F389659
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 290 | 159 | 289 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100548656|Ga0070664_1005486562 |
| Length | 230 |
| Sequence | MRRRNIRSEAEPTFEVLPLAGADVGYAADAFTPRADALFEALHREIPWEQHRLHIFGREVASPRLSCWIGDAGTAYRYSGSLFEPRAWTPTLAALRHELRDRFDLQFNSVLANLYRDGSDSMGWHSDAEPELGKEPVIASLSFGAVRRFRFRSRETKRVVLAIDLASGSLLVMRGATQRLYHHDLPKTARAGARINLTFRMIRSKSLLPHAGERYGEGRVESRQRTKQSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 129 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 130 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 138 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 139 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 140 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 141 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 142 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 143 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 144 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 145 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 146 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 147 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 148 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 156 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 157 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 158 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 159 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.83 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 77.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001924 | 3300001989 | Bacteria | 7939 |
| 2 | JGI24737J22298_10000189 | 3300001990 | Bacteria | 19911 |
| 3 | JGI24735J21928_10000048 | 3300002067 | Bacteria | 51228 |
| 4 | Ga0055524_1005871 | 3300003775 | Bacteria | 5416 |
| 5 | Ga0055524_1020268 | 3300003775 | Bacteria | 2246 |
| 6 | Ga0055536_1002805 | 3300003781 | Bacteria | 9623 |
| 7 | Ga0055536_1007437 | 3300003781 | Bacteria | 4903 |
| 8 | Ga0055530_10003834 | 3300003791 | Bacteria | 8251 |
| 9 | Ga0055531_10001978 | 3300003794 | Bacteria | 14281 |
| 10 | Ga0055531_10008870 | 3300003794 | Bacteria | 5224 |
| 11 | Ga0055531_10017109 | 3300003794 | Bacteria | 3080 |
| 12 | Ga0055531_10021978 | 3300003794 | Bacteria | 2450 |
| 13 | Ga0055531_10024193 | 3300003794 | Bacteria | 2250 |
| 14 | Ga0070658_10346548 | 3300005327 | Unclassified | 1271 |
| 15 | Ga0070658_11096195 | 3300005327 | Bacteria | 692 |
| 16 | Ga0070683_100019696 | 3300005329 | Bacteria | 5995 |
| 17 | Ga0070683_100271642 | 3300005329 | Bacteria | 1613 |
| 18 | Ga0070670_100466631 | 3300005331 | Bacteria | 1120 |
| 19 | Ga0068869_100026006 | 3300005334 | Bacteria | 4070 |
| 20 | Ga0068869_100169687 | 3300005334 | Bacteria | 1704 |
| 21 | Ga0068869_100934990 | 3300005334 | Bacteria | 752 |
| 22 | Ga0070666_10090894 | 3300005335 | Bacteria | 2097 |
| 23 | Ga0070666_10176550 | 3300005335 | Bacteria | 1498 |
| 24 | Ga0070689_100123652 | 3300005340 | Bacteria | 2069 |
| 25 | Ga0070689_100321811 | 3300005340 | Bacteria | 1292 |
| 26 | Ga0070661_100079302 | 3300005344 | Bacteria | 2422 |
| 27 | Ga0070668_100845893 | 3300005347 | Bacteria | 815 |
| 28 | Ga0070669_100085706 | 3300005353 | Bacteria | 2352 |
| 29 | Ga0070671_100197531 | 3300005355 | Bacteria | 1705 |
| 30 | Ga0070688_100373246 | 3300005365 | Bacteria | 1050 |
| 31 | Ga0070659_100020448 | 3300005366 | Bacteria | 5028 |
| 32 | Ga0070667_100027012 | 3300005367 | Bacteria | 4774 |
| 33 | Ga0070667_100040180 | 3300005367 | Bacteria | 3922 |
| 34 | Ga0070667_100242512 | 3300005367 | Bacteria | 1609 |
| 35 | Ga0070663_100058052 | 3300005455 | Bacteria | 2778 |
| 36 | Ga0070662_100128656 | 3300005457 | Bacteria | 1950 |
| 37 | Ga0070681_10020370 | 3300005458 | Bacteria | 6647 |
| 38 | Ga0070681_10487203 | 3300005458 | Bacteria | 1146 |
| 39 | Ga0068867_100530286 | 3300005459 | Bacteria | 1017 |
| 40 | Ga0070684_100033622 | 3300005535 | Bacteria | 4379 |
| 41 | Ga0068853_100002428 | 3300005539 | Bacteria | 13933 |
| 42 | Ga0068853_100154900 | 3300005539 | Bacteria | 2064 |
| 43 | Ga0068853_100277572 | 3300005539 | Bacteria | 1544 |
| 44 | Ga0068853_100522577 | 3300005539 | Bacteria | 1122 |
| 45 | Ga0070686_100115143 | 3300005544 | Bacteria | 1838 |
| 46 | Ga0070665_100000026 | 3300005548 | Bacteria | 365176 |
| 47 | Ga0070665_100580701 | 3300005548 | Bacteria | 1134 |
| 48 | Ga0070665_100623613 | 3300005548 | Bacteria | 1091 |
| 49 | Ga0070665_100639336 | 3300005548 | Bacteria | 1077 |
| 50 | Ga0068855_100095596 | 3300005563 | Bacteria | 3424 |
| 51 | Ga0070664_100134294 | 3300005564 | Bacteria | 2175 |
| 52 | Ga0070664_100548656 | 3300005564 | Bacteria | 1069 |
| 53 | Ga0068857_100025890 | 3300005577 | Bacteria | 5167 |
| 54 | Ga0068857_100414310 | 3300005577 | Bacteria | 1255 |
| 55 | Ga0068854_100003891 | 3300005578 | Bacteria | 9357 |
| 56 | Ga0068854_100114768 | 3300005578 | Bacteria | 2037 |
| 57 | Ga0068856_100009013 | 3300005614 | Bacteria | 9707 |
| 58 | Ga0068856_100054143 | 3300005614 | Bacteria | 3957 |
| 59 | Ga0068856_100060668 | 3300005614 | Bacteria | 3736 |
| 60 | Ga0068856_100178008 | 3300005614 | Bacteria | 2139 |
| 61 | Ga0068856_100292885 | 3300005614 | Bacteria | 1644 |
| 62 | Ga0068852_100006698 | 3300005616 | Bacteria | 8353 |
| 63 | Ga0068852_100034398 | 3300005616 | Bacteria | 4215 |
| 64 | Ga0068852_100037940 | 3300005616 | Bacteria | 4045 |
| 65 | Ga0068852_100105687 | 3300005616 | Bacteria | 2551 |
| 66 | Ga0068852_100215143 | 3300005616 | Bacteria | 1825 |
| 67 | Ga0068859_100001424 | 3300005617 | Bacteria | 24282 |
| 68 | Ga0068859_100015133 | 3300005617 | Bacteria | 7743 |
| 69 | Ga0068864_100006327 | 3300005618 | Bacteria | 9710 |
| 70 | Ga0068861_100053361 | 3300005719 | Bacteria | 3075 |
| 71 | Ga0068851_10030037 | 3300005834 | Bacteria | 2693 |
| 72 | Ga0068851_10095456 | 3300005834 | Bacteria | 1571 |
| 73 | Ga0068851_10099593 | 3300005834 | Bacteria | 1540 |
| 74 | Ga0068863_100009483 | 3300005841 | Bacteria | 9493 |
| 75 | Ga0068863_100032368 | 3300005841 | Bacteria | 4984 |
| 76 | Ga0068863_100087076 | 3300005841 | Bacteria | 2959 |
| 77 | Ga0068863_100089693 | 3300005841 | Bacteria | 2915 |
| 78 | Ga0068863_100624843 | 3300005841 | Unclassified | 1067 |
| 79 | Ga0068858_100741090 | 3300005842 | Bacteria | 957 |
| 80 | Ga0068860_100017903 | 3300005843 | Bacteria | 6899 |
| 81 | Ga0068860_100077905 | 3300005843 | Bacteria | 3153 |
| 82 | Ga0081540_1033154 | 3300005983 | Bacteria | 2809 |
| 83 | Ga0097621_100246427 | 3300006237 | Bacteria | 1563 |
| 84 | Ga0097621_100359036 | 3300006237 | Bacteria | 1297 |
| 85 | Ga0097621_100391061 | 3300006237 | Bacteria | 1243 |
| 86 | Ga0068871_100025811 | 3300006358 | Bacteria | 4577 |
| 87 | Ga0068871_100184909 | 3300006358 | Bacteria | 1792 |
| 88 | Ga0068865_100039066 | 3300006881 | Bacteria | 3217 |
| 89 | Ga0068865_100044518 | 3300006881 | Bacteria | 3038 |
| 90 | Ga0068865_100101254 | 3300006881 | Bacteria | 2109 |
| 91 | Ga0097620_100001424 | 3300006931 | Bacteria | 24282 |
| 92 | Ga0097620_100015133 | 3300006931 | Bacteria | 7743 |
| 93 | Ga0105240_10044537 | 3300009093 | Bacteria | 5638 |
| 94 | Ga0105240_10080372 | 3300009093 | Bacteria | 4009 |
| 95 | Ga0105245_10256613 | 3300009098 | Bacteria | 1700 |
| 96 | Ga0105247_10294174 | 3300009101 | Bacteria | 1124 |
| 97 | Ga0105243_10252539 | 3300009148 | Bacteria | 1575 |
| 98 | Ga0105241_10004054 | 3300009174 | Bacteria | 10837 |
| 99 | Ga0105241_10065893 | 3300009174 | Bacteria | 2800 |
| 100 | Ga0105241_10213363 | 3300009174 | Bacteria | 1618 |
| 101 | Ga0105241_10752422 | 3300009174 | Bacteria | 894 |
| 102 | Ga0105242_10001521 | 3300009176 | Bacteria | 18231 |
| 103 | Ga0105248_10271877 | 3300009177 | Bacteria | 1908 |
| 104 | Ga0105237_10028694 | 3300009545 | Bacteria | 5664 |
| 105 | Ga0105237_10157200 | 3300009545 | Bacteria | 2271 |
| 106 | Ga0105238_10042076 | 3300009551 | Bacteria | 4626 |
| 107 | Ga0105238_10044240 | 3300009551 | Bacteria | 4502 |
| 108 | Ga0105238_10168783 | 3300009551 | Bacteria | 2164 |
| 109 | Ga0105239_10010305 | 3300010375 | Bacteria | 10469 |
| 110 | Ga0105239_10019000 | 3300010375 | Bacteria | 7594 |
| 111 | Ga0105239_10550053 | 3300010375 | Bacteria | 1314 |
| 112 | Ga0105246_10052896 | 3300011119 | Bacteria | 2793 |
| 113 | Ga0157371_10028873 | 3300013102 | Bacteria | 4016 |
| 114 | Ga0157370_10002937 | 3300013104 | Bacteria | 20291 |
| 115 | Ga0157370_10156848 | 3300013104 | Bacteria | 2118 |
| 116 | Ga0157370_10168236 | 3300013104 | Bacteria | 2038 |
| 117 | Ga0157370_10244792 | 3300013104 | Bacteria | 1659 |
| 118 | Ga0157369_10003913 | 3300013105 | Bacteria | 17658 |
| 119 | Ga0157369_10018584 | 3300013105 | Bacteria | 7792 |
| 120 | Ga0157374_10266726 | 3300013296 | Bacteria | 1688 |
| 121 | Ga0157374_10424207 | 3300013296 | Bacteria | 1329 |
| 122 | Ga0163162_10018425 | 3300013306 | Bacteria | 6840 |
| 123 | Ga0163162_10262545 | 3300013306 | Bacteria | 1858 |
| 124 | Ga0157372_10000120 | 3300013307 | Bacteria | 83586 |
| 125 | Ga0157372_10003498 | 3300013307 | Bacteria | 16924 |
| 126 | Ga0157372_10167045 | 3300013307 | Bacteria | 2545 |
| 127 | Ga0157375_10004905 | 3300013308 | Bacteria | 11631 |
| 128 | Ga0163163_10016248 | 3300014325 | Bacteria | 6910 |
| 129 | Ga0163163_10038492 | 3300014325 | Bacteria | 4662 |
| 130 | Ga0182008_10052150 | 3300014497 | Bacteria | 2028 |
| 131 | Ga0157379_10008254 | 3300014968 | Bacteria | 9047 |
| 132 | Ga0157379_11071274 | 3300014968 | Bacteria | 771 |
| 133 | Ga0157376_10009315 | 3300014969 | Bacteria | 7133 |
| 134 | Ga0157376_10081333 | 3300014969 | Bacteria | 2781 |
| 135 | Ga0157376_10500081 | 3300014969 | Bacteria | 1194 |
| 136 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 137 | Ga0163161_10568856 | 3300017792 | Bacteria | 931 |
| 138 | Ga0209673_1013304 | 3300025273 | Bacteria | 3254 |
| 139 | Ga0209130_1003814 | 3300025284 | Bacteria | 6107 |
| 140 | Ga0209675_1005655 | 3300025291 | Bacteria | 5171 |
| 141 | Ga0209675_1010253 | 3300025291 | Bacteria | 3216 |
| 142 | Ga0209675_1014778 | 3300025291 | Bacteria | 2357 |
| 143 | Ga0209676_1000809 | 3300025292 | Bacteria | 40893 |
| 144 | Ga0209676_1001495 | 3300025292 | Bacteria | 21489 |
| 145 | Ga0209676_1003105 | 3300025292 | Bacteria | 10679 |
| 146 | Ga0209676_1004762 | 3300025292 | Bacteria | 7400 |
| 147 | Ga0209676_1005188 | 3300025292 | Bacteria | 6913 |
| 148 | Ga0209676_1014952 | 3300025292 | Bacteria | 2884 |
| 149 | Ga0209025_1001646 | 3300025294 | Bacteria | 27568 |
| 150 | Ga0209025_1002555 | 3300025294 | Bacteria | 18988 |
| 151 | Ga0209025_1057591 | 3300025294 | Bacteria | 1483 |
| 152 | Ga0209025_1093698 | 3300025294 | Bacteria | 973 |
| 153 | Ga0209564_1003278 | 3300025295 | Bacteria | 11286 |
| 154 | Ga0209758_1013007 | 3300025297 | Bacteria | 4589 |
| 155 | Ga0209050_1000712 | 3300025298 | Bacteria | 48980 |
| 156 | Ga0209256_1002032 | 3300025299 | Bacteria | 17993 |
| 157 | Ga0209256_1003634 | 3300025299 | Bacteria | 10569 |
| 158 | Ga0209256_1004476 | 3300025299 | Bacteria | 8739 |
| 159 | Ga0207426_1067457 | 3300025302 | Bacteria | 1008 |
| 160 | Ga0209051_1015703 | 3300025303 | Bacteria | 3469 |
| 161 | Ga0209051_1023682 | 3300025303 | Bacteria | 2546 |
| 162 | Ga0209257_1000210 | 3300025304 | Bacteria | 140822 |
| 163 | Ga0209257_1000856 | 3300025304 | Bacteria | 43386 |
| 164 | Ga0209257_1002551 | 3300025304 | Bacteria | 17780 |
| 165 | Ga0209257_1003823 | 3300025304 | Bacteria | 12350 |
| 166 | Ga0209257_1013406 | 3300025304 | Bacteria | 3651 |
| 167 | Ga0207656_10065682 | 3300025321 | Bacteria | 1602 |
| 168 | Ga0207680_10395366 | 3300025903 | Bacteria | 976 |
| 169 | Ga0207647_10030728 | 3300025904 | Bacteria | 3462 |
| 170 | Ga0207645_10034627 | 3300025907 | Bacteria | 3244 |
| 171 | Ga0207705_10124074 | 3300025909 | Bacteria | 1918 |
| 172 | Ga0207705_10300705 | 3300025909 | Unclassified | 1231 |
| 173 | Ga0207654_10003015 | 3300025911 | Bacteria | 8548 |
| 174 | Ga0207654_10103237 | 3300025911 | Bacteria | 1760 |
| 175 | Ga0207654_10315357 | 3300025911 | Bacteria | 1067 |
| 176 | Ga0207707_10426436 | 3300025912 | Bacteria | 1136 |
| 177 | Ga0207695_10000304 | 3300025913 | Bacteria | 120823 |
| 178 | Ga0207695_10001866 | 3300025913 | Bacteria | 33001 |
| 179 | Ga0207671_10004089 | 3300025914 | Bacteria | 14120 |
| 180 | Ga0207671_10104837 | 3300025914 | Bacteria | 2145 |
| 181 | Ga0207657_10003400 | 3300025919 | Bacteria | 17006 |
| 182 | Ga0207649_10002169 | 3300025920 | Bacteria | 11100 |
| 183 | Ga0207649_10103853 | 3300025920 | Bacteria | 1886 |
| 184 | Ga0207649_10344909 | 3300025920 | Bacteria | 1101 |
| 185 | Ga0207681_10166970 | 3300025923 | Bacteria | 1665 |
| 186 | Ga0207694_10094160 | 3300025924 | Bacteria | 2367 |
| 187 | Ga0207694_10577877 | 3300025924 | Bacteria | 944 |
| 188 | Ga0207650_10188788 | 3300025925 | Bacteria | 1646 |
| 189 | Ga0207687_10170698 | 3300025927 | Bacteria | 1677 |
| 190 | Ga0207687_10183183 | 3300025927 | Bacteria | 1624 |
| 191 | Ga0207644_10451646 | 3300025931 | Bacteria | 1056 |
| 192 | Ga0207686_10002225 | 3300025934 | Bacteria | 10658 |
| 193 | Ga0207686_10094741 | 3300025934 | Bacteria | 1980 |
| 194 | Ga0207670_10143887 | 3300025936 | Bacteria | 1761 |
| 195 | Ga0207704_10024547 | 3300025938 | Bacteria | 3272 |
| 196 | Ga0207704_10351605 | 3300025938 | Bacteria | 1148 |
| 197 | Ga0207691_10296717 | 3300025940 | Bacteria | 1389 |
| 198 | Ga0207711_10089867 | 3300025941 | Bacteria | 2699 |
| 199 | Ga0207711_10144076 | 3300025941 | Bacteria | 2145 |
| 200 | Ga0207689_10025543 | 3300025942 | Bacteria | 4950 |
| 201 | Ga0207689_10079635 | 3300025942 | Bacteria | 2692 |
| 202 | Ga0207661_10078539 | 3300025944 | Bacteria | 2717 |
| 203 | Ga0207661_10394842 | 3300025944 | Bacteria | 1254 |
| 204 | Ga0207661_10736799 | 3300025944 | Bacteria | 907 |
| 205 | Ga0207679_10243064 | 3300025945 | Bacteria | 1526 |
| 206 | Ga0207667_10009478 | 3300025949 | Bacteria | 11463 |
| 207 | Ga0207667_10055679 | 3300025949 | Bacteria | 4157 |
| 208 | Ga0207667_10327793 | 3300025949 | Bacteria | 1563 |
| 209 | Ga0207651_10547520 | 3300025960 | Bacteria | 1006 |
| 210 | Ga0207668_10006724 | 3300025972 | Bacteria | 6803 |
| 211 | Ga0207668_10289042 | 3300025972 | Bacteria | 1348 |
| 212 | Ga0207668_10368481 | 3300025972 | Bacteria | 1206 |
| 213 | Ga0207640_10012296 | 3300025981 | Bacteria | 4870 |
| 214 | Ga0207640_10442800 | 3300025981 | Bacteria | 1069 |
| 215 | Ga0207658_10112039 | 3300025986 | Bacteria | 2159 |
| 216 | Ga0207658_10158520 | 3300025986 | Bacteria | 1852 |
| 217 | Ga0207658_10247430 | 3300025986 | Bacteria | 1513 |
| 218 | Ga0207658_10348403 | 3300025986 | Bacteria | 1289 |
| 219 | Ga0207703_10141488 | 3300026035 | Bacteria | 2088 |
| 220 | Ga0207703_10147707 | 3300026035 | Bacteria | 2046 |
| 221 | Ga0207703_10993362 | 3300026035 | Bacteria | 805 |
| 222 | Ga0207639_10002482 | 3300026041 | Bacteria | 12362 |
| 223 | Ga0207639_10038293 | 3300026041 | Bacteria | 3566 |
| 224 | Ga0207639_10172886 | 3300026041 | Bacteria | 1831 |
| 225 | Ga0207639_10209051 | 3300026041 | Bacteria | 1679 |
| 226 | Ga0207678_10428633 | 3300026067 | Bacteria | 1147 |
| 227 | Ga0207678_10802698 | 3300026067 | Bacteria | 831 |
| 228 | Ga0207702_10001978 | 3300026078 | Bacteria | 19916 |
| 229 | Ga0207702_10047523 | 3300026078 | Bacteria | 3617 |
| 230 | Ga0207702_10602274 | 3300026078 | Bacteria | 1078 |
| 231 | Ga0207641_10034989 | 3300026088 | Bacteria | 4181 |
| 232 | Ga0207641_10079981 | 3300026088 | Bacteria | 2835 |
| 233 | Ga0207641_10522570 | 3300026088 | Unclassified | 1155 |
| 234 | Ga0207641_10707492 | 3300026088 | Bacteria | 992 |
| 235 | Ga0207641_10773605 | 3300026088 | Bacteria | 949 |
| 236 | Ga0207648_10072179 | 3300026089 | Bacteria | 3008 |
| 237 | Ga0207676_10007201 | 3300026095 | Bacteria | 7873 |
| 238 | Ga0207674_10007979 | 3300026116 | Bacteria | 12284 |
| 239 | Ga0207674_10151171 | 3300026116 | Bacteria | 2279 |
| 240 | Ga0207674_10295478 | 3300026116 | Bacteria | 1569 |
| 241 | Ga0207675_100067424 | 3300026118 | Bacteria | 3345 |
| 242 | Ga0207675_100370374 | 3300026118 | Bacteria | 1407 |
| 243 | Ga0207683_10088947 | 3300026121 | Bacteria | 2748 |
| 244 | Ga0207698_10086147 | 3300026142 | Bacteria | 2554 |
| 245 | Ga0207698_10895587 | 3300026142 | Bacteria | 894 |
| 246 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 247 | Ga0268266_10086215 | 3300028379 | Bacteria | 2745 |
| 248 | Ga0268264_10061042 | 3300028381 | Bacteria | 3161 |
| 249 | Ga0268264_10343507 | 3300028381 | Bacteria | 1418 |
| 250 | Ga0307516_10168768 | 3300031730 | Bacteria | 1930 |
| 251 | Ga0307413_10001920 | 3300031824 | Bacteria | 8238 |
| 252 | Ga0307416_100295279 | 3300032002 | Bacteria | 1607 |
| 253 | Ga0439436_0014444 | 3300041404 | Bacteria | 2382 |
| 254 | Ga0439465_0007780 | 3300041413 | Bacteria | 3398 |
| 255 | Ga0451802_0955984 | 3300041460 | Bacteria | 884 |
| 256 | Ga0451853_0293453 | 3300041512 | Bacteria | 1011 |
| 257 | Ga0439452_031599 | 3300042010 | Bacteria | 1298 |
| 258 | Ga0495638_0209560 | 3300046460 | Bacteria | 1096 |
| 259 | Ga0495628_0450577 | 3300046516 | Bacteria | 935 |
| 260 | Ga0495670_0233881 | 3300046691 | Bacteria | 978 |
| 261 | Ga0496100_0225687 | 3300048903 | Bacteria | 1376 |
| 262 | Ga0496103_0230919 | 3300048906 | Bacteria | 1190 |
| 263 | Ga0496104_0000012 | 3300048907 | Bacteria | 438011 |
| 264 | Ga0496105_0000032 | 3300048908 | Bacteria | 135801 |
| 265 | Ga0496106_0558789 | 3300048909 | Bacteria | 918 |
| 266 | Ga0496107_0060160 | 3300048910 | Bacteria | 2749 |
| 267 | Ga0496115_0024945 | 3300048918 | Bacteria | 4651 |
| 268 | Ga0496117_0003312 | 3300048920 | Bacteria | 18824 |
| 269 | Ga0496117_0026632 | 3300048920 | Bacteria | 4521 |
| 270 | Ga0496118_0000101 | 3300048921 | Bacteria | 159577 |
| 271 | Ga0496118_0000885 | 3300048921 | Bacteria | 47246 |
| 272 | Ga0496119_0001389 | 3300048922 | Bacteria | 29376 |
| 273 | Ga0496120_0001232 | 3300048923 | Bacteria | 32376 |
| 274 | Ga0496121_0000282 | 3300048924 | Bacteria | 105900 |
| 275 | Ga0496121_0039199 | 3300048924 | Bacteria | 4180 |
| 276 | Ga0496121_0042405 | 3300048924 | Bacteria | 3959 |
| 277 | Ga0496126_0000160 | 3300048929 | Bacteria | 155144 |
| 278 | Ga0496126_0157753 | 3300048929 | Bacteria | 1941 |
| 279 | Ga0501043_0042640 | 3300049579 | Bacteria | 3566 |
| 280 | Ga0501046_0614356 | 3300049580 | Bacteria | 771 |
| 281 | Ga0501068_0055597 | 3300049584 | Bacteria | 2398 |
| 282 | Ga0501073_0189782 | 3300049589 | Bacteria | 1422 |
| 283 | Ga0501080_0107782 | 3300049742 | Bacteria | 2582 |
| 284 | Ga0501044_0215393 | 3300049823 | Bacteria | 1873 |
| 285 | Ga0501044_0483483 | 3300049823 | Bacteria | 1141 |
| 286 | Ga0500635_0000511 | 3300053080 | Bacteria | 10708 |
| 287 | Ga0500651_0216729 | 3300053093 | Unclassified | 1124 |
| 288 | Ga0500608_002619 | 3300053122 | Bacteria | 6588 |
| 289 | Ga0500636_0147784 | 3300053177 | Bacteria | 1294 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048906 | Ga0496103_0230919 | Ga0496103_0230919_377_970 | 184 |
| 2 | 3300005331 | Ga0070670_100466631 | Ga0070670_1004666312 | 185 |
| 3 | 3300005335 | Ga0070666_10176550 | Ga0070666_101765502 | 185 |
| 4 | 3300005347 | Ga0070668_100845893 | Ga0070668_1008458931 | 185 |
| 5 | 3300005459 | Ga0068867_100530286 | Ga0068867_1005302861 | 185 |
| 6 | 3300005544 | Ga0070686_100115143 | Ga0070686_1001151432 | 185 |
| 7 | 3300005614 | Ga0068856_100060668 | Ga0068856_1000606681 | 185 |
| 8 | 3300005616 | Ga0068852_100037940 | Ga0068852_1000379403 | 185 |
| 9 | 3300005616 | Ga0068852_100105687 | Ga0068852_1001056872 | 185 |
| 10 | 3300005617 | Ga0068859_100015133 | Ga0068859_1000151334 | 185 |
| 11 | 3300005618 | Ga0068864_100006327 | Ga0068864_1000063278 | 185 |
| 12 | 3300005841 | Ga0068863_100009483 | Ga0068863_1000094834 | 185 |
| 13 | 3300005842 | Ga0068858_100741090 | Ga0068858_1007410901 | 185 |
| 14 | 3300005843 | Ga0068860_100077905 | Ga0068860_1000779052 | 185 |
| 15 | 3300006881 | Ga0068865_100044518 | Ga0068865_1000445181 | 185 |
| 16 | 3300006931 | Ga0097620_100015133 | Ga0097620_1000151334 | 185 |
| 17 | 3300009176 | Ga0105242_10001521 | Ga0105242_1000152115 | 185 |
| 18 | 3300013104 | Ga0157370_10244792 | Ga0157370_102447922 | 185 |
| 19 | 3300013306 | Ga0163162_10018425 | Ga0163162_100184252 | 185 |
| 20 | 3300013308 | Ga0157375_10004905 | Ga0157375_1000490510 | 185 |
| 21 | 3300014325 | Ga0163163_10016248 | Ga0163163_100162485 | 185 |
| 22 | 3300014968 | Ga0157379_10008254 | Ga0157379_100082544 | 185 |
| 23 | 3300014968 | Ga0157379_11071274 | Ga0157379_110712741 | 185 |
| 24 | 3300014969 | Ga0157376_10009315 | Ga0157376_100093154 | 185 |
| 25 | 3300025925 | Ga0207650_10188788 | Ga0207650_101887882 | 185 |
| 26 | 3300025934 | Ga0207686_10002225 | Ga0207686_1000222510 | 185 |
| 27 | 3300025941 | Ga0207711_10089867 | Ga0207711_100898672 | 185 |
| 28 | 3300025941 | Ga0207711_10144076 | Ga0207711_101440762 | 185 |
| 29 | 3300025944 | Ga0207661_10394842 | Ga0207661_103948422 | 185 |
| 30 | 3300025960 | Ga0207651_10547520 | Ga0207651_105475202 | 185 |
| 31 | 3300026035 | Ga0207703_10147707 | Ga0207703_101477072 | 185 |
| 32 | 3300026078 | Ga0207702_10047523 | Ga0207702_100475232 | 185 |
| 33 | 3300026088 | Ga0207641_10034989 | Ga0207641_100349893 | 185 |
| 34 | 3300026095 | Ga0207676_10007201 | Ga0207676_100072014 | 185 |
| 35 | 3300026142 | Ga0207698_10086147 | Ga0207698_100861472 | 185 |
| 36 | 3300028381 | Ga0268264_10061042 | Ga0268264_100610423 | 185 |
| 37 | 3300031730 | Ga0307516_10168768 | Ga0307516_101687682 | 185 |
| 38 | 3300048907 | Ga0496104_0000012 | Ga0496104_0000012_8350_8964 | 185 |
| 39 | 3300048908 | Ga0496105_0000032 | Ga0496105_0000032_126860_127474 | 185 |
| 40 | 3300003775 | Ga0055524_1005871 | Ga0055524_10058713 | 186 |
| 41 | 3300003775 | Ga0055524_1020268 | Ga0055524_10202683 | 186 |
| 42 | 3300003781 | Ga0055536_1002805 | Ga0055536_10028058 | 186 |
| 43 | 3300003781 | Ga0055536_1007437 | Ga0055536_10074375 | 186 |
| 44 | 3300003791 | Ga0055530_10003834 | Ga0055530_100038341 | 186 |
| 45 | 3300003794 | Ga0055531_10001978 | Ga0055531_100019783 | 186 |
| 46 | 3300003794 | Ga0055531_10008870 | Ga0055531_100088702 | 186 |
| 47 | 3300003794 | Ga0055531_10017109 | Ga0055531_100171092 | 186 |
| 48 | 3300003794 | Ga0055531_10021978 | Ga0055531_100219783 | 186 |
| 49 | 3300003794 | Ga0055531_10024193 | Ga0055531_100241931 | 186 |
| 50 | 3300005344 | Ga0070661_100079302 | Ga0070661_1000793022 | 186 |
| 51 | 3300005548 | Ga0070665_100639336 | Ga0070665_1006393362 | 186 |
| 52 | 3300005577 | Ga0068857_100414310 | Ga0068857_1004143102 | 186 |
| 53 | 3300005616 | Ga0068852_100215143 | Ga0068852_1002151432 | 186 |
| 54 | 3300005834 | Ga0068851_10099593 | Ga0068851_100995933 | 186 |
| 55 | 3300006237 | Ga0097621_100391061 | Ga0097621_1003910612 | 186 |
| 56 | 3300006881 | Ga0068865_100039066 | Ga0068865_1000390663 | 186 |
| 57 | 3300009551 | Ga0105238_10168783 | Ga0105238_101687832 | 186 |
| 58 | 3300014325 | Ga0163163_10038492 | Ga0163163_100384923 | 186 |
| 59 | 3300025273 | Ga0209673_1013304 | Ga0209673_10133043 | 186 |
| 60 | 3300025284 | Ga0209130_1003814 | Ga0209130_10038145 | 186 |
| 61 | 3300025291 | Ga0209675_1005655 | Ga0209675_10056552 | 186 |
| 62 | 3300025291 | Ga0209675_1010253 | Ga0209675_10102533 | 186 |
| 63 | 3300025291 | Ga0209675_1014778 | Ga0209675_10147781 | 186 |
| 64 | 3300025292 | Ga0209676_1000809 | Ga0209676_10008098 | 186 |
| 65 | 3300025292 | Ga0209676_1001495 | Ga0209676_10014953 | 186 |
| 66 | 3300025292 | Ga0209676_1003105 | Ga0209676_10031059 | 186 |
| 67 | 3300025292 | Ga0209676_1004762 | Ga0209676_10047622 | 186 |
| 68 | 3300025292 | Ga0209676_1005188 | Ga0209676_10051885 | 186 |
| 69 | 3300025292 | Ga0209676_1014952 | Ga0209676_10149523 | 186 |
| 70 | 3300025294 | Ga0209025_1001646 | Ga0209025_100164613 | 186 |
| 71 | 3300025294 | Ga0209025_1002555 | Ga0209025_10025558 | 186 |
| 72 | 3300025294 | Ga0209025_1057591 | Ga0209025_10575912 | 186 |
| 73 | 3300025294 | Ga0209025_1093698 | Ga0209025_10936982 | 186 |
| 74 | 3300025295 | Ga0209564_1003278 | Ga0209564_10032785 | 186 |
| 75 | 3300025297 | Ga0209758_1013007 | Ga0209758_10130072 | 186 |
| 76 | 3300025298 | Ga0209050_1000712 | Ga0209050_100071238 | 186 |
| 77 | 3300025299 | Ga0209256_1003634 | Ga0209256_10036345 | 186 |
| 78 | 3300025299 | Ga0209256_1004476 | Ga0209256_10044765 | 186 |
| 79 | 3300025302 | Ga0207426_1067457 | Ga0207426_10674572 | 186 |
| 80 | 3300025303 | Ga0209051_1023682 | Ga0209051_10236822 | 186 |
| 81 | 3300025304 | Ga0209257_1000210 | Ga0209257_100021041 | 186 |
| 82 | 3300025304 | Ga0209257_1000856 | Ga0209257_10008566 | 186 |
| 83 | 3300025304 | Ga0209257_1002551 | Ga0209257_10025519 | 186 |
| 84 | 3300025304 | Ga0209257_1003823 | Ga0209257_10038235 | 186 |
| 85 | 3300025304 | Ga0209257_1013406 | Ga0209257_10134062 | 186 |
| 86 | 3300025913 | Ga0207695_10000304 | Ga0207695_1000030485 | 186 |
| 87 | 3300025920 | Ga0207649_10344909 | Ga0207649_103449092 | 186 |
| 88 | 3300025938 | Ga0207704_10024547 | Ga0207704_100245473 | 186 |
| 89 | 3300025944 | Ga0207661_10736799 | Ga0207661_107367991 | 186 |
| 90 | 3300025949 | Ga0207667_10327793 | Ga0207667_103277932 | 186 |
| 91 | 3300026041 | Ga0207639_10172886 | Ga0207639_101728862 | 186 |
| 92 | 3300026067 | Ga0207678_10428633 | Ga0207678_104286331 | 186 |
| 93 | 3300026116 | Ga0207674_10295478 | Ga0207674_102954782 | 186 |
| 94 | 3300031824 | Ga0307413_10001920 | Ga0307413_100019202 | 186 |
| 95 | 3300032002 | Ga0307416_100295279 | Ga0307416_1002952792 | 186 |
| 96 | 3300041404 | Ga0439436_0014444 | Ga0439436_0014444_1222_1812 | 186 |
| 97 | 3300041413 | Ga0439465_0007780 | Ga0439465_0007780_2070_2660 | 186 |
| 98 | 3300042010 | Ga0439452_031599 | Ga0439452_031599_448_1038 | 186 |
| 99 | 3300046460 | Ga0495638_0209560 | Ga0495638_0209560_57_662 | 186 |
| 100 | 3300046516 | Ga0495628_0450577 | Ga0495628_0450577_242_838 | 186 |
| 101 | 3300046691 | Ga0495670_0233881 | Ga0495670_0233881_32_619 | 186 |
| 102 | 3300048903 | Ga0496100_0225687 | Ga0496100_0225687_238_873 | 186 |
| 103 | 3300048909 | Ga0496106_0558789 | Ga0496106_0558789_79_699 | 186 |
| 104 | 3300048910 | Ga0496107_0060160 | Ga0496107_0060160_683_1303 | 186 |
| 105 | 3300048918 | Ga0496115_0024945 | Ga0496115_0024945_372_992 | 186 |
| 106 | 3300048920 | Ga0496117_0026632 | Ga0496117_0026632_2293_2913 | 186 |
| 107 | 3300048921 | Ga0496118_0000885 | Ga0496118_0000885_44362_44982 | 186 |
| 108 | 3300048922 | Ga0496119_0001389 | Ga0496119_0001389_23576_24190 | 186 |
| 109 | 3300048923 | Ga0496120_0001232 | Ga0496120_0001232_7411_8025 | 186 |
| 110 | 3300048924 | Ga0496121_0000282 | Ga0496121_0000282_102953_103573 | 186 |
| 111 | 3300048924 | Ga0496121_0039199 | Ga0496121_0039199_731_1366 | 186 |
| 112 | 3300048929 | Ga0496126_0000160 | Ga0496126_0000160_75250_75870 | 186 |
| 113 | 3300048929 | Ga0496126_0157753 | Ga0496126_0157753_174_788 | 186 |
| 114 | 3300049579 | Ga0501043_0042640 | Ga0501043_0042640_816_1406 | 186 |
| 115 | 3300053080 | Ga0500635_0000511 | Ga0500635_0000511_4031_4615 | 186 |
| 116 | 3300053122 | Ga0500608_002619 | Ga0500608_002619_1173_1790 | 186 |
| 117 | 3300053177 | Ga0500636_0147784 | Ga0500636_0147784_518_1114 | 186 |
| 118 | iso_pu_bacteria | 8003014200 | 8003015278 | 186 |
| 119 | 3300005841 | Ga0068863_100087076 | Ga0068863_1000870763 | 187 |
| 120 | 3300006237 | Ga0097621_100359036 | Ga0097621_1003590362 | 187 |
| 121 | 3300009148 | Ga0105243_10252539 | Ga0105243_102525392 | 187 |
| 122 | 3300013296 | Ga0157374_10266726 | Ga0157374_102667262 | 187 |
| 123 | 3300013306 | Ga0163162_10262545 | Ga0163162_102625451 | 187 |
| 124 | 3300014969 | Ga0157376_10500081 | Ga0157376_105000812 | 187 |
| 125 | 3300005334 | Ga0068869_100169687 | Ga0068869_1001696872 | 188 |
| 126 | 3300005340 | Ga0070689_100321811 | Ga0070689_1003218112 | 188 |
| 127 | 3300005353 | Ga0070669_100085706 | Ga0070669_1000857062 | 188 |
| 128 | 3300005365 | Ga0070688_100373246 | Ga0070688_1003732462 | 188 |
| 129 | 3300005548 | Ga0070665_100580701 | Ga0070665_1005807012 | 188 |
| 130 | 3300005548 | Ga0070665_100623613 | Ga0070665_1006236132 | 188 |
| 131 | 3300015685 | Ga0183369_1003 | Ga0183369_1003197 | 188 |
| 132 | 3300025907 | Ga0207645_10034627 | Ga0207645_100346273 | 188 |
| 133 | 3300025923 | Ga0207681_10166970 | Ga0207681_101669702 | 188 |
| 134 | 3300025942 | Ga0207689_10079635 | Ga0207689_100796352 | 188 |
| 135 | 3300025972 | Ga0207668_10289042 | Ga0207668_102890422 | 188 |
| 136 | 3300025986 | Ga0207658_10112039 | Ga0207658_101120392 | 188 |
| 137 | 3300026121 | Ga0207683_10088947 | Ga0207683_100889471 | 188 |
| 138 | 3300028379 | Ga0268266_10086215 | Ga0268266_100862153 | 188 |
| 139 | 3300049580 | Ga0501046_0614356 | Ga0501046_0614356_24_629 | 188 |
| 140 | 3300053093 | Ga0500651_0216729 | Ga0500651_0216729_30_665 | 189 |
| 141 | 3300005340 | Ga0070689_100123652 | Ga0070689_1001236522 | 190 |
| 142 | 3300006881 | Ga0068865_100101254 | Ga0068865_1001012542 | 190 |
| 143 | 3300025934 | Ga0207686_10094741 | Ga0207686_100947411 | 190 |
| 144 | 3300025936 | Ga0207670_10143887 | Ga0207670_101438872 | 190 |
| 145 | 3300026089 | Ga0207648_10072179 | Ga0207648_100721793 | 190 |
| 146 | 3300041512 | Ga0451853_0293453 | Ga0451853_0293453_297_974 | 190 |
| 147 | 3300005334 | Ga0068869_100934990 | Ga0068869_1009349901 | 191 |
| 148 | 3300005367 | Ga0070667_100242512 | Ga0070667_1002425122 | 191 |
| 149 | 3300005719 | Ga0068861_100053361 | Ga0068861_1000533614 | 191 |
| 150 | 3300005983 | Ga0081540_1033154 | Ga0081540_10331542 | 191 |
| 151 | 3300017792 | Ga0163161_10568856 | Ga0163161_105688561 | 191 |
| 152 | 3300025938 | Ga0207704_10351605 | Ga0207704_103516052 | 191 |
| 153 | 3300025940 | Ga0207691_10296717 | Ga0207691_102967172 | 191 |
| 154 | 3300025972 | Ga0207668_10368481 | Ga0207668_103684811 | 191 |
| 155 | 3300025986 | Ga0207658_10348403 | Ga0207658_103484031 | 191 |
| 156 | 3300026088 | Ga0207641_10773605 | Ga0207641_107736052 | 191 |
| 157 | 3300026118 | Ga0207675_100067424 | Ga0207675_1000674242 | 191 |
| 158 | 3300005327 | Ga0070658_10346548 | Ga0070658_103465481 | 192 |
| 159 | 3300005327 | Ga0070658_11096195 | Ga0070658_110961951 | 192 |
| 160 | 3300005329 | Ga0070683_100019696 | Ga0070683_1000196963 | 192 |
| 161 | 3300005329 | Ga0070683_100271642 | Ga0070683_1002716422 | 192 |
| 162 | 3300005334 | Ga0068869_100026006 | Ga0068869_1000260063 | 192 |
| 163 | 3300005335 | Ga0070666_10090894 | Ga0070666_100908943 | 192 |
| 164 | 3300005355 | Ga0070671_100197531 | Ga0070671_1001975313 | 192 |
| 165 | 3300005366 | Ga0070659_100020448 | Ga0070659_1000204483 | 192 |
| 166 | 3300005367 | Ga0070667_100040180 | Ga0070667_1000401802 | 192 |
| 167 | 3300005455 | Ga0070663_100058052 | Ga0070663_1000580523 | 192 |
| 168 | 3300005457 | Ga0070662_100128656 | Ga0070662_1001286563 | 192 |
| 169 | 3300005458 | Ga0070681_10020370 | Ga0070681_100203703 | 192 |
| 170 | 3300005458 | Ga0070681_10487203 | Ga0070681_104872031 | 192 |
| 171 | 3300005535 | Ga0070684_100033622 | Ga0070684_1000336223 | 192 |
| 172 | 3300005539 | Ga0068853_100002428 | Ga0068853_10000242812 | 192 |
| 173 | 3300005539 | Ga0068853_100154900 | Ga0068853_1001549002 | 192 |
| 174 | 3300005539 | Ga0068853_100277572 | Ga0068853_1002775722 | 192 |
| 175 | 3300005539 | Ga0068853_100522577 | Ga0068853_1005225772 | 192 |
| 176 | 3300005563 | Ga0068855_100095596 | Ga0068855_1000955963 | 192 |
| 177 | 3300005564 | Ga0070664_100134294 | Ga0070664_1001342942 | 192 |
| 178 | 3300005564 | Ga0070664_100548656 | Ga0070664_1005486562 | 192 |
| 179 | 3300005577 | Ga0068857_100025890 | Ga0068857_1000258903 | 192 |
| 180 | 3300005578 | Ga0068854_100003891 | Ga0068854_10000389110 | 192 |
| 181 | 3300005578 | Ga0068854_100114768 | Ga0068854_1001147682 | 192 |
| 182 | 3300005614 | Ga0068856_100009013 | Ga0068856_1000090136 | 192 |
| 183 | 3300005614 | Ga0068856_100054143 | Ga0068856_1000541432 | 192 |
| 184 | 3300005614 | Ga0068856_100178008 | Ga0068856_1001780082 | 192 |
| 185 | 3300005614 | Ga0068856_100292885 | Ga0068856_1002928852 | 192 |
| 186 | 3300005616 | Ga0068852_100034398 | Ga0068852_1000343982 | 192 |
| 187 | 3300005617 | Ga0068859_100001424 | Ga0068859_1000014241 | 192 |
| 188 | 3300005834 | Ga0068851_10030037 | Ga0068851_100300373 | 192 |
| 189 | 3300005834 | Ga0068851_10095456 | Ga0068851_100954561 | 192 |
| 190 | 3300005841 | Ga0068863_100032368 | Ga0068863_1000323684 | 192 |
| 191 | 3300005841 | Ga0068863_100624843 | Ga0068863_1006248432 | 192 |
| 192 | 3300005843 | Ga0068860_100017903 | Ga0068860_1000179033 | 192 |
| 193 | 3300006931 | Ga0097620_100001424 | Ga0097620_1000014241 | 192 |
| 194 | 3300009093 | Ga0105240_10044537 | Ga0105240_100445374 | 192 |
| 195 | 3300009093 | Ga0105240_10080372 | Ga0105240_100803722 | 192 |
| 196 | 3300009098 | Ga0105245_10256613 | Ga0105245_102566132 | 192 |
| 197 | 3300009101 | Ga0105247_10294174 | Ga0105247_102941742 | 192 |
| 198 | 3300009174 | Ga0105241_10004054 | Ga0105241_100040548 | 192 |
| 199 | 3300009174 | Ga0105241_10065893 | Ga0105241_100658933 | 192 |
| 200 | 3300009174 | Ga0105241_10213363 | Ga0105241_102133632 | 192 |
| 201 | 3300009174 | Ga0105241_10752422 | Ga0105241_107524221 | 192 |
| 202 | 3300009545 | Ga0105237_10028694 | Ga0105237_100286944 | 192 |
| 203 | 3300009545 | Ga0105237_10157200 | Ga0105237_101572002 | 192 |
| 204 | 3300009551 | Ga0105238_10042076 | Ga0105238_100420763 | 192 |
| 205 | 3300009551 | Ga0105238_10044240 | Ga0105238_100442403 | 192 |
| 206 | 3300010375 | Ga0105239_10010305 | Ga0105239_100103059 | 192 |
| 207 | 3300010375 | Ga0105239_10019000 | Ga0105239_100190004 | 192 |
| 208 | 3300010375 | Ga0105239_10550053 | Ga0105239_105500532 | 192 |
| 209 | 3300011119 | Ga0105246_10052896 | Ga0105246_100528963 | 192 |
| 210 | 3300013104 | Ga0157370_10002937 | Ga0157370_1000293715 | 192 |
| 211 | 3300013104 | Ga0157370_10156848 | Ga0157370_101568483 | 192 |
| 212 | 3300013105 | Ga0157369_10003913 | Ga0157369_100039137 | 192 |
| 213 | 3300013105 | Ga0157369_10018584 | Ga0157369_100185846 | 192 |
| 214 | 3300013296 | Ga0157374_10424207 | Ga0157374_104242072 | 192 |
| 215 | 3300013307 | Ga0157372_10003498 | Ga0157372_100034983 | 192 |
| 216 | 3300013307 | Ga0157372_10167045 | Ga0157372_101670452 | 192 |
| 217 | 3300014497 | Ga0182008_10052150 | Ga0182008_100521503 | 192 |
| 218 | 3300025303 | Ga0209051_1015703 | Ga0209051_10157032 | 192 |
| 219 | 3300025321 | Ga0207656_10065682 | Ga0207656_100656822 | 192 |
| 220 | 3300025903 | Ga0207680_10395366 | Ga0207680_103953661 | 192 |
| 221 | 3300025904 | Ga0207647_10030728 | Ga0207647_100307283 | 192 |
| 222 | 3300025909 | Ga0207705_10124074 | Ga0207705_101240742 | 192 |
| 223 | 3300025909 | Ga0207705_10300705 | Ga0207705_103007052 | 192 |
| 224 | 3300025911 | Ga0207654_10003015 | Ga0207654_100030157 | 192 |
| 225 | 3300025911 | Ga0207654_10103237 | Ga0207654_101032372 | 192 |
| 226 | 3300025911 | Ga0207654_10315357 | Ga0207654_103153572 | 192 |
| 227 | 3300025912 | Ga0207707_10426436 | Ga0207707_104264362 | 192 |
| 228 | 3300025913 | Ga0207695_10001866 | Ga0207695_100018664 | 192 |
| 229 | 3300025914 | Ga0207671_10004089 | Ga0207671_100040892 | 192 |
| 230 | 3300025914 | Ga0207671_10104837 | Ga0207671_101048373 | 192 |
| 231 | 3300025919 | Ga0207657_10003400 | Ga0207657_1000340015 | 192 |
| 232 | 3300025920 | Ga0207649_10002169 | Ga0207649_100021695 | 192 |
| 233 | 3300025920 | Ga0207649_10103853 | Ga0207649_101038532 | 192 |
| 234 | 3300025924 | Ga0207694_10094160 | Ga0207694_100941602 | 192 |
| 235 | 3300025924 | Ga0207694_10577877 | Ga0207694_105778772 | 192 |
| 236 | 3300025927 | Ga0207687_10170698 | Ga0207687_101706982 | 192 |
| 237 | 3300025927 | Ga0207687_10183183 | Ga0207687_101831832 | 192 |
| 238 | 3300025931 | Ga0207644_10451646 | Ga0207644_104516462 | 192 |
| 239 | 3300025942 | Ga0207689_10025543 | Ga0207689_100255433 | 192 |
| 240 | 3300025944 | Ga0207661_10078539 | Ga0207661_100785392 | 192 |
| 241 | 3300025945 | Ga0207679_10243064 | Ga0207679_102430642 | 192 |
| 242 | 3300025949 | Ga0207667_10009478 | Ga0207667_1000947812 | 192 |
| 243 | 3300025949 | Ga0207667_10055679 | Ga0207667_100556793 | 192 |
| 244 | 3300025972 | Ga0207668_10006724 | Ga0207668_100067245 | 192 |
| 245 | 3300025981 | Ga0207640_10012296 | Ga0207640_100122962 | 192 |
| 246 | 3300025981 | Ga0207640_10442800 | Ga0207640_104428002 | 192 |
| 247 | 3300025986 | Ga0207658_10247430 | Ga0207658_102474302 | 192 |
| 248 | 3300026035 | Ga0207703_10141488 | Ga0207703_101414882 | 192 |
| 249 | 3300026035 | Ga0207703_10993362 | Ga0207703_109933621 | 192 |
| 250 | 3300026041 | Ga0207639_10002482 | Ga0207639_100024824 | 192 |
| 251 | 3300026041 | Ga0207639_10038293 | Ga0207639_100382934 | 192 |
| 252 | 3300026067 | Ga0207678_10802698 | Ga0207678_108026982 | 192 |
| 253 | 3300026078 | Ga0207702_10001978 | Ga0207702_100019788 | 192 |
| 254 | 3300026078 | Ga0207702_10602274 | Ga0207702_106022742 | 192 |
| 255 | 3300026088 | Ga0207641_10522570 | Ga0207641_105225702 | 192 |
| 256 | 3300026088 | Ga0207641_10707492 | Ga0207641_107074921 | 192 |
| 257 | 3300026116 | Ga0207674_10007979 | Ga0207674_100079797 | 192 |
| 258 | 3300026116 | Ga0207674_10151171 | Ga0207674_101511713 | 192 |
| 259 | 3300026118 | Ga0207675_100370374 | Ga0207675_1003703741 | 192 |
| 260 | 3300026142 | Ga0207698_10895587 | Ga0207698_108955872 | 192 |
| 261 | 3300028381 | Ga0268264_10343507 | Ga0268264_103435072 | 192 |
| 262 | 3300041460 | Ga0451802_0955984 | Ga0451802_0955984_108_728 | 192 |
| 263 | 3300049584 | Ga0501068_0055597 | Ga0501068_0055597_592_1215 | 192 |
| 264 | 3300049589 | Ga0501073_0189782 | Ga0501073_0189782_237_860 | 192 |
| 265 | 3300049742 | Ga0501080_0107782 | Ga0501080_0107782_1151_1774 | 192 |
| 266 | 3300049823 | Ga0501044_0215393 | Ga0501044_0215393_393_1016 | 192 |
| 267 | 3300049823 | Ga0501044_0483483 | Ga0501044_0483483_331_975 | 192 |
| 268 | 3300005367 | Ga0070667_100027012 | Ga0070667_1000270122 | 193 |
| 269 | 3300005548 | Ga0070665_100000026 | Ga0070665_10000002692 | 193 |
| 270 | 3300025299 | Ga0209256_1002032 | Ga0209256_10020323 | 193 |
| 271 | 3300025986 | Ga0207658_10158520 | Ga0207658_101585203 | 193 |
| 272 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011177 | 193 |
| 273 | 3300005616 | Ga0068852_100006698 | Ga0068852_1000066985 | 194 |
| 274 | 3300006358 | Ga0068871_100184909 | Ga0068871_1001849092 | 194 |
| 275 | 3300026041 | Ga0207639_10209051 | Ga0207639_102090512 | 194 |
| 276 | 3300048920 | Ga0496117_0003312 | Ga0496117_0003312_16853_17488 | 194 |
| 277 | 3300048921 | Ga0496118_0000101 | Ga0496118_0000101_115930_116565 | 194 |
| 278 | 3300048924 | Ga0496121_0042405 | Ga0496121_0042405_3187_3822 | 194 |
| 279 | 3300005841 | Ga0068863_100089693 | Ga0068863_1000896932 | 197 |
| 280 | 3300006237 | Ga0097621_100246427 | Ga0097621_1002464272 | 197 |
| 281 | 3300006358 | Ga0068871_100025811 | Ga0068871_1000258113 | 197 |
| 282 | 3300009177 | Ga0105248_10271877 | Ga0105248_102718772 | 197 |
| 283 | 3300026088 | Ga0207641_10079981 | Ga0207641_100799812 | 197 |
| 284 | 3300014969 | Ga0157376_10081333 | Ga0157376_100813332 | 200 |
| 285 | 3300001989 | JGI24739J22299_10001924 | JGI24739J22299_100019249 | 203 |
| 286 | 3300001990 | JGI24737J22298_10000189 | JGI24737J22298_100001899 | 203 |
| 287 | 3300002067 | JGI24735J21928_10000048 | JGI24735J21928_100000489 | 203 |
| 288 | 3300013102 | Ga0157371_10028873 | Ga0157371_100288733 | 203 |
| 289 | 3300013104 | Ga0157370_10168236 | Ga0157370_101682362 | 203 |
| 290 | 3300013307 | Ga0157372_10000120 | Ga0157372_1000012042 | 203 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rzg-assembly1.cif.gz_A | duplex interrogation by a direct dna repair protein in the search of damage | 0.9157 | 17 | 203 |
| 3s5a-assembly1.cif.gz_A | abh2 cross-linked to undamaged dsdna-2 with cofactors | 0.9112 | 17 | 203 |
| 3btz-assembly1.cif.gz_A | crystal structure of human abh2 cross-linked to dsdna | 0.9105 | 21 | 203 |
| 3buc-assembly1.cif.gz_A | x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg | 0.9099 | 21 | 203 |
| 2iuw-assembly1.cif.gz_A-2 | crystal structure of human abh3 in complex with iron ion and 2- oxoglutarate | 0.9063 | 21 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SIE0_90_314_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.908 | 21 | 202 | 2.60.120.590 |
| 2iuwA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9063 | 21 | 203 | 2.60.120.590 |
| 3rzlA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9029 | 21 | 203 | 2.60.120.590 |
| af_L7N6A4_38_203_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.88 | 33 | 202 | 2.60.120.590 |
| af_L7N6A4_38_203_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8596 | 33 | 202 | 2.60.120.590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W2A7G3-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.966 | 19 | 200 |
GO:0006307
GO:0051213 |
| AF-A4AW87-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.9611 | 81 | 202 |
GO:0006307
GO:0051213 |
| AF-A0A2S9YF58-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.9578 | 21 | 202 |
GO:0006307
GO:0051213 |
| AF-A0A3C0HGN5-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.9577 | 21 | 200 |
GO:0006307
GO:0051213 |
| AF-S7X5J3-F1-model_v4 | DNA repair system specific for alkylated DNA | 0.9574 | 86 | 203 |
GO:0006307
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar