F389661

General Info

Members Datasets Scaffolds Average Seq Length
290 208 580 337

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100051566|Ga0068857_1000515662
Length 367
Sequence VIHSNQTRPDRLLTGHFQLSSGKILFENRPTSDDALAEEELLMNFSDNATGLGFQSELTPAFNRRDFLRLTVATTVAMTALPQVWSAETNGNIPYRKLGRTGEKISAIGVGGFHIGNPPEEEGIRIIRTAIDSGINFMDNSWDYHDGGSEIRMGKALKDGYREKAFLMTKIDGDLMQFHEIIRMEDPDRIFAEGGALEAMLAAKKAGKVRYIGFTGHKDPTIHLRMLETAAKHKFHFDAVQMPLNVMDAHFRSFQKQVLPVLVKEEIGVLGMKPLASGLILKSNTAKPIECLHYALSLPTSTVITGMDKMEILQQALEATRTFKPMSEQQIAALLGQTAEAASEGKFELFKTETRFDATAHNPQWLG

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
154 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
155 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
156 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
157 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
158 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
159 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
160 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
161 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
171 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
172 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
173 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
174 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
175 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
178 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
179 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
180 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
183 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
186 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
191 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
194 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
195 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
196 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
197 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
198 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
199 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
200 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
206 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
207 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
208 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.17
Metatranscriptomes 3.45
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100051566 3300005577 Bacteria 3651
2 Ga0058862_12845602 3300004803 Unclassified 1473
3 Ga0070658_10000004 3300005327 Bacteria 402230
4 Ga0070658_10095349 3300005327 Bacteria 2456
5 Ga0070658_10115533 3300005327 Bacteria 2226
6 Ga0070658_10206381 3300005327 Bacteria 1659
7 Ga0070658_10265597 3300005327 Bacteria 1458
8 Ga0070683_100008004 3300005329 Bacteria 8969
9 Ga0070683_100288867 3300005329 Bacteria 1560
10 Ga0070670_100087202 3300005331 Unclassified 2682
11 Ga0070666_10058182 3300005335 Bacteria 2613
12 Ga0070680_100170727 3300005336 Bacteria 1830
13 Ga0068868_100099186 3300005338 Bacteria 2356
14 Ga0070661_100015228 3300005344 Bacteria 5427
15 Ga0070661_100090115 3300005344 Bacteria 2271
16 Ga0070661_100239065 3300005344 Bacteria 1398
17 Ga0070675_100122956 3300005354 Bacteria 2206
18 Ga0070671_100001552 3300005355 Bacteria 17296
19 Ga0070659_100009323 3300005366 Bacteria 7209
20 Ga0070659_100220823 3300005366 Bacteria 1564
21 Ga0070714_100299350 3300005435 Bacteria 1499
22 Ga0070708_100067611 3300005445 Bacteria 3209
23 Ga0070663_100019980 3300005455 Bacteria 4424
24 Ga0070681_10006476 3300005458 Bacteria 11399
25 Ga0070681_10408433 3300005458 Bacteria 1270
26 Ga0070706_100179068 3300005467 Bacteria 1979
27 Ga0070707_100368258 3300005468 Bacteria 1396
28 Ga0070699_100011041 3300005518 Bacteria 7808
29 Ga0070679_100021589 3300005530 Bacteria 6286
30 Ga0070679_100063996 3300005530 Bacteria 3665
31 Ga0070684_100024128 3300005535 Bacteria 5099
32 Ga0070697_100005629 3300005536 Bacteria 9659
33 Ga0068853_100036673 3300005539 Bacteria 4170
34 Ga0068853_100207275 3300005539 Bacteria 1786
35 Ga0070686_100117956 3300005544 Unclassified 1818
36 Ga0068855_100024466 3300005563 Bacteria 7224
37 Ga0068855_100025395 3300005563 Bacteria 7089
38 Ga0068855_100047088 3300005563 Bacteria 5095
39 Ga0068855_100054746 3300005563 Bacteria 4689
40 Ga0068855_100103323 3300005563 Bacteria 3278
41 Ga0068855_100135896 3300005563 Bacteria 2805
42 Ga0070664_100056572 3300005564 Bacteria 3333
43 Ga0070664_100070013 3300005564 Bacteria 3003
44 Ga0068857_100008365 3300005577 Bacteria 8940
45 Ga0068857_100036255 3300005577 Bacteria 4370
46 Ga0068854_100002687 3300005578 Bacteria 11024
47 Ga0068854_100059052 3300005578 Bacteria 2771
48 Ga0068856_100024239 3300005614 Bacteria 5904
49 Ga0068856_100027180 3300005614 Bacteria 5582
50 Ga0068856_100033551 3300005614 Bacteria 5026
51 Ga0068852_100000057 3300005616 Bacteria 75410
52 Ga0068852_100025303 3300005616 Bacteria 4808
53 Ga0068852_100138167 3300005616 Bacteria 2252
54 Ga0068852_100200749 3300005616 Bacteria 1887
55 Ga0068851_10028762 3300005834 Bacteria 2746
56 Ga0068858_100010081 3300005842 Bacteria 8970
57 Ga0068860_100253559 3300005843 Bacteria 1714
58 Ga0081540_1007314 3300005983 Bacteria 7896
59 Ga0070717_10011580 3300006028 Bacteria 6704
60 Ga0068871_100129047 3300006358 Bacteria 2142
61 Ga0075428_100389076 3300006844 Bacteria 1495
62 Ga0075430_100051883 3300006846 Bacteria 3454
63 Ga0075431_100129834 3300006847 Bacteria 2600
64 Ga0099794_10036477 3300007265 Bacteria 2324
65 Ga0099794_10068927 3300007265 Unclassified 1730
66 Ga0105240_10000454 3300009093 Bacteria 75423
67 Ga0105240_10022149 3300009093 Bacteria 8431
68 Ga0105240_10235216 3300009093 Bacteria 2127
69 Ga0105241_10000623 3300009174 Bacteria 26614
70 Ga0105237_10029118 3300009545 Bacteria 5617
71 Ga0105238_10071183 3300009551 Bacteria 3475
72 Ga0105238_10077821 3300009551 Bacteria 3308
73 Ga0105239_10084957 3300010375 Bacteria 3487
74 Ga0105239_10086051 3300010375 Bacteria 3464
75 Ga0157373_10171203 3300013100 Unclassified 1528
76 Ga0157371_10145883 3300013102 Unclassified 1686
77 Ga0157370_10000107 3300013104 Bacteria 95413
78 Ga0157370_10072956 3300013104 Unclassified 3238
79 Ga0157370_10130657 3300013104 Bacteria 2343
80 Ga0157369_10000244 3300013105 Bacteria 75434
81 Ga0157369_10007174 3300013105 Bacteria 12842
82 Ga0157369_10040184 3300013105 Bacteria 5108
83 Ga0157369_10043432 3300013105 Bacteria 4899
84 Ga0157369_10313743 3300013105 Bacteria 1630
85 Ga0157374_10031928 3300013296 Bacteria 4791
86 Ga0157374_10204334 3300013296 Bacteria 1935
87 Ga0157378_10044397 3300013297 Bacteria 3947
88 Ga0163162_10223238 3300013306 Bacteria 2014
89 Ga0157372_10000650 3300013307 Bacteria 38163
90 Ga0157372_10031280 3300013307 Bacteria 5827
91 Ga0157372_10060431 3300013307 Bacteria 4241
92 Ga0157372_10092248 3300013307 Bacteria 3445
93 Ga0157372_10108310 3300013307 Bacteria 3180
94 Ga0157372_10118795 3300013307 Bacteria 3034
95 Ga0157372_10384287 3300013307 Bacteria 1636
96 Ga0157375_10000063 3300013308 Bacteria 113258
97 Ga0197907_10713196 3300020069 Bacteria 3720
98 Ga0206352_10306503 3300020078 Unclassified 1367
99 Ga0206350_10087336 3300020080 Bacteria 1280
100 Ga0206350_11215676 3300020080 Bacteria 5855
101 Ga0154015_1598718 3300020610 Bacteria 1422
102 Ga0213872_10001502 3300021361 Bacteria 15026
103 Ga0213875_10033692 3300021388 Unclassified 2419
104 Ga0224712_10001473 3300022467 Bacteria 5431
105 Ga0224712_10060580 3300022467 Unclassified 1506
106 Ga0224712_10135436 3300022467 Bacteria 1079
107 Ga0224712_10146612 3300022467 Bacteria 1043
108 Ga0207656_10047214 3300025321 Bacteria 1850
109 Ga0207647_10017566 3300025904 Bacteria 4862
110 Ga0207705_10000013 3300025909 Bacteria 451680
111 Ga0207705_10002679 3300025909 Bacteria 13632
112 Ga0207684_10000713 3300025910 Bacteria 39081
113 Ga0207654_10001417 3300025911 Bacteria 12720
114 Ga0207707_10017506 3300025912 Bacteria 6247
115 Ga0207707_10190040 3300025912 Bacteria 1792
116 Ga0207695_10000570 3300025913 Bacteria 75451
117 Ga0207695_10004352 3300025913 Bacteria 19395
118 Ga0207695_10205771 3300025913 Bacteria 1881
119 Ga0207657_10002757 3300025919 Bacteria 18918
120 Ga0207652_10033826 3300025921 Unclassified 4305
121 Ga0207694_10045634 3300025924 Bacteria 3385
122 Ga0207694_10211622 3300025924 Bacteria 1579
123 Ga0207694_10299522 3300025924 Bacteria 1324
124 Ga0207650_10066946 3300025925 Unclassified 2694
125 Ga0207644_10207009 3300025931 Bacteria 1549
126 Ga0207711_10038782 3300025941 Bacteria 4051
127 Ga0207661_10013756 3300025944 Bacteria 5910
128 Ga0207661_10321594 3300025944 Bacteria 1391
129 Ga0207679_10056200 3300025945 Bacteria 2905
130 Ga0207667_10027849 3300025949 Bacteria 6144
131 Ga0207667_10030010 3300025949 Bacteria 5888
132 Ga0207667_10053442 3300025949 Bacteria 4251
133 Ga0207667_10117874 3300025949 Bacteria 2736
134 Ga0207667_10463071 3300025949 Unclassified 1287
135 Ga0207667_10485484 3300025949 Bacteria 1254
136 Ga0207651_10114199 3300025960 Bacteria 2034
137 Ga0207640_10016394 3300025981 Bacteria 4310
138 Ga0207703_10007541 3300026035 Bacteria 8630
139 Ga0207678_10000626 3300026067 Bacteria 32290
140 Ga0207641_10182165 3300026088 Bacteria 1925
141 Ga0207676_10145621 3300026095 Bacteria 2034
142 Ga0207674_10003832 3300026116 Bacteria 18334
143 Ga0207674_10023454 3300026116 Bacteria 6610
144 Ga0207674_10062659 3300026116 Bacteria 3756
145 Ga0207698_10000033 3300026142 Bacteria 110484
146 Ga0207698_10065925 3300026142 Bacteria 2847
147 Ga0207698_10096517 3300026142 Bacteria 2436
148 Ga0207698_10113777 3300026142 Bacteria 2275
149 Ga0268266_10009326 3300028379 Bacteria 8653
150 Ga0268265_10298365 3300028380 Bacteria 1450
151 Ga0268264_10154065 3300028381 Bacteria 2063
152 Ga0268264_10402635 3300028381 Bacteria 1316
153 Ga0265326_10012450 3300028558 Unclassified 2500
154 Ga0265326_10027109 3300028558 Unclassified 1634
155 Ga0265338_10000607 3300028800 Bacteria 62806
156 Ga0265338_10021388 3300028800 Bacteria 6748
157 Ga0265338_10038235 3300028800 Bacteria 4551
158 Ga0265324_10014567 3300029957 Bacteria 2906
159 Ga0265330_10041809 3300031235 Bacteria 2032
160 Ga0265339_10068752 3300031249 Unclassified 1892
161 Ga0265339_10071156 3300031249 Bacteria 1854
162 Ga0265316_10000021 3300031344 Bacteria 185946
163 Ga0265316_10040729 3300031344 Bacteria 3722
164 Ga0265316_10329037 3300031344 Bacteria 1109
165 Ga0265314_10035775 3300031711 Bacteria 3617
166 Ga0265314_10207560 3300031711 Bacteria 1153
167 Ga0307411_10001112 3300032005 Bacteria 10477
168 Ga0307415_100002976 3300032126 Bacteria 8517
169 Ga0373937_0103708 3300036401 Bacteria 2642
170 Ga0373925_0071516 3300037068 Bacteria 2624
171 Ga0436364_0050743 3300037853 Bacteria 4310
172 Ga0436364_0250724 3300037853 Bacteria 9889
173 Ga0436364_0470530 3300037853 Bacteria 2082
174 Ga0436365_0194972 3300039437 Bacteria 39396
175 Ga0436365_0543788 3300039437 Bacteria 5726
176 Ga0436360_0543996 3300039438 Bacteria 21564
177 Ga0436361_0761235 3300039447 Bacteria 90297
178 Ga0436363_1683511 3300039450 Bacteria 1704
179 Ga0451791_1609464 3300041451 Bacteria 2209
180 Ga0466966_0057453 3300044684 Bacteria 2460
181 Ga0466963_0009702 3300044694 Bacteria 5807
182 Ga0453684_0002112 3300044712 Bacteria 50157
183 Ga0451576_0006779 3300045051 Bacteria 13937
184 Ga0466967_0001022 3300045976 Bacteria 15345
185 Ga0495603_0076795 3300046455 Bacteria 1960
186 Ga0495629_0001291 3300046459 Bacteria 19702
187 Ga0495651_0001801 3300046462 Bacteria 16523
188 Ga0495653_0001137 3300046463 Bacteria 20491
189 Ga0495580_0021911 3300046472 Bacteria 4710
190 Ga0495582_0003128 3300046473 Bacteria 9284
191 Ga0495582_0101861 3300046473 Bacteria 1608
192 Ga0495639_0001430 3300046475 Bacteria 10669
193 Ga0495662_0000730 3300046476 Bacteria 15702
194 Ga0495664_0001463 3300046477 Bacteria 12508
195 Ga0495585_0039894 3300046492 Bacteria 2638
196 Ga0495594_0000765 3300046499 Bacteria 16490
197 Ga0495594_0001153 3300046499 Bacteria 13809
198 Ga0495594_0003687 3300046499 Bacteria 7866
199 Ga0495608_0011111 3300046511 Bacteria 6269
200 Ga0495618_0047001 3300046514 Bacteria 2725
201 Ga0495628_0072864 3300046516 Bacteria 2676
202 Ga0495630_0303450 3300046517 Bacteria 1220
203 Ga0495644_0000078 3300046523 Bacteria 48386
204 Ga0495666_0001110 3300046526 Bacteria 12885
205 Ga0495652_0009741 3300046529 Bacteria 8714
206 Ga0495665_0002266 3300046531 Bacteria 10422
207 Ga0495586_0027612 3300046535 Bacteria 3036
208 Ga0495609_0012875 3300046538 Bacteria 3959
209 Ga0495609_0079915 3300046538 Bacteria 1430
210 Ga0495645_0000476 3300046543 Bacteria 27726
211 Ga0495667_0019473 3300046559 Bacteria 4579
212 Ga0495634_0001320 3300046642 Bacteria 22642
213 Ga0495625_0072456 3300046660 Bacteria 2416
214 Ga0495635_0007800 3300046663 Bacteria 7473
215 Ga0495646_0009249 3300046680 Bacteria 6252
216 Ga0495613_0024876 3300046689 Bacteria 4461
217 Ga0495624_0007179 3300046690 Bacteria 7840
218 Ga0495670_0031064 3300046691 Bacteria 2654
219 Ga0495600_0003012 3300046809 Bacteria 9834
220 Ga0495581_0000532 3300047315 Bacteria 19579
221 Ga0495581_0078984 3300047315 Bacteria 1904
222 Ga0495604_0005961 3300047317 Bacteria 9671
223 Ga0495674_0011737 3300047319 Bacteria 8263
224 Ga0495672_0000951 3300047320 Bacteria 30208
225 Ga0495676_0002396 3300047321 Bacteria 16644
226 Ga0495675_0002159 3300047444 Bacteria 11723
227 Ga0495685_020898 3300047447 Bacteria 2251
228 Ga0495684_0024850 3300047471 Bacteria 4607
229 Ga0495593_0042263 3300047673 Bacteria 2447
230 Ga0495614_0000272 3300048089 Bacteria 20187
231 Ga0496112_0296714 3300048915 Bacteria 1562
232 Ga0496126_0000231 3300048929 Bacteria 120254
233 Ga0501291_000135 3300049514 Bacteria 9071
234 Ga0501292_005358 3300049515 Bacteria 1787
235 Ga0501294_000767 3300049517 Bacteria 3537
236 Ga0501296_002218 3300049519 Bacteria 2014
237 Ga0501297_000043 3300049520 Bacteria 12938
238 Ga0501298_000216 3300049521 Bacteria 7341
239 Ga0501300_000045 3300049523 Bacteria 17589
240 Ga0501301_000651 3300049524 Bacteria 2146
241 Ga0501303_000213 3300049526 Bacteria 4819
242 Ga0501032_0000749 3300049569 Bacteria 26407
243 Ga0501033_0011738 3300049570 Bacteria 6699
244 Ga0501038_0002314 3300049574 Bacteria 17714
245 Ga0501043_0000743 3300049579 Bacteria 28889
246 Ga0501046_0000830 3300049580 Bacteria 30101
247 Ga0501047_0000993 3300049581 Bacteria 28616
248 Ga0501047_0143895 3300049581 Bacteria 2262
249 Ga0501047_0333873 3300049581 Bacteria 1354
250 Ga0501070_0041215 3300049586 Bacteria 3847
251 Ga0501076_0138253 3300049592 Bacteria 1978
252 Ga0501198_012464 3300049649 Bacteria 1279
253 Ga0501206_000463 3300049653 Bacteria 4892
254 Ga0501209_002130 3300049656 Bacteria 2975
255 Ga0501211_001341 3300049658 Bacteria 2627
256 Ga0501214_001816 3300049659 Bacteria 1711
257 Ga0501230_000061 3300049667 Bacteria 7079
258 Ga0501235_001282 3300049669 Bacteria 5307
259 Ga0501236_000413 3300049670 Bacteria 4789
260 Ga0501239_001060 3300049672 Bacteria 2276
261 Ga0501242_006235 3300049674 Bacteria 1358
262 Ga0501243_001522 3300049675 Bacteria 3329
263 Ga0501249_002476 3300049679 Bacteria 3733
264 Ga0501250_007047 3300049680 Bacteria 1204
265 Ga0501251_000122 3300049681 Bacteria 6437
266 Ga0501257_012991 3300049686 Bacteria 1908
267 Ga0501258_002460 3300049687 Bacteria 1627
268 Ga0501261_000466 3300049690 Bacteria 5201
269 Ga0501225_0000320 3300049705 Bacteria 15043
270 Ga0501234_001097 3300049707 Bacteria 4279
271 Ga0501080_0040843 3300049742 Bacteria 4326
272 Ga0501262_002077 3300049759 Bacteria 2263
273 Ga0501265_001222 3300049762 Bacteria 2912
274 Ga0501266_000183 3300049763 Bacteria 7978
275 Ga0501271_002695 3300049768 Bacteria 1601
276 Ga0501275_000467 3300049772 Bacteria 4550
277 Ga0501276_003097 3300049773 Bacteria 1196
278 Ga0501279_000124 3300049775 Bacteria 11385
279 Ga0501280_012842 3300049776 Bacteria 1180
280 Ga0501281_01222 3300049777 Bacteria 2043
281 Ga0501282_000706 3300049778 Bacteria 3831
282 Ga0501283_000105 3300049779 Bacteria 10206
283 Ga0501035_0068570 3300049822 Bacteria 3144
284 Ga0501044_0187652 3300049823 Bacteria 2031
285 Ga0501226_000906 3300049853 Bacteria 3959
286 nmdc:mga0qj67_57640_c1 3300050509 Bacteria 3079
287 2617914022 2617270889 Bacteria 9064343
288 2884217183 2884215851 Bacteria 4554841
289 2913844704 2913844669 Bacteria 8381711
290 642605441 642555144 Bacteria 9059191
291 Ga0068857_100051566
292 Ga0058862_12845602
293 Ga0070658_10000004
294 Ga0070658_10095349
295 Ga0070658_10115533
296 Ga0070658_10206381
297 Ga0070658_10265597
298 Ga0070683_100008004
299 Ga0070683_100288867
300 Ga0070670_100087202
301 Ga0070666_10058182
302 Ga0070680_100170727
303 Ga0068868_100099186
304 Ga0070661_100015228
305 Ga0070661_100090115
306 Ga0070661_100239065
307 Ga0070675_100122956
308 Ga0070671_100001552
309 Ga0070659_100009323
310 Ga0070659_100220823
311 Ga0070714_100299350
312 Ga0070708_100067611
313 Ga0070663_100019980
314 Ga0070681_10006476
315 Ga0070681_10408433
316 Ga0070706_100179068
317 Ga0070707_100368258
318 Ga0070699_100011041
319 Ga0070679_100021589
320 Ga0070679_100063996
321 Ga0070684_100024128
322 Ga0070697_100005629
323 Ga0068853_100036673
324 Ga0068853_100207275
325 Ga0070686_100117956
326 Ga0068855_100024466
327 Ga0068855_100025395
328 Ga0068855_100047088
329 Ga0068855_100054746
330 Ga0068855_100103323
331 Ga0068855_100135896
332 Ga0070664_100056572
333 Ga0070664_100070013
334 Ga0068857_100008365
335 Ga0068857_100036255
336 Ga0068854_100002687
337 Ga0068854_100059052
338 Ga0068856_100024239
339 Ga0068856_100027180
340 Ga0068856_100033551
341 Ga0068852_100000057
342 Ga0068852_100025303
343 Ga0068852_100138167
344 Ga0068852_100200749
345 Ga0068851_10028762
346 Ga0068858_100010081
347 Ga0068860_100253559
348 Ga0081540_1007314
349 Ga0070717_10011580
350 Ga0068871_100129047
351 Ga0075428_100389076
352 Ga0075430_100051883
353 Ga0075431_100129834
354 Ga0099794_10036477
355 Ga0099794_10068927
356 Ga0105240_10000454
357 Ga0105240_10022149
358 Ga0105240_10235216
359 Ga0105241_10000623
360 Ga0105237_10029118
361 Ga0105238_10071183
362 Ga0105238_10077821
363 Ga0105239_10084957
364 Ga0105239_10086051
365 Ga0157373_10171203
366 Ga0157371_10145883
367 Ga0157370_10000107
368 Ga0157370_10072956
369 Ga0157370_10130657
370 Ga0157369_10000244
371 Ga0157369_10007174
372 Ga0157369_10040184
373 Ga0157369_10043432
374 Ga0157369_10313743
375 Ga0157374_10031928
376 Ga0157374_10204334
377 Ga0157378_10044397
378 Ga0163162_10223238
379 Ga0157372_10000650
380 Ga0157372_10031280
381 Ga0157372_10060431
382 Ga0157372_10092248
383 Ga0157372_10108310
384 Ga0157372_10118795
385 Ga0157372_10384287
386 Ga0157375_10000063
387 Ga0197907_10713196
388 Ga0206352_10306503
389 Ga0206350_10087336
390 Ga0206350_11215676
391 Ga0154015_1598718
392 Ga0213872_10001502
393 Ga0213875_10033692
394 Ga0224712_10001473
395 Ga0224712_10060580
396 Ga0224712_10135436
397 Ga0224712_10146612
398 Ga0207656_10047214
399 Ga0207647_10017566
400 Ga0207705_10000013
401 Ga0207705_10002679
402 Ga0207684_10000713
403 Ga0207654_10001417
404 Ga0207707_10017506
405 Ga0207707_10190040
406 Ga0207695_10000570
407 Ga0207695_10004352
408 Ga0207695_10205771
409 Ga0207657_10002757
410 Ga0207652_10033826
411 Ga0207694_10045634
412 Ga0207694_10211622
413 Ga0207694_10299522
414 Ga0207650_10066946
415 Ga0207644_10207009
416 Ga0207711_10038782
417 Ga0207661_10013756
418 Ga0207661_10321594
419 Ga0207679_10056200
420 Ga0207667_10027849
421 Ga0207667_10030010
422 Ga0207667_10053442
423 Ga0207667_10117874
424 Ga0207667_10463071
425 Ga0207667_10485484
426 Ga0207651_10114199
427 Ga0207640_10016394
428 Ga0207703_10007541
429 Ga0207678_10000626
430 Ga0207641_10182165
431 Ga0207676_10145621
432 Ga0207674_10003832
433 Ga0207674_10023454
434 Ga0207674_10062659
435 Ga0207698_10000033
436 Ga0207698_10065925
437 Ga0207698_10096517
438 Ga0207698_10113777
439 Ga0268266_10009326
440 Ga0268265_10298365
441 Ga0268264_10154065
442 Ga0268264_10402635
443 Ga0265326_10012450
444 Ga0265326_10027109
445 Ga0265338_10000607
446 Ga0265338_10021388
447 Ga0265338_10038235
448 Ga0265324_10014567
449 Ga0265330_10041809
450 Ga0265339_10068752
451 Ga0265339_10071156
452 Ga0265316_10000021
453 Ga0265316_10040729
454 Ga0265316_10329037
455 Ga0265314_10035775
456 Ga0265314_10207560
457 Ga0307411_10001112
458 Ga0307415_100002976
459 Ga0373937_0103708
460 Ga0373925_0071516
461 Ga0436364_0050743
462 Ga0436364_0250724
463 Ga0436364_0470530
464 Ga0436365_0194972
465 Ga0436365_0543788
466 Ga0436360_0543996
467 Ga0436361_0761235
468 Ga0436363_1683511
469 Ga0451791_1609464
470 Ga0466966_0057453
471 Ga0466963_0009702
472 Ga0453684_0002112
473 Ga0451576_0006779
474 Ga0466967_0001022
475 Ga0495603_0076795
476 Ga0495629_0001291
477 Ga0495651_0001801
478 Ga0495653_0001137
479 Ga0495580_0021911
480 Ga0495582_0003128
481 Ga0495582_0101861
482 Ga0495639_0001430
483 Ga0495662_0000730
484 Ga0495664_0001463
485 Ga0495585_0039894
486 Ga0495594_0000765
487 Ga0495594_0001153
488 Ga0495594_0003687
489 Ga0495608_0011111
490 Ga0495618_0047001
491 Ga0495628_0072864
492 Ga0495630_0303450
493 Ga0495644_0000078
494 Ga0495666_0001110
495 Ga0495652_0009741
496 Ga0495665_0002266
497 Ga0495586_0027612
498 Ga0495609_0012875
499 Ga0495609_0079915
500 Ga0495645_0000476
501 Ga0495667_0019473
502 Ga0495634_0001320
503 Ga0495625_0072456
504 Ga0495635_0007800
505 Ga0495646_0009249
506 Ga0495613_0024876
507 Ga0495624_0007179
508 Ga0495670_0031064
509 Ga0495600_0003012
510 Ga0495581_0000532
511 Ga0495581_0078984
512 Ga0495604_0005961
513 Ga0495674_0011737
514 Ga0495672_0000951
515 Ga0495676_0002396
516 Ga0495675_0002159
517 Ga0495685_020898
518 Ga0495684_0024850
519 Ga0495593_0042263
520 Ga0495614_0000272
521 Ga0496112_0296714
522 Ga0496126_0000231
523 Ga0501291_000135
524 Ga0501292_005358
525 Ga0501294_000767
526 Ga0501296_002218
527 Ga0501297_000043
528 Ga0501298_000216
529 Ga0501300_000045
530 Ga0501301_000651
531 Ga0501303_000213
532 Ga0501032_0000749
533 Ga0501033_0011738
534 Ga0501038_0002314
535 Ga0501043_0000743
536 Ga0501046_0000830
537 Ga0501047_0000993
538 Ga0501047_0143895
539 Ga0501047_0333873
540 Ga0501070_0041215
541 Ga0501076_0138253
542 Ga0501198_012464
543 Ga0501206_000463
544 Ga0501209_002130
545 Ga0501211_001341
546 Ga0501214_001816
547 Ga0501230_000061
548 Ga0501235_001282
549 Ga0501236_000413
550 Ga0501239_001060
551 Ga0501242_006235
552 Ga0501243_001522
553 Ga0501249_002476
554 Ga0501250_007047
555 Ga0501251_000122
556 Ga0501257_012991
557 Ga0501258_002460
558 Ga0501261_000466
559 Ga0501225_0000320
560 Ga0501234_001097
561 Ga0501080_0040843
562 Ga0501262_002077
563 Ga0501265_001222
564 Ga0501266_000183
565 Ga0501271_002695
566 Ga0501275_000467
567 Ga0501276_003097
568 Ga0501279_000124
569 Ga0501280_012842
570 Ga0501281_01222
571 Ga0501282_000706
572 Ga0501283_000105
573 Ga0501035_0068570
574 Ga0501044_0187652
575 Ga0501226_000906
576 nmdc:mga0qj67_57640_c1
577 2617914022
578 2884217183
579 2913844704
580 642605441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

107

186

0.91

PF00248

Aldo_ket_red

Aldo/keto reductase family

172

291

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.8227 27 298
4q3m-assembly3.cif.gz_F crystal structure of mgs-m4, an aldo-keto reductase enzyme from a medee basin deep-sea metagenome library 0.8159 32 297
4ast-assembly1.cif.gz_B the apo structure of a bacterial aldo-keto reductase akr14a1 0.8156 27 295
1vbj-assembly2.cif.gz_B the crystal structure of prostaglandin f synthase from trypanosoma brucei 0.8149 27 295
4aub-assembly1.cif.gz_F the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate 0.8147 27 295
ID Description Score Start End Superfamily
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9218 29 134 3.20.20.100
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.889 28 136 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8438 28 200 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8411 29 108 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8312 28 294 3.20.20.100
ID Description Score Start End GO Terms
AF-K2ASJ7-F1-model_v4 Oxidoreductase-related protein 0.9941 28 202
AF-A0A150R877-F1-model_v4 Aldo/keto reductase 0.9928 28 324
AF-A0A4P2R1Z1-F1-model_v4 Aldo/keto reductase 0.9928 27 324
AF-A0A3D1R786-F1-model_v4 Aldo/keto reductase 0.992 27 325
AF-A0A2V9L913-F1-model_v4 Aldo/keto reductase 0.9907 28 325

Map