F389659

General Info

Members Datasets Scaffolds Average Seq Length
290 159 289 211

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100548656|Ga0070664_1005486562
Length 230
Sequence MRRRNIRSEAEPTFEVLPLAGADVGYAADAFTPRADALFEALHREIPWEQHRLHIFGREVASPRLSCWIGDAGTAYRYSGSLFEPRAWTPTLAALRHELRDRFDLQFNSVLANLYRDGSDSMGWHSDAEPELGKEPVIASLSFGAVRRFRFRSRETKRVVLAIDLASGSLLVMRGATQRLYHHDLPKTARAGARINLTFRMIRSKSLLPHAGERYGEGRVESRQRTKQSR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
159 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.83
Nodule 0
Rhizoplane 2.76
Rhizosphere 77.59
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001924 3300001989 Bacteria 7939
2 JGI24737J22298_10000189 3300001990 Bacteria 19911
3 JGI24735J21928_10000048 3300002067 Bacteria 51228
4 Ga0055524_1005871 3300003775 Bacteria 5416
5 Ga0055524_1020268 3300003775 Bacteria 2246
6 Ga0055536_1002805 3300003781 Bacteria 9623
7 Ga0055536_1007437 3300003781 Bacteria 4903
8 Ga0055530_10003834 3300003791 Bacteria 8251
9 Ga0055531_10001978 3300003794 Bacteria 14281
10 Ga0055531_10008870 3300003794 Bacteria 5224
11 Ga0055531_10017109 3300003794 Bacteria 3080
12 Ga0055531_10021978 3300003794 Bacteria 2450
13 Ga0055531_10024193 3300003794 Bacteria 2250
14 Ga0070658_10346548 3300005327 Unclassified 1271
15 Ga0070658_11096195 3300005327 Bacteria 692
16 Ga0070683_100019696 3300005329 Bacteria 5995
17 Ga0070683_100271642 3300005329 Bacteria 1613
18 Ga0070670_100466631 3300005331 Bacteria 1120
19 Ga0068869_100026006 3300005334 Bacteria 4070
20 Ga0068869_100169687 3300005334 Bacteria 1704
21 Ga0068869_100934990 3300005334 Bacteria 752
22 Ga0070666_10090894 3300005335 Bacteria 2097
23 Ga0070666_10176550 3300005335 Bacteria 1498
24 Ga0070689_100123652 3300005340 Bacteria 2069
25 Ga0070689_100321811 3300005340 Bacteria 1292
26 Ga0070661_100079302 3300005344 Bacteria 2422
27 Ga0070668_100845893 3300005347 Bacteria 815
28 Ga0070669_100085706 3300005353 Bacteria 2352
29 Ga0070671_100197531 3300005355 Bacteria 1705
30 Ga0070688_100373246 3300005365 Bacteria 1050
31 Ga0070659_100020448 3300005366 Bacteria 5028
32 Ga0070667_100027012 3300005367 Bacteria 4774
33 Ga0070667_100040180 3300005367 Bacteria 3922
34 Ga0070667_100242512 3300005367 Bacteria 1609
35 Ga0070663_100058052 3300005455 Bacteria 2778
36 Ga0070662_100128656 3300005457 Bacteria 1950
37 Ga0070681_10020370 3300005458 Bacteria 6647
38 Ga0070681_10487203 3300005458 Bacteria 1146
39 Ga0068867_100530286 3300005459 Bacteria 1017
40 Ga0070684_100033622 3300005535 Bacteria 4379
41 Ga0068853_100002428 3300005539 Bacteria 13933
42 Ga0068853_100154900 3300005539 Bacteria 2064
43 Ga0068853_100277572 3300005539 Bacteria 1544
44 Ga0068853_100522577 3300005539 Bacteria 1122
45 Ga0070686_100115143 3300005544 Bacteria 1838
46 Ga0070665_100000026 3300005548 Bacteria 365176
47 Ga0070665_100580701 3300005548 Bacteria 1134
48 Ga0070665_100623613 3300005548 Bacteria 1091
49 Ga0070665_100639336 3300005548 Bacteria 1077
50 Ga0068855_100095596 3300005563 Bacteria 3424
51 Ga0070664_100134294 3300005564 Bacteria 2175
52 Ga0070664_100548656 3300005564 Bacteria 1069
53 Ga0068857_100025890 3300005577 Bacteria 5167
54 Ga0068857_100414310 3300005577 Bacteria 1255
55 Ga0068854_100003891 3300005578 Bacteria 9357
56 Ga0068854_100114768 3300005578 Bacteria 2037
57 Ga0068856_100009013 3300005614 Bacteria 9707
58 Ga0068856_100054143 3300005614 Bacteria 3957
59 Ga0068856_100060668 3300005614 Bacteria 3736
60 Ga0068856_100178008 3300005614 Bacteria 2139
61 Ga0068856_100292885 3300005614 Bacteria 1644
62 Ga0068852_100006698 3300005616 Bacteria 8353
63 Ga0068852_100034398 3300005616 Bacteria 4215
64 Ga0068852_100037940 3300005616 Bacteria 4045
65 Ga0068852_100105687 3300005616 Bacteria 2551
66 Ga0068852_100215143 3300005616 Bacteria 1825
67 Ga0068859_100001424 3300005617 Bacteria 24282
68 Ga0068859_100015133 3300005617 Bacteria 7743
69 Ga0068864_100006327 3300005618 Bacteria 9710
70 Ga0068861_100053361 3300005719 Bacteria 3075
71 Ga0068851_10030037 3300005834 Bacteria 2693
72 Ga0068851_10095456 3300005834 Bacteria 1571
73 Ga0068851_10099593 3300005834 Bacteria 1540
74 Ga0068863_100009483 3300005841 Bacteria 9493
75 Ga0068863_100032368 3300005841 Bacteria 4984
76 Ga0068863_100087076 3300005841 Bacteria 2959
77 Ga0068863_100089693 3300005841 Bacteria 2915
78 Ga0068863_100624843 3300005841 Unclassified 1067
79 Ga0068858_100741090 3300005842 Bacteria 957
80 Ga0068860_100017903 3300005843 Bacteria 6899
81 Ga0068860_100077905 3300005843 Bacteria 3153
82 Ga0081540_1033154 3300005983 Bacteria 2809
83 Ga0097621_100246427 3300006237 Bacteria 1563
84 Ga0097621_100359036 3300006237 Bacteria 1297
85 Ga0097621_100391061 3300006237 Bacteria 1243
86 Ga0068871_100025811 3300006358 Bacteria 4577
87 Ga0068871_100184909 3300006358 Bacteria 1792
88 Ga0068865_100039066 3300006881 Bacteria 3217
89 Ga0068865_100044518 3300006881 Bacteria 3038
90 Ga0068865_100101254 3300006881 Bacteria 2109
91 Ga0097620_100001424 3300006931 Bacteria 24282
92 Ga0097620_100015133 3300006931 Bacteria 7743
93 Ga0105240_10044537 3300009093 Bacteria 5638
94 Ga0105240_10080372 3300009093 Bacteria 4009
95 Ga0105245_10256613 3300009098 Bacteria 1700
96 Ga0105247_10294174 3300009101 Bacteria 1124
97 Ga0105243_10252539 3300009148 Bacteria 1575
98 Ga0105241_10004054 3300009174 Bacteria 10837
99 Ga0105241_10065893 3300009174 Bacteria 2800
100 Ga0105241_10213363 3300009174 Bacteria 1618
101 Ga0105241_10752422 3300009174 Bacteria 894
102 Ga0105242_10001521 3300009176 Bacteria 18231
103 Ga0105248_10271877 3300009177 Bacteria 1908
104 Ga0105237_10028694 3300009545 Bacteria 5664
105 Ga0105237_10157200 3300009545 Bacteria 2271
106 Ga0105238_10042076 3300009551 Bacteria 4626
107 Ga0105238_10044240 3300009551 Bacteria 4502
108 Ga0105238_10168783 3300009551 Bacteria 2164
109 Ga0105239_10010305 3300010375 Bacteria 10469
110 Ga0105239_10019000 3300010375 Bacteria 7594
111 Ga0105239_10550053 3300010375 Bacteria 1314
112 Ga0105246_10052896 3300011119 Bacteria 2793
113 Ga0157371_10028873 3300013102 Bacteria 4016
114 Ga0157370_10002937 3300013104 Bacteria 20291
115 Ga0157370_10156848 3300013104 Bacteria 2118
116 Ga0157370_10168236 3300013104 Bacteria 2038
117 Ga0157370_10244792 3300013104 Bacteria 1659
118 Ga0157369_10003913 3300013105 Bacteria 17658
119 Ga0157369_10018584 3300013105 Bacteria 7792
120 Ga0157374_10266726 3300013296 Bacteria 1688
121 Ga0157374_10424207 3300013296 Bacteria 1329
122 Ga0163162_10018425 3300013306 Bacteria 6840
123 Ga0163162_10262545 3300013306 Bacteria 1858
124 Ga0157372_10000120 3300013307 Bacteria 83586
125 Ga0157372_10003498 3300013307 Bacteria 16924
126 Ga0157372_10167045 3300013307 Bacteria 2545
127 Ga0157375_10004905 3300013308 Bacteria 11631
128 Ga0163163_10016248 3300014325 Bacteria 6910
129 Ga0163163_10038492 3300014325 Bacteria 4662
130 Ga0182008_10052150 3300014497 Bacteria 2028
131 Ga0157379_10008254 3300014968 Bacteria 9047
132 Ga0157379_11071274 3300014968 Bacteria 771
133 Ga0157376_10009315 3300014969 Bacteria 7133
134 Ga0157376_10081333 3300014969 Bacteria 2781
135 Ga0157376_10500081 3300014969 Bacteria 1194
136 Ga0183369_1003 3300015685 Bacteria 726443
137 Ga0163161_10568856 3300017792 Bacteria 931
138 Ga0209673_1013304 3300025273 Bacteria 3254
139 Ga0209130_1003814 3300025284 Bacteria 6107
140 Ga0209675_1005655 3300025291 Bacteria 5171
141 Ga0209675_1010253 3300025291 Bacteria 3216
142 Ga0209675_1014778 3300025291 Bacteria 2357
143 Ga0209676_1000809 3300025292 Bacteria 40893
144 Ga0209676_1001495 3300025292 Bacteria 21489
145 Ga0209676_1003105 3300025292 Bacteria 10679
146 Ga0209676_1004762 3300025292 Bacteria 7400
147 Ga0209676_1005188 3300025292 Bacteria 6913
148 Ga0209676_1014952 3300025292 Bacteria 2884
149 Ga0209025_1001646 3300025294 Bacteria 27568
150 Ga0209025_1002555 3300025294 Bacteria 18988
151 Ga0209025_1057591 3300025294 Bacteria 1483
152 Ga0209025_1093698 3300025294 Bacteria 973
153 Ga0209564_1003278 3300025295 Bacteria 11286
154 Ga0209758_1013007 3300025297 Bacteria 4589
155 Ga0209050_1000712 3300025298 Bacteria 48980
156 Ga0209256_1002032 3300025299 Bacteria 17993
157 Ga0209256_1003634 3300025299 Bacteria 10569
158 Ga0209256_1004476 3300025299 Bacteria 8739
159 Ga0207426_1067457 3300025302 Bacteria 1008
160 Ga0209051_1015703 3300025303 Bacteria 3469
161 Ga0209051_1023682 3300025303 Bacteria 2546
162 Ga0209257_1000210 3300025304 Bacteria 140822
163 Ga0209257_1000856 3300025304 Bacteria 43386
164 Ga0209257_1002551 3300025304 Bacteria 17780
165 Ga0209257_1003823 3300025304 Bacteria 12350
166 Ga0209257_1013406 3300025304 Bacteria 3651
167 Ga0207656_10065682 3300025321 Bacteria 1602
168 Ga0207680_10395366 3300025903 Bacteria 976
169 Ga0207647_10030728 3300025904 Bacteria 3462
170 Ga0207645_10034627 3300025907 Bacteria 3244
171 Ga0207705_10124074 3300025909 Bacteria 1918
172 Ga0207705_10300705 3300025909 Unclassified 1231
173 Ga0207654_10003015 3300025911 Bacteria 8548
174 Ga0207654_10103237 3300025911 Bacteria 1760
175 Ga0207654_10315357 3300025911 Bacteria 1067
176 Ga0207707_10426436 3300025912 Bacteria 1136
177 Ga0207695_10000304 3300025913 Bacteria 120823
178 Ga0207695_10001866 3300025913 Bacteria 33001
179 Ga0207671_10004089 3300025914 Bacteria 14120
180 Ga0207671_10104837 3300025914 Bacteria 2145
181 Ga0207657_10003400 3300025919 Bacteria 17006
182 Ga0207649_10002169 3300025920 Bacteria 11100
183 Ga0207649_10103853 3300025920 Bacteria 1886
184 Ga0207649_10344909 3300025920 Bacteria 1101
185 Ga0207681_10166970 3300025923 Bacteria 1665
186 Ga0207694_10094160 3300025924 Bacteria 2367
187 Ga0207694_10577877 3300025924 Bacteria 944
188 Ga0207650_10188788 3300025925 Bacteria 1646
189 Ga0207687_10170698 3300025927 Bacteria 1677
190 Ga0207687_10183183 3300025927 Bacteria 1624
191 Ga0207644_10451646 3300025931 Bacteria 1056
192 Ga0207686_10002225 3300025934 Bacteria 10658
193 Ga0207686_10094741 3300025934 Bacteria 1980
194 Ga0207670_10143887 3300025936 Bacteria 1761
195 Ga0207704_10024547 3300025938 Bacteria 3272
196 Ga0207704_10351605 3300025938 Bacteria 1148
197 Ga0207691_10296717 3300025940 Bacteria 1389
198 Ga0207711_10089867 3300025941 Bacteria 2699
199 Ga0207711_10144076 3300025941 Bacteria 2145
200 Ga0207689_10025543 3300025942 Bacteria 4950
201 Ga0207689_10079635 3300025942 Bacteria 2692
202 Ga0207661_10078539 3300025944 Bacteria 2717
203 Ga0207661_10394842 3300025944 Bacteria 1254
204 Ga0207661_10736799 3300025944 Bacteria 907
205 Ga0207679_10243064 3300025945 Bacteria 1526
206 Ga0207667_10009478 3300025949 Bacteria 11463
207 Ga0207667_10055679 3300025949 Bacteria 4157
208 Ga0207667_10327793 3300025949 Bacteria 1563
209 Ga0207651_10547520 3300025960 Bacteria 1006
210 Ga0207668_10006724 3300025972 Bacteria 6803
211 Ga0207668_10289042 3300025972 Bacteria 1348
212 Ga0207668_10368481 3300025972 Bacteria 1206
213 Ga0207640_10012296 3300025981 Bacteria 4870
214 Ga0207640_10442800 3300025981 Bacteria 1069
215 Ga0207658_10112039 3300025986 Bacteria 2159
216 Ga0207658_10158520 3300025986 Bacteria 1852
217 Ga0207658_10247430 3300025986 Bacteria 1513
218 Ga0207658_10348403 3300025986 Bacteria 1289
219 Ga0207703_10141488 3300026035 Bacteria 2088
220 Ga0207703_10147707 3300026035 Bacteria 2046
221 Ga0207703_10993362 3300026035 Bacteria 805
222 Ga0207639_10002482 3300026041 Bacteria 12362
223 Ga0207639_10038293 3300026041 Bacteria 3566
224 Ga0207639_10172886 3300026041 Bacteria 1831
225 Ga0207639_10209051 3300026041 Bacteria 1679
226 Ga0207678_10428633 3300026067 Bacteria 1147
227 Ga0207678_10802698 3300026067 Bacteria 831
228 Ga0207702_10001978 3300026078 Bacteria 19916
229 Ga0207702_10047523 3300026078 Bacteria 3617
230 Ga0207702_10602274 3300026078 Bacteria 1078
231 Ga0207641_10034989 3300026088 Bacteria 4181
232 Ga0207641_10079981 3300026088 Bacteria 2835
233 Ga0207641_10522570 3300026088 Unclassified 1155
234 Ga0207641_10707492 3300026088 Bacteria 992
235 Ga0207641_10773605 3300026088 Bacteria 949
236 Ga0207648_10072179 3300026089 Bacteria 3008
237 Ga0207676_10007201 3300026095 Bacteria 7873
238 Ga0207674_10007979 3300026116 Bacteria 12284
239 Ga0207674_10151171 3300026116 Bacteria 2279
240 Ga0207674_10295478 3300026116 Bacteria 1569
241 Ga0207675_100067424 3300026118 Bacteria 3345
242 Ga0207675_100370374 3300026118 Bacteria 1407
243 Ga0207683_10088947 3300026121 Bacteria 2748
244 Ga0207698_10086147 3300026142 Bacteria 2554
245 Ga0207698_10895587 3300026142 Bacteria 894
246 Ga0268266_10000001 3300028379 Bacteria 4040580
247 Ga0268266_10086215 3300028379 Bacteria 2745
248 Ga0268264_10061042 3300028381 Bacteria 3161
249 Ga0268264_10343507 3300028381 Bacteria 1418
250 Ga0307516_10168768 3300031730 Bacteria 1930
251 Ga0307413_10001920 3300031824 Bacteria 8238
252 Ga0307416_100295279 3300032002 Bacteria 1607
253 Ga0439436_0014444 3300041404 Bacteria 2382
254 Ga0439465_0007780 3300041413 Bacteria 3398
255 Ga0451802_0955984 3300041460 Bacteria 884
256 Ga0451853_0293453 3300041512 Bacteria 1011
257 Ga0439452_031599 3300042010 Bacteria 1298
258 Ga0495638_0209560 3300046460 Bacteria 1096
259 Ga0495628_0450577 3300046516 Bacteria 935
260 Ga0495670_0233881 3300046691 Bacteria 978
261 Ga0496100_0225687 3300048903 Bacteria 1376
262 Ga0496103_0230919 3300048906 Bacteria 1190
263 Ga0496104_0000012 3300048907 Bacteria 438011
264 Ga0496105_0000032 3300048908 Bacteria 135801
265 Ga0496106_0558789 3300048909 Bacteria 918
266 Ga0496107_0060160 3300048910 Bacteria 2749
267 Ga0496115_0024945 3300048918 Bacteria 4651
268 Ga0496117_0003312 3300048920 Bacteria 18824
269 Ga0496117_0026632 3300048920 Bacteria 4521
270 Ga0496118_0000101 3300048921 Bacteria 159577
271 Ga0496118_0000885 3300048921 Bacteria 47246
272 Ga0496119_0001389 3300048922 Bacteria 29376
273 Ga0496120_0001232 3300048923 Bacteria 32376
274 Ga0496121_0000282 3300048924 Bacteria 105900
275 Ga0496121_0039199 3300048924 Bacteria 4180
276 Ga0496121_0042405 3300048924 Bacteria 3959
277 Ga0496126_0000160 3300048929 Bacteria 155144
278 Ga0496126_0157753 3300048929 Bacteria 1941
279 Ga0501043_0042640 3300049579 Bacteria 3566
280 Ga0501046_0614356 3300049580 Bacteria 771
281 Ga0501068_0055597 3300049584 Bacteria 2398
282 Ga0501073_0189782 3300049589 Bacteria 1422
283 Ga0501080_0107782 3300049742 Bacteria 2582
284 Ga0501044_0215393 3300049823 Bacteria 1873
285 Ga0501044_0483483 3300049823 Bacteria 1141
286 Ga0500635_0000511 3300053080 Bacteria 10708
287 Ga0500651_0216729 3300053093 Unclassified 1124
288 Ga0500608_002619 3300053122 Bacteria 6588
289 Ga0500636_0147784 3300053177 Bacteria 1294

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0230919 Ga0496103_0230919_377_970 184
2 3300005331 Ga0070670_100466631 Ga0070670_1004666312 185
3 3300005335 Ga0070666_10176550 Ga0070666_101765502 185
4 3300005347 Ga0070668_100845893 Ga0070668_1008458931 185
5 3300005459 Ga0068867_100530286 Ga0068867_1005302861 185
6 3300005544 Ga0070686_100115143 Ga0070686_1001151432 185
7 3300005614 Ga0068856_100060668 Ga0068856_1000606681 185
8 3300005616 Ga0068852_100037940 Ga0068852_1000379403 185
9 3300005616 Ga0068852_100105687 Ga0068852_1001056872 185
10 3300005617 Ga0068859_100015133 Ga0068859_1000151334 185
11 3300005618 Ga0068864_100006327 Ga0068864_1000063278 185
12 3300005841 Ga0068863_100009483 Ga0068863_1000094834 185
13 3300005842 Ga0068858_100741090 Ga0068858_1007410901 185
14 3300005843 Ga0068860_100077905 Ga0068860_1000779052 185
15 3300006881 Ga0068865_100044518 Ga0068865_1000445181 185
16 3300006931 Ga0097620_100015133 Ga0097620_1000151334 185
17 3300009176 Ga0105242_10001521 Ga0105242_1000152115 185
18 3300013104 Ga0157370_10244792 Ga0157370_102447922 185
19 3300013306 Ga0163162_10018425 Ga0163162_100184252 185
20 3300013308 Ga0157375_10004905 Ga0157375_1000490510 185
21 3300014325 Ga0163163_10016248 Ga0163163_100162485 185
22 3300014968 Ga0157379_10008254 Ga0157379_100082544 185
23 3300014968 Ga0157379_11071274 Ga0157379_110712741 185
24 3300014969 Ga0157376_10009315 Ga0157376_100093154 185
25 3300025925 Ga0207650_10188788 Ga0207650_101887882 185
26 3300025934 Ga0207686_10002225 Ga0207686_1000222510 185
27 3300025941 Ga0207711_10089867 Ga0207711_100898672 185
28 3300025941 Ga0207711_10144076 Ga0207711_101440762 185
29 3300025944 Ga0207661_10394842 Ga0207661_103948422 185
30 3300025960 Ga0207651_10547520 Ga0207651_105475202 185
31 3300026035 Ga0207703_10147707 Ga0207703_101477072 185
32 3300026078 Ga0207702_10047523 Ga0207702_100475232 185
33 3300026088 Ga0207641_10034989 Ga0207641_100349893 185
34 3300026095 Ga0207676_10007201 Ga0207676_100072014 185
35 3300026142 Ga0207698_10086147 Ga0207698_100861472 185
36 3300028381 Ga0268264_10061042 Ga0268264_100610423 185
37 3300031730 Ga0307516_10168768 Ga0307516_101687682 185
38 3300048907 Ga0496104_0000012 Ga0496104_0000012_8350_8964 185
39 3300048908 Ga0496105_0000032 Ga0496105_0000032_126860_127474 185
40 3300003775 Ga0055524_1005871 Ga0055524_10058713 186
41 3300003775 Ga0055524_1020268 Ga0055524_10202683 186
42 3300003781 Ga0055536_1002805 Ga0055536_10028058 186
43 3300003781 Ga0055536_1007437 Ga0055536_10074375 186
44 3300003791 Ga0055530_10003834 Ga0055530_100038341 186
45 3300003794 Ga0055531_10001978 Ga0055531_100019783 186
46 3300003794 Ga0055531_10008870 Ga0055531_100088702 186
47 3300003794 Ga0055531_10017109 Ga0055531_100171092 186
48 3300003794 Ga0055531_10021978 Ga0055531_100219783 186
49 3300003794 Ga0055531_10024193 Ga0055531_100241931 186
50 3300005344 Ga0070661_100079302 Ga0070661_1000793022 186
51 3300005548 Ga0070665_100639336 Ga0070665_1006393362 186
52 3300005577 Ga0068857_100414310 Ga0068857_1004143102 186
53 3300005616 Ga0068852_100215143 Ga0068852_1002151432 186
54 3300005834 Ga0068851_10099593 Ga0068851_100995933 186
55 3300006237 Ga0097621_100391061 Ga0097621_1003910612 186
56 3300006881 Ga0068865_100039066 Ga0068865_1000390663 186
57 3300009551 Ga0105238_10168783 Ga0105238_101687832 186
58 3300014325 Ga0163163_10038492 Ga0163163_100384923 186
59 3300025273 Ga0209673_1013304 Ga0209673_10133043 186
60 3300025284 Ga0209130_1003814 Ga0209130_10038145 186
61 3300025291 Ga0209675_1005655 Ga0209675_10056552 186
62 3300025291 Ga0209675_1010253 Ga0209675_10102533 186
63 3300025291 Ga0209675_1014778 Ga0209675_10147781 186
64 3300025292 Ga0209676_1000809 Ga0209676_10008098 186
65 3300025292 Ga0209676_1001495 Ga0209676_10014953 186
66 3300025292 Ga0209676_1003105 Ga0209676_10031059 186
67 3300025292 Ga0209676_1004762 Ga0209676_10047622 186
68 3300025292 Ga0209676_1005188 Ga0209676_10051885 186
69 3300025292 Ga0209676_1014952 Ga0209676_10149523 186
70 3300025294 Ga0209025_1001646 Ga0209025_100164613 186
71 3300025294 Ga0209025_1002555 Ga0209025_10025558 186
72 3300025294 Ga0209025_1057591 Ga0209025_10575912 186
73 3300025294 Ga0209025_1093698 Ga0209025_10936982 186
74 3300025295 Ga0209564_1003278 Ga0209564_10032785 186
75 3300025297 Ga0209758_1013007 Ga0209758_10130072 186
76 3300025298 Ga0209050_1000712 Ga0209050_100071238 186
77 3300025299 Ga0209256_1003634 Ga0209256_10036345 186
78 3300025299 Ga0209256_1004476 Ga0209256_10044765 186
79 3300025302 Ga0207426_1067457 Ga0207426_10674572 186
80 3300025303 Ga0209051_1023682 Ga0209051_10236822 186
81 3300025304 Ga0209257_1000210 Ga0209257_100021041 186
82 3300025304 Ga0209257_1000856 Ga0209257_10008566 186
83 3300025304 Ga0209257_1002551 Ga0209257_10025519 186
84 3300025304 Ga0209257_1003823 Ga0209257_10038235 186
85 3300025304 Ga0209257_1013406 Ga0209257_10134062 186
86 3300025913 Ga0207695_10000304 Ga0207695_1000030485 186
87 3300025920 Ga0207649_10344909 Ga0207649_103449092 186
88 3300025938 Ga0207704_10024547 Ga0207704_100245473 186
89 3300025944 Ga0207661_10736799 Ga0207661_107367991 186
90 3300025949 Ga0207667_10327793 Ga0207667_103277932 186
91 3300026041 Ga0207639_10172886 Ga0207639_101728862 186
92 3300026067 Ga0207678_10428633 Ga0207678_104286331 186
93 3300026116 Ga0207674_10295478 Ga0207674_102954782 186
94 3300031824 Ga0307413_10001920 Ga0307413_100019202 186
95 3300032002 Ga0307416_100295279 Ga0307416_1002952792 186
96 3300041404 Ga0439436_0014444 Ga0439436_0014444_1222_1812 186
97 3300041413 Ga0439465_0007780 Ga0439465_0007780_2070_2660 186
98 3300042010 Ga0439452_031599 Ga0439452_031599_448_1038 186
99 3300046460 Ga0495638_0209560 Ga0495638_0209560_57_662 186
100 3300046516 Ga0495628_0450577 Ga0495628_0450577_242_838 186
101 3300046691 Ga0495670_0233881 Ga0495670_0233881_32_619 186
102 3300048903 Ga0496100_0225687 Ga0496100_0225687_238_873 186
103 3300048909 Ga0496106_0558789 Ga0496106_0558789_79_699 186
104 3300048910 Ga0496107_0060160 Ga0496107_0060160_683_1303 186
105 3300048918 Ga0496115_0024945 Ga0496115_0024945_372_992 186
106 3300048920 Ga0496117_0026632 Ga0496117_0026632_2293_2913 186
107 3300048921 Ga0496118_0000885 Ga0496118_0000885_44362_44982 186
108 3300048922 Ga0496119_0001389 Ga0496119_0001389_23576_24190 186
109 3300048923 Ga0496120_0001232 Ga0496120_0001232_7411_8025 186
110 3300048924 Ga0496121_0000282 Ga0496121_0000282_102953_103573 186
111 3300048924 Ga0496121_0039199 Ga0496121_0039199_731_1366 186
112 3300048929 Ga0496126_0000160 Ga0496126_0000160_75250_75870 186
113 3300048929 Ga0496126_0157753 Ga0496126_0157753_174_788 186
114 3300049579 Ga0501043_0042640 Ga0501043_0042640_816_1406 186
115 3300053080 Ga0500635_0000511 Ga0500635_0000511_4031_4615 186
116 3300053122 Ga0500608_002619 Ga0500608_002619_1173_1790 186
117 3300053177 Ga0500636_0147784 Ga0500636_0147784_518_1114 186
118 iso_pu_bacteria 8003014200 8003015278 186
119 3300005841 Ga0068863_100087076 Ga0068863_1000870763 187
120 3300006237 Ga0097621_100359036 Ga0097621_1003590362 187
121 3300009148 Ga0105243_10252539 Ga0105243_102525392 187
122 3300013296 Ga0157374_10266726 Ga0157374_102667262 187
123 3300013306 Ga0163162_10262545 Ga0163162_102625451 187
124 3300014969 Ga0157376_10500081 Ga0157376_105000812 187
125 3300005334 Ga0068869_100169687 Ga0068869_1001696872 188
126 3300005340 Ga0070689_100321811 Ga0070689_1003218112 188
127 3300005353 Ga0070669_100085706 Ga0070669_1000857062 188
128 3300005365 Ga0070688_100373246 Ga0070688_1003732462 188
129 3300005548 Ga0070665_100580701 Ga0070665_1005807012 188
130 3300005548 Ga0070665_100623613 Ga0070665_1006236132 188
131 3300015685 Ga0183369_1003 Ga0183369_1003197 188
132 3300025907 Ga0207645_10034627 Ga0207645_100346273 188
133 3300025923 Ga0207681_10166970 Ga0207681_101669702 188
134 3300025942 Ga0207689_10079635 Ga0207689_100796352 188
135 3300025972 Ga0207668_10289042 Ga0207668_102890422 188
136 3300025986 Ga0207658_10112039 Ga0207658_101120392 188
137 3300026121 Ga0207683_10088947 Ga0207683_100889471 188
138 3300028379 Ga0268266_10086215 Ga0268266_100862153 188
139 3300049580 Ga0501046_0614356 Ga0501046_0614356_24_629 188
140 3300053093 Ga0500651_0216729 Ga0500651_0216729_30_665 189
141 3300005340 Ga0070689_100123652 Ga0070689_1001236522 190
142 3300006881 Ga0068865_100101254 Ga0068865_1001012542 190
143 3300025934 Ga0207686_10094741 Ga0207686_100947411 190
144 3300025936 Ga0207670_10143887 Ga0207670_101438872 190
145 3300026089 Ga0207648_10072179 Ga0207648_100721793 190
146 3300041512 Ga0451853_0293453 Ga0451853_0293453_297_974 190
147 3300005334 Ga0068869_100934990 Ga0068869_1009349901 191
148 3300005367 Ga0070667_100242512 Ga0070667_1002425122 191
149 3300005719 Ga0068861_100053361 Ga0068861_1000533614 191
150 3300005983 Ga0081540_1033154 Ga0081540_10331542 191
151 3300017792 Ga0163161_10568856 Ga0163161_105688561 191
152 3300025938 Ga0207704_10351605 Ga0207704_103516052 191
153 3300025940 Ga0207691_10296717 Ga0207691_102967172 191
154 3300025972 Ga0207668_10368481 Ga0207668_103684811 191
155 3300025986 Ga0207658_10348403 Ga0207658_103484031 191
156 3300026088 Ga0207641_10773605 Ga0207641_107736052 191
157 3300026118 Ga0207675_100067424 Ga0207675_1000674242 191
158 3300005327 Ga0070658_10346548 Ga0070658_103465481 192
159 3300005327 Ga0070658_11096195 Ga0070658_110961951 192
160 3300005329 Ga0070683_100019696 Ga0070683_1000196963 192
161 3300005329 Ga0070683_100271642 Ga0070683_1002716422 192
162 3300005334 Ga0068869_100026006 Ga0068869_1000260063 192
163 3300005335 Ga0070666_10090894 Ga0070666_100908943 192
164 3300005355 Ga0070671_100197531 Ga0070671_1001975313 192
165 3300005366 Ga0070659_100020448 Ga0070659_1000204483 192
166 3300005367 Ga0070667_100040180 Ga0070667_1000401802 192
167 3300005455 Ga0070663_100058052 Ga0070663_1000580523 192
168 3300005457 Ga0070662_100128656 Ga0070662_1001286563 192
169 3300005458 Ga0070681_10020370 Ga0070681_100203703 192
170 3300005458 Ga0070681_10487203 Ga0070681_104872031 192
171 3300005535 Ga0070684_100033622 Ga0070684_1000336223 192
172 3300005539 Ga0068853_100002428 Ga0068853_10000242812 192
173 3300005539 Ga0068853_100154900 Ga0068853_1001549002 192
174 3300005539 Ga0068853_100277572 Ga0068853_1002775722 192
175 3300005539 Ga0068853_100522577 Ga0068853_1005225772 192
176 3300005563 Ga0068855_100095596 Ga0068855_1000955963 192
177 3300005564 Ga0070664_100134294 Ga0070664_1001342942 192
178 3300005564 Ga0070664_100548656 Ga0070664_1005486562 192
179 3300005577 Ga0068857_100025890 Ga0068857_1000258903 192
180 3300005578 Ga0068854_100003891 Ga0068854_10000389110 192
181 3300005578 Ga0068854_100114768 Ga0068854_1001147682 192
182 3300005614 Ga0068856_100009013 Ga0068856_1000090136 192
183 3300005614 Ga0068856_100054143 Ga0068856_1000541432 192
184 3300005614 Ga0068856_100178008 Ga0068856_1001780082 192
185 3300005614 Ga0068856_100292885 Ga0068856_1002928852 192
186 3300005616 Ga0068852_100034398 Ga0068852_1000343982 192
187 3300005617 Ga0068859_100001424 Ga0068859_1000014241 192
188 3300005834 Ga0068851_10030037 Ga0068851_100300373 192
189 3300005834 Ga0068851_10095456 Ga0068851_100954561 192
190 3300005841 Ga0068863_100032368 Ga0068863_1000323684 192
191 3300005841 Ga0068863_100624843 Ga0068863_1006248432 192
192 3300005843 Ga0068860_100017903 Ga0068860_1000179033 192
193 3300006931 Ga0097620_100001424 Ga0097620_1000014241 192
194 3300009093 Ga0105240_10044537 Ga0105240_100445374 192
195 3300009093 Ga0105240_10080372 Ga0105240_100803722 192
196 3300009098 Ga0105245_10256613 Ga0105245_102566132 192
197 3300009101 Ga0105247_10294174 Ga0105247_102941742 192
198 3300009174 Ga0105241_10004054 Ga0105241_100040548 192
199 3300009174 Ga0105241_10065893 Ga0105241_100658933 192
200 3300009174 Ga0105241_10213363 Ga0105241_102133632 192
201 3300009174 Ga0105241_10752422 Ga0105241_107524221 192
202 3300009545 Ga0105237_10028694 Ga0105237_100286944 192
203 3300009545 Ga0105237_10157200 Ga0105237_101572002 192
204 3300009551 Ga0105238_10042076 Ga0105238_100420763 192
205 3300009551 Ga0105238_10044240 Ga0105238_100442403 192
206 3300010375 Ga0105239_10010305 Ga0105239_100103059 192
207 3300010375 Ga0105239_10019000 Ga0105239_100190004 192
208 3300010375 Ga0105239_10550053 Ga0105239_105500532 192
209 3300011119 Ga0105246_10052896 Ga0105246_100528963 192
210 3300013104 Ga0157370_10002937 Ga0157370_1000293715 192
211 3300013104 Ga0157370_10156848 Ga0157370_101568483 192
212 3300013105 Ga0157369_10003913 Ga0157369_100039137 192
213 3300013105 Ga0157369_10018584 Ga0157369_100185846 192
214 3300013296 Ga0157374_10424207 Ga0157374_104242072 192
215 3300013307 Ga0157372_10003498 Ga0157372_100034983 192
216 3300013307 Ga0157372_10167045 Ga0157372_101670452 192
217 3300014497 Ga0182008_10052150 Ga0182008_100521503 192
218 3300025303 Ga0209051_1015703 Ga0209051_10157032 192
219 3300025321 Ga0207656_10065682 Ga0207656_100656822 192
220 3300025903 Ga0207680_10395366 Ga0207680_103953661 192
221 3300025904 Ga0207647_10030728 Ga0207647_100307283 192
222 3300025909 Ga0207705_10124074 Ga0207705_101240742 192
223 3300025909 Ga0207705_10300705 Ga0207705_103007052 192
224 3300025911 Ga0207654_10003015 Ga0207654_100030157 192
225 3300025911 Ga0207654_10103237 Ga0207654_101032372 192
226 3300025911 Ga0207654_10315357 Ga0207654_103153572 192
227 3300025912 Ga0207707_10426436 Ga0207707_104264362 192
228 3300025913 Ga0207695_10001866 Ga0207695_100018664 192
229 3300025914 Ga0207671_10004089 Ga0207671_100040892 192
230 3300025914 Ga0207671_10104837 Ga0207671_101048373 192
231 3300025919 Ga0207657_10003400 Ga0207657_1000340015 192
232 3300025920 Ga0207649_10002169 Ga0207649_100021695 192
233 3300025920 Ga0207649_10103853 Ga0207649_101038532 192
234 3300025924 Ga0207694_10094160 Ga0207694_100941602 192
235 3300025924 Ga0207694_10577877 Ga0207694_105778772 192
236 3300025927 Ga0207687_10170698 Ga0207687_101706982 192
237 3300025927 Ga0207687_10183183 Ga0207687_101831832 192
238 3300025931 Ga0207644_10451646 Ga0207644_104516462 192
239 3300025942 Ga0207689_10025543 Ga0207689_100255433 192
240 3300025944 Ga0207661_10078539 Ga0207661_100785392 192
241 3300025945 Ga0207679_10243064 Ga0207679_102430642 192
242 3300025949 Ga0207667_10009478 Ga0207667_1000947812 192
243 3300025949 Ga0207667_10055679 Ga0207667_100556793 192
244 3300025972 Ga0207668_10006724 Ga0207668_100067245 192
245 3300025981 Ga0207640_10012296 Ga0207640_100122962 192
246 3300025981 Ga0207640_10442800 Ga0207640_104428002 192
247 3300025986 Ga0207658_10247430 Ga0207658_102474302 192
248 3300026035 Ga0207703_10141488 Ga0207703_101414882 192
249 3300026035 Ga0207703_10993362 Ga0207703_109933621 192
250 3300026041 Ga0207639_10002482 Ga0207639_100024824 192
251 3300026041 Ga0207639_10038293 Ga0207639_100382934 192
252 3300026067 Ga0207678_10802698 Ga0207678_108026982 192
253 3300026078 Ga0207702_10001978 Ga0207702_100019788 192
254 3300026078 Ga0207702_10602274 Ga0207702_106022742 192
255 3300026088 Ga0207641_10522570 Ga0207641_105225702 192
256 3300026088 Ga0207641_10707492 Ga0207641_107074921 192
257 3300026116 Ga0207674_10007979 Ga0207674_100079797 192
258 3300026116 Ga0207674_10151171 Ga0207674_101511713 192
259 3300026118 Ga0207675_100370374 Ga0207675_1003703741 192
260 3300026142 Ga0207698_10895587 Ga0207698_108955872 192
261 3300028381 Ga0268264_10343507 Ga0268264_103435072 192
262 3300041460 Ga0451802_0955984 Ga0451802_0955984_108_728 192
263 3300049584 Ga0501068_0055597 Ga0501068_0055597_592_1215 192
264 3300049589 Ga0501073_0189782 Ga0501073_0189782_237_860 192
265 3300049742 Ga0501080_0107782 Ga0501080_0107782_1151_1774 192
266 3300049823 Ga0501044_0215393 Ga0501044_0215393_393_1016 192
267 3300049823 Ga0501044_0483483 Ga0501044_0483483_331_975 192
268 3300005367 Ga0070667_100027012 Ga0070667_1000270122 193
269 3300005548 Ga0070665_100000026 Ga0070665_10000002692 193
270 3300025299 Ga0209256_1002032 Ga0209256_10020323 193
271 3300025986 Ga0207658_10158520 Ga0207658_101585203 193
272 3300028379 Ga0268266_10000001 Ga0268266_100000011177 193
273 3300005616 Ga0068852_100006698 Ga0068852_1000066985 194
274 3300006358 Ga0068871_100184909 Ga0068871_1001849092 194
275 3300026041 Ga0207639_10209051 Ga0207639_102090512 194
276 3300048920 Ga0496117_0003312 Ga0496117_0003312_16853_17488 194
277 3300048921 Ga0496118_0000101 Ga0496118_0000101_115930_116565 194
278 3300048924 Ga0496121_0042405 Ga0496121_0042405_3187_3822 194
279 3300005841 Ga0068863_100089693 Ga0068863_1000896932 197
280 3300006237 Ga0097621_100246427 Ga0097621_1002464272 197
281 3300006358 Ga0068871_100025811 Ga0068871_1000258113 197
282 3300009177 Ga0105248_10271877 Ga0105248_102718772 197
283 3300026088 Ga0207641_10079981 Ga0207641_100799812 197
284 3300014969 Ga0157376_10081333 Ga0157376_100813332 200
285 3300001989 JGI24739J22299_10001924 JGI24739J22299_100019249 203
286 3300001990 JGI24737J22298_10000189 JGI24737J22298_100001899 203
287 3300002067 JGI24735J21928_10000048 JGI24735J21928_100000489 203
288 3300013102 Ga0157371_10028873 Ga0157371_100288733 203
289 3300013104 Ga0157370_10168236 Ga0157370_101682362 203
290 3300013307 Ga0157372_10000120 Ga0157372_1000012042 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

24

200

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rzg-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.9157 17 203
3s5a-assembly1.cif.gz_A abh2 cross-linked to undamaged dsdna-2 with cofactors 0.9112 17 203
3btz-assembly1.cif.gz_A crystal structure of human abh2 cross-linked to dsdna 0.9105 21 203
3buc-assembly1.cif.gz_A x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg 0.9099 21 203
2iuw-assembly1.cif.gz_A-2 crystal structure of human abh3 in complex with iron ion and 2- oxoglutarate 0.9063 21 203
ID Description Score Start End Superfamily
af_Q9SIE0_90_314_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.908 21 202 2.60.120.590
2iuwA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9063 21 203 2.60.120.590
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9029 21 203 2.60.120.590
af_L7N6A4_38_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.88 33 202 2.60.120.590
af_L7N6A4_38_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8596 33 202 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A2W2A7G3-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.966 19 200 GO:0006307
GO:0051213
AF-A4AW87-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9611 81 202 GO:0006307
GO:0051213
AF-A0A2S9YF58-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9578 21 202 GO:0006307
GO:0051213
AF-A0A3C0HGN5-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9577 21 200 GO:0006307
GO:0051213
AF-S7X5J3-F1-model_v4 DNA repair system specific for alkylated DNA 0.9574 86 203 GO:0006307
GO:0051213

Feature Viewer

pLDDT pTM Quality
85.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map