F389583

General Info

Members Datasets Scaffolds Average Seq Length
290 143 580 173

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10096703|Ga0070677_100967031
Length 196
Sequence MTMMKATLTLFQRCRLSVLFMLGRCPLLACLALAAIGIAAPAMPQDVQAPCRLCDASANMIDDKPAAPISLDVEASLDFDRLILAGAGSGTAELGPDGTRIVTGTVTALSARAMVGEVIIRGEPGRTVRVDLPRNIELWGFNGGSIQIDSIRSDLPPAPRLDSNGKLTFRFGGVIRLSGDADGQFRGDVRIDVDYF

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
108 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
134 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
135 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
136 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
137 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
138 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
139 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
140 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 23.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10096703 3300005333 Unclassified 1294
2 JGI24034J26672_10037033 3300002239 Unclassified 810
3 Ga0065715_10093315 3300005293 Bacteria 4717
4 Ga0065715_10466657 3300005293 Unclassified 810
5 Ga0070658_10029744 3300005327 Bacteria 4389
6 Ga0070658_10053165 3300005327 Bacteria 3286
7 Ga0070658_10219474 3300005327 Bacteria 1607
8 Ga0070670_100005097 3300005331 Bacteria 11057
9 Ga0070670_100018741 3300005331 Bacteria 5934
10 Ga0070670_100340116 3300005331 Bacteria 1317
11 Ga0070670_100734352 3300005331 Unclassified 889
12 Ga0070677_10001818 3300005333 Bacteria 6735
13 Ga0070680_100346993 3300005336 Bacteria 1262
14 Ga0070682_100299340 3300005337 Bacteria 1180
15 Ga0070660_100166782 3300005339 Bacteria 1777
16 Ga0070660_100679327 3300005339 Unclassified 863
17 Ga0070660_100836584 3300005339 Bacteria 775
18 Ga0070661_100007969 3300005344 Bacteria 7316
19 Ga0070661_100489622 3300005344 Bacteria 983
20 Ga0070692_10008008 3300005345 Bacteria 4689
21 Ga0070692_10035761 3300005345 Bacteria 2516
22 Ga0070668_100078307 3300005347 Bacteria 2585
23 Ga0070668_100087179 3300005347 Bacteria 2456
24 Ga0070669_100013468 3300005353 Bacteria 5813
25 Ga0070669_100105957 3300005353 Bacteria 2128
26 Ga0070669_100106873 3300005353 Bacteria 2119
27 Ga0070669_100298345 3300005353 Bacteria 1295
28 Ga0070669_100418599 3300005353 Unclassified 1099
29 Ga0070669_101084103 3300005353 Unclassified 689
30 Ga0070675_100003250 3300005354 Bacteria 12310
31 Ga0070675_100719188 3300005354 Unclassified 910
32 Ga0070671_100014702 3300005355 Bacteria 6325
33 Ga0070671_100022538 3300005355 Bacteria 5143
34 Ga0070671_100073420 3300005355 Bacteria 2857
35 Ga0070671_100165976 3300005355 Bacteria 1867
36 Ga0070671_100224917 3300005355 Bacteria 1592
37 Ga0070671_100267769 3300005355 Bacteria 1452
38 Ga0070673_100017653 3300005364 Bacteria 5080
39 Ga0070673_100148989 3300005364 Bacteria 1980
40 Ga0070673_100222815 3300005364 Bacteria 1633
41 Ga0070688_100344369 3300005365 Unclassified 1089
42 Ga0070659_100021834 3300005366 Bacteria 4881
43 Ga0070659_100096740 3300005366 Bacteria 2372
44 Ga0070659_100185099 3300005366 Unclassified 1710
45 Ga0070659_100271916 3300005366 Unclassified 1408
46 Ga0070659_100486983 3300005366 Bacteria 1050
47 Ga0070667_100078250 3300005367 Bacteria 2825
48 Ga0070667_100428825 3300005367 Bacteria 1206
49 Ga0070714_100330660 3300005435 Unclassified 1427
50 Ga0070662_100004563 3300005457 Bacteria 8767
51 Ga0070662_100214839 3300005457 Unclassified 1532
52 Ga0070662_100251845 3300005457 Bacteria 1420
53 Ga0070681_10072137 3300005458 Bacteria 3416
54 Ga0070681_10571100 3300005458 Bacteria 1045
55 Ga0070679_100039740 3300005530 Bacteria 4677
56 Ga0070686_100323047 3300005544 Bacteria 1151
57 Ga0070686_100430503 3300005544 Bacteria 1010
58 Ga0070665_100046659 3300005548 Bacteria 4350
59 Ga0068855_100041276 3300005563 Bacteria 5469
60 Ga0068855_100183369 3300005563 Unclassified 2366
61 Ga0070664_100784779 3300005564 Bacteria 890
62 Ga0068857_100391213 3300005577 Bacteria 1292
63 Ga0068857_100773696 3300005577 Unclassified 915
64 Ga0068854_100020112 3300005578 Bacteria 4510
65 Ga0068854_100189720 3300005578 Bacteria 1610
66 Ga0068854_100512304 3300005578 Bacteria 1012
67 Ga0068856_100055774 3300005614 Bacteria 3899
68 Ga0068856_100137446 3300005614 Bacteria 2450
69 Ga0068856_100282393 3300005614 Bacteria 1677
70 Ga0068852_100001895 3300005616 Bacteria 14227
71 Ga0068852_100289479 3300005616 Bacteria 1582
72 Ga0068864_100019694 3300005618 Bacteria 5642
73 Ga0068861_100077867 3300005719 Bacteria 2588
74 Ga0068863_100021743 3300005841 Bacteria 6120
75 Ga0068863_100412588 3300005841 Bacteria 1322
76 Ga0068862_100009040 3300005844 Bacteria 8246
77 Ga0068862_100854837 3300005844 Unclassified 892
78 Ga0068862_100859674 3300005844 Bacteria 889
79 Ga0075431_100009548 3300006847 Bacteria 9744
80 Ga0075434_100795031 3300006871 Unclassified 962
81 Ga0105248_10002389 3300009177 Bacteria 20852
82 Ga0105238_10004341 3300009551 Bacteria 14067
83 Ga0157327_1014444 3300012512 Unclassified 808
84 Ga0157373_10262007 3300013100 Unclassified 1223
85 Ga0157373_10313193 3300013100 Unclassified 1116
86 Ga0157373_10439249 3300013100 Bacteria 938
87 Ga0157371_10015102 3300013102 Bacteria 5805
88 Ga0157371_10150942 3300013102 Bacteria 1657
89 Ga0157370_10042516 3300013104 Bacteria 4379
90 Ga0157369_10021690 3300013105 Bacteria 7183
91 Ga0157369_10032368 3300013105 Bacteria 5752
92 Ga0157369_10055583 3300013105 Bacteria 4272
93 Ga0157374_11201508 3300013296 Bacteria 780
94 Ga0163162_10710750 3300013306 Bacteria 1126
95 Ga0157372_10522687 3300013307 Bacteria 1383
96 Ga0157372_11649840 3300013307 Unclassified 738
97 Ga0157380_10000710 3300014326 Bacteria 20822
98 Ga0157380_10008979 3300014326 Bacteria 7141
99 Ga0157380_10011868 3300014326 Bacteria 6300
100 Ga0157380_10508018 3300014326 Bacteria 1172
101 Ga0163161_10026154 3300017792 Bacteria 4134
102 Ga0163161_10368412 3300017792 Bacteria 1146
103 Ga0206353_10557373 3300020082 Bacteria 3326
104 Ga0207697_10002338 3300025315 Bacteria 9876
105 Ga0207656_10212245 3300025321 Bacteria 939
106 Ga0207682_10000494 3300025893 Bacteria 18198
107 Ga0207688_10685703 3300025901 Unclassified 648
108 Ga0207680_10042871 3300025903 Bacteria 2650
109 Ga0207645_10011669 3300025907 Bacteria 5990
110 Ga0207705_10004661 3300025909 Bacteria 10348
111 Ga0207705_10014014 3300025909 Bacteria 5777
112 Ga0207705_10039058 3300025909 Bacteria 3401
113 Ga0207705_10151062 3300025909 Bacteria 1740
114 Ga0207660_10033300 3300025917 Bacteria 3563
115 Ga0207649_10582262 3300025920 Bacteria 859
116 Ga0207652_10070004 3300025921 Bacteria 3046
117 Ga0207652_10202577 3300025921 Bacteria 1786
118 Ga0207681_10098296 3300025923 Bacteria 2105
119 Ga0207681_10164729 3300025923 Bacteria 1675
120 Ga0207681_10275385 3300025923 Unclassified 1323
121 Ga0207694_10008803 3300025924 Bacteria 7615
122 Ga0207650_10021233 3300025925 Bacteria 4590
123 Ga0207650_10051954 3300025925 Bacteria 3034
124 Ga0207650_10144729 3300025925 Bacteria 1871
125 Ga0207659_10540886 3300025926 Unclassified 989
126 Ga0207700_10475075 3300025928 Bacteria 1104
127 Ga0207644_10000138 3300025931 Bacteria 52145
128 Ga0207644_10020351 3300025931 Bacteria 4512
129 Ga0207644_10124001 3300025931 Bacteria 1970
130 Ga0207690_10018965 3300025932 Bacteria 4223
131 Ga0207690_10169143 3300025932 Bacteria 1636
132 Ga0207690_11163394 3300025932 Unclassified 644
133 Ga0207706_10000276 3300025933 Bacteria 55889
134 Ga0207706_10245367 3300025933 Unclassified 1565
135 Ga0207669_10217402 3300025937 Bacteria 1400
136 Ga0207691_10011470 3300025940 Bacteria 8505
137 Ga0207711_10006001 3300025941 Bacteria 10268
138 Ga0207661_11379925 3300025944 Unclassified 647
139 Ga0207679_10061189 3300025945 Bacteria 2801
140 Ga0207667_10066028 3300025949 Bacteria 3772
141 Ga0207667_10700820 3300025949 Unclassified 1015
142 Ga0207651_10024664 3300025960 Bacteria 3725
143 Ga0207651_10085479 3300025960 Bacteria 2289
144 Ga0207712_10531051 3300025961 Unclassified 1010
145 Ga0207668_10035047 3300025972 Bacteria 3338
146 Ga0207668_10037204 3300025972 Bacteria 3255
147 Ga0207668_10146229 3300025972 Bacteria 1824
148 Ga0207640_10024110 3300025981 Bacteria 3666
149 Ga0207640_10505785 3300025981 Bacteria 1007
150 Ga0207658_10251209 3300025986 Bacteria 1503
151 Ga0207658_10286432 3300025986 Bacteria 1414
152 Ga0207658_10476208 3300025986 Bacteria 1109
153 Ga0207639_10063008 3300026041 Bacteria 2869
154 Ga0207639_11199207 3300026041 Unclassified 712
155 Ga0207678_10028868 3300026067 Bacteria 4843
156 Ga0207702_10250514 3300026078 Bacteria 1663
157 Ga0207702_10525621 3300026078 Bacteria 1155
158 Ga0207641_10312592 3300026088 Unclassified 1487
159 Ga0207648_10372586 3300026089 Unclassified 1290
160 Ga0207676_10025317 3300026095 Bacteria 4403
161 Ga0207676_10158267 3300026095 Bacteria 1959
162 Ga0207674_11029020 3300026116 Bacteria 793
163 Ga0207675_100001317 3300026118 Bacteria 24894
164 Ga0207683_10004703 3300026121 Bacteria 11769
165 Ga0207698_10001001 3300026142 Bacteria 16416
166 Ga0207698_10001487 3300026142 Bacteria 13641
167 Ga0268265_10187653 3300028380 Bacteria 1782
168 Ga0268265_10822812 3300028380 Unclassified 907
169 Ga0307405_10266493 3300031731 Bacteria 1282
170 Ga0307405_10645771 3300031731 Unclassified 869
171 Ga0307405_10949267 3300031731 Unclassified 730
172 Ga0307413_10034419 3300031824 Bacteria 2895
173 Ga0307413_10090548 3300031824 Bacteria 1990
174 Ga0307413_10645082 3300031824 Unclassified 872
175 Ga0307410_10082218 3300031852 Bacteria 2265
176 Ga0307410_10179837 3300031852 Bacteria 1600
177 Ga0307410_10215254 3300031852 Bacteria 1474
178 Ga0307406_10416117 3300031901 Unclassified 1069
179 Ga0307406_11020623 3300031901 Unclassified 710
180 Ga0307406_11050483 3300031901 Unclassified 701
181 Ga0307407_10638232 3300031903 Unclassified 796
182 Ga0307407_10942107 3300031903 Unclassified 664
183 Ga0307412_10143035 3300031911 Bacteria 1754
184 Ga0307412_10146891 3300031911 Bacteria 1734
185 Ga0307412_10373449 3300031911 Bacteria 1152
186 Ga0307412_10468135 3300031911 Unclassified 1042
187 Ga0307409_100072598 3300031995 Bacteria 2741
188 Ga0307409_100117140 3300031995 Bacteria 2247
189 Ga0307409_100299800 3300031995 Bacteria 1494
190 Ga0307409_100346939 3300031995 Bacteria 1399
191 Ga0307409_100381821 3300031995 Unclassified 1340
192 Ga0307409_100422918 3300031995 Bacteria 1278
193 Ga0307409_100863224 3300031995 Unclassified 916
194 Ga0307409_101208083 3300031995 Unclassified 779
195 Ga0307409_101400403 3300031995 Unclassified 725
196 Ga0307416_100014890 3300032002 Bacteria 5349
197 Ga0307416_100105859 3300032002 Bacteria 2464
198 Ga0307416_100638198 3300032002 Bacteria 1148
199 Ga0307416_101691469 3300032002 Unclassified 737
200 Ga0307414_10143039 3300032004 Bacteria 1875
201 Ga0307414_10243921 3300032004 Bacteria 1489
202 Ga0307414_10436598 3300032004 Bacteria 1145
203 Ga0307414_10441397 3300032004 Bacteria 1139
204 Ga0307414_10508978 3300032004 Unclassified 1066
205 Ga0307414_10512289 3300032004 Bacteria 1063
206 Ga0307411_10160125 3300032005 Bacteria 1684
207 Ga0307411_10175318 3300032005 Bacteria 1621
208 Ga0307411_10184206 3300032005 Bacteria 1588
209 Ga0307411_10236786 3300032005 Bacteria 1426
210 Ga0307415_100018931 3300032126 Bacteria 4170
211 Ga0307415_100046514 3300032126 Bacteria 2915
212 Ga0307415_100139395 3300032126 Bacteria 1850
213 Ga0307415_101111128 3300032126 Unclassified 740
214 Ga0395899_0009052 3300037312 Bacteria 7651
215 Ga0395899_0041697 3300037312 Bacteria 3429
216 Ga0395899_0171573 3300037312 Bacteria 1527
217 Ga0395899_0200688 3300037312 Bacteria 1391
218 Ga0395900_0015583 3300037418 Bacteria 7748
219 Ga0395900_0027961 3300037418 Bacteria 5774
220 Ga0395900_0176826 3300037418 Bacteria 2170
221 Ga0395900_0514690 3300037418 Bacteria 1145
222 Ga0395898_0085122 3300037466 Bacteria 3047
223 Ga0395898_0096747 3300037466 Bacteria 2836
224 Ga0395898_0403687 3300037466 Bacteria 1303
225 Ga0395905_0014320 3300037471 Bacteria 7579
226 Ga0395905_0032583 3300037471 Bacteria 4900
227 Ga0395905_0035338 3300037471 Bacteria 4692
228 Ga0395905_0119996 3300037471 Unclassified 2471
229 Ga0395905_0193367 3300037471 Bacteria 1908
230 Ga0395905_0206219 3300037471 Bacteria 1842
231 Ga0395905_0292862 3300037471 Bacteria 1514
232 Ga0395905_0510386 3300037471 Bacteria 1102
233 Ga0395905_0950478 3300037471 Bacteria 762
234 Ga0395901_0061169 3300038443 Bacteria 3918
235 Ga0395901_0191372 3300038443 Unclassified 2145
236 Ga0395901_0196071 3300038443 Unclassified 2117
237 Ga0395901_0217000 3300038443 Bacteria 2000
238 Ga0395901_0332123 3300038443 Bacteria 1571
239 Ga0395901_0579799 3300038443 Bacteria 1133
240 Ga0451853_3711517 3300041512 Bacteria 744
241 Ga0450913_017562 3300042117 Unclassified 633
242 Ga0450889_004277 3300042144 Bacteria 1412
243 Ga0439464_0034832 3300042439 Unclassified 1420
244 Ga0466963_0097723 3300044694 Unclassified 2006
245 Ga0466967_0004933 3300045976 Bacteria 9123
246 Ga0466967_0017903 3300045976 Bacteria 5645
247 Ga0495585_0040480 3300046492 Bacteria 2617
248 Ga0495663_0001226 3300046525 Bacteria 8198
249 Ga0495663_0008098 3300046525 Bacteria 2908
250 Ga0495663_0264753 3300046525 Unclassified 613
251 Ga0495642_0024078 3300046528 Bacteria 2407
252 Ga0495654_0146888 3300046530 Unclassified 1046
253 Ga0495598_0026386 3300046537 Bacteria 1592
254 Ga0495621_0021470 3300046539 Bacteria 2128
255 Ga0495621_0067625 3300046539 Bacteria 1309
256 Ga0495633_0058330 3300046558 Unclassified 1812
257 Ga0495668_0288891 3300046616 Unclassified 898
258 Ga0495659_0066334 3300046664 Bacteria 1344
259 Ga0495669_0001309 3300046684 Bacteria 10307
260 Ga0495669_0002250 3300046684 Bacteria 7915
261 Ga0495669_0004107 3300046684 Bacteria 5991
262 Ga0495669_0024490 3300046684 Bacteria 2628
263 Ga0495669_0024674 3300046684 Bacteria 2619
264 Ga0495670_0061560 3300046691 Bacteria 1887
265 Ga0495670_0083517 3300046691 Bacteria 1629
266 Ga0495670_0101683 3300046691 Unclassified 1480
267 Ga0495670_0484784 3300046691 Unclassified 671
268 Ga0495670_0501684 3300046691 Unclassified 659
269 Ga0495636_0269452 3300047318 Unclassified 791
270 Ga0495683_0212803 3300047323 Unclassified 866
271 Ga0495677_0002911 3300047445 Bacteria 6663
272 Ga0495677_0059073 3300047445 Bacteria 1419
273 Ga0495685_029168 3300047447 Bacteria 1898
274 Ga0495681_0108384 3300047470 Unclassified 1206
275 Ga0496107_0325960 3300048910 Bacteria 1143
276 Ga0496109_0002117 3300048912 Bacteria 16511
277 Ga0496111_0058980 3300048914 Bacteria 2780
278 Ga0496112_0115144 3300048915 Bacteria 2659
279 Ga0496113_0003387 3300048916 Bacteria 9536
280 Ga0501202_012307 3300049652 Bacteria 1613
281 Ga0501207_091247 3300049654 Bacteria 600
282 Ga0501227_130052 3300049665 Unclassified 685
283 Ga0501239_020668 3300049672 Unclassified 806
284 Ga0501247_022545 3300049677 Unclassified 825
285 Ga0501249_004236 3300049679 Bacteria 2909
286 Ga0501253_050696 3300049683 Unclassified 868
287 Ga0501268_007428 3300049765 Bacteria 1635
288 nmdc:mga06r32_14483_c1 3300050510 Bacteria 7157
289 nmdc:mga0a205_523737_c1 3300050515 Bacteria 1042
290 Ga0587107_074186 3300059652 Bacteria 627
291 Ga0070677_10096703
292 JGI24034J26672_10037033
293 Ga0065715_10093315
294 Ga0065715_10466657
295 Ga0070658_10029744
296 Ga0070658_10053165
297 Ga0070658_10219474
298 Ga0070670_100005097
299 Ga0070670_100018741
300 Ga0070670_100340116
301 Ga0070670_100734352
302 Ga0070677_10001818
303 Ga0070680_100346993
304 Ga0070682_100299340
305 Ga0070660_100166782
306 Ga0070660_100679327
307 Ga0070660_100836584
308 Ga0070661_100007969
309 Ga0070661_100489622
310 Ga0070692_10008008
311 Ga0070692_10035761
312 Ga0070668_100078307
313 Ga0070668_100087179
314 Ga0070669_100013468
315 Ga0070669_100105957
316 Ga0070669_100106873
317 Ga0070669_100298345
318 Ga0070669_100418599
319 Ga0070669_101084103
320 Ga0070675_100003250
321 Ga0070675_100719188
322 Ga0070671_100014702
323 Ga0070671_100022538
324 Ga0070671_100073420
325 Ga0070671_100165976
326 Ga0070671_100224917
327 Ga0070671_100267769
328 Ga0070673_100017653
329 Ga0070673_100148989
330 Ga0070673_100222815
331 Ga0070688_100344369
332 Ga0070659_100021834
333 Ga0070659_100096740
334 Ga0070659_100185099
335 Ga0070659_100271916
336 Ga0070659_100486983
337 Ga0070667_100078250
338 Ga0070667_100428825
339 Ga0070714_100330660
340 Ga0070662_100004563
341 Ga0070662_100214839
342 Ga0070662_100251845
343 Ga0070681_10072137
344 Ga0070681_10571100
345 Ga0070679_100039740
346 Ga0070686_100323047
347 Ga0070686_100430503
348 Ga0070665_100046659
349 Ga0068855_100041276
350 Ga0068855_100183369
351 Ga0070664_100784779
352 Ga0068857_100391213
353 Ga0068857_100773696
354 Ga0068854_100020112
355 Ga0068854_100189720
356 Ga0068854_100512304
357 Ga0068856_100055774
358 Ga0068856_100137446
359 Ga0068856_100282393
360 Ga0068852_100001895
361 Ga0068852_100289479
362 Ga0068864_100019694
363 Ga0068861_100077867
364 Ga0068863_100021743
365 Ga0068863_100412588
366 Ga0068862_100009040
367 Ga0068862_100854837
368 Ga0068862_100859674
369 Ga0075431_100009548
370 Ga0075434_100795031
371 Ga0105248_10002389
372 Ga0105238_10004341
373 Ga0157327_1014444
374 Ga0157373_10262007
375 Ga0157373_10313193
376 Ga0157373_10439249
377 Ga0157371_10015102
378 Ga0157371_10150942
379 Ga0157370_10042516
380 Ga0157369_10021690
381 Ga0157369_10032368
382 Ga0157369_10055583
383 Ga0157374_11201508
384 Ga0163162_10710750
385 Ga0157372_10522687
386 Ga0157372_11649840
387 Ga0157380_10000710
388 Ga0157380_10008979
389 Ga0157380_10011868
390 Ga0157380_10508018
391 Ga0163161_10026154
392 Ga0163161_10368412
393 Ga0206353_10557373
394 Ga0207697_10002338
395 Ga0207656_10212245
396 Ga0207682_10000494
397 Ga0207688_10685703
398 Ga0207680_10042871
399 Ga0207645_10011669
400 Ga0207705_10004661
401 Ga0207705_10014014
402 Ga0207705_10039058
403 Ga0207705_10151062
404 Ga0207660_10033300
405 Ga0207649_10582262
406 Ga0207652_10070004
407 Ga0207652_10202577
408 Ga0207681_10098296
409 Ga0207681_10164729
410 Ga0207681_10275385
411 Ga0207694_10008803
412 Ga0207650_10021233
413 Ga0207650_10051954
414 Ga0207650_10144729
415 Ga0207659_10540886
416 Ga0207700_10475075
417 Ga0207644_10000138
418 Ga0207644_10020351
419 Ga0207644_10124001
420 Ga0207690_10018965
421 Ga0207690_10169143
422 Ga0207690_11163394
423 Ga0207706_10000276
424 Ga0207706_10245367
425 Ga0207669_10217402
426 Ga0207691_10011470
427 Ga0207711_10006001
428 Ga0207661_11379925
429 Ga0207679_10061189
430 Ga0207667_10066028
431 Ga0207667_10700820
432 Ga0207651_10024664
433 Ga0207651_10085479
434 Ga0207712_10531051
435 Ga0207668_10035047
436 Ga0207668_10037204
437 Ga0207668_10146229
438 Ga0207640_10024110
439 Ga0207640_10505785
440 Ga0207658_10251209
441 Ga0207658_10286432
442 Ga0207658_10476208
443 Ga0207639_10063008
444 Ga0207639_11199207
445 Ga0207678_10028868
446 Ga0207702_10250514
447 Ga0207702_10525621
448 Ga0207641_10312592
449 Ga0207648_10372586
450 Ga0207676_10025317
451 Ga0207676_10158267
452 Ga0207674_11029020
453 Ga0207675_100001317
454 Ga0207683_10004703
455 Ga0207698_10001001
456 Ga0207698_10001487
457 Ga0268265_10187653
458 Ga0268265_10822812
459 Ga0307405_10266493
460 Ga0307405_10645771
461 Ga0307405_10949267
462 Ga0307413_10034419
463 Ga0307413_10090548
464 Ga0307413_10645082
465 Ga0307410_10082218
466 Ga0307410_10179837
467 Ga0307410_10215254
468 Ga0307406_10416117
469 Ga0307406_11020623
470 Ga0307406_11050483
471 Ga0307407_10638232
472 Ga0307407_10942107
473 Ga0307412_10143035
474 Ga0307412_10146891
475 Ga0307412_10373449
476 Ga0307412_10468135
477 Ga0307409_100072598
478 Ga0307409_100117140
479 Ga0307409_100299800
480 Ga0307409_100346939
481 Ga0307409_100381821
482 Ga0307409_100422918
483 Ga0307409_100863224
484 Ga0307409_101208083
485 Ga0307409_101400403
486 Ga0307416_100014890
487 Ga0307416_100105859
488 Ga0307416_100638198
489 Ga0307416_101691469
490 Ga0307414_10143039
491 Ga0307414_10243921
492 Ga0307414_10436598
493 Ga0307414_10441397
494 Ga0307414_10508978
495 Ga0307414_10512289
496 Ga0307411_10160125
497 Ga0307411_10175318
498 Ga0307411_10184206
499 Ga0307411_10236786
500 Ga0307415_100018931
501 Ga0307415_100046514
502 Ga0307415_100139395
503 Ga0307415_101111128
504 Ga0395899_0009052
505 Ga0395899_0041697
506 Ga0395899_0171573
507 Ga0395899_0200688
508 Ga0395900_0015583
509 Ga0395900_0027961
510 Ga0395900_0176826
511 Ga0395900_0514690
512 Ga0395898_0085122
513 Ga0395898_0096747
514 Ga0395898_0403687
515 Ga0395905_0014320
516 Ga0395905_0032583
517 Ga0395905_0035338
518 Ga0395905_0119996
519 Ga0395905_0193367
520 Ga0395905_0206219
521 Ga0395905_0292862
522 Ga0395905_0510386
523 Ga0395905_0950478
524 Ga0395901_0061169
525 Ga0395901_0191372
526 Ga0395901_0196071
527 Ga0395901_0217000
528 Ga0395901_0332123
529 Ga0395901_0579799
530 Ga0451853_3711517
531 Ga0450913_017562
532 Ga0450889_004277
533 Ga0439464_0034832
534 Ga0466963_0097723
535 Ga0466967_0004933
536 Ga0466967_0017903
537 Ga0495585_0040480
538 Ga0495663_0001226
539 Ga0495663_0008098
540 Ga0495663_0264753
541 Ga0495642_0024078
542 Ga0495654_0146888
543 Ga0495598_0026386
544 Ga0495621_0021470
545 Ga0495621_0067625
546 Ga0495633_0058330
547 Ga0495668_0288891
548 Ga0495659_0066334
549 Ga0495669_0001309
550 Ga0495669_0002250
551 Ga0495669_0004107
552 Ga0495669_0024490
553 Ga0495669_0024674
554 Ga0495670_0061560
555 Ga0495670_0083517
556 Ga0495670_0101683
557 Ga0495670_0484784
558 Ga0495670_0501684
559 Ga0495636_0269452
560 Ga0495683_0212803
561 Ga0495677_0002911
562 Ga0495677_0059073
563 Ga0495685_029168
564 Ga0495681_0108384
565 Ga0496107_0325960
566 Ga0496109_0002117
567 Ga0496111_0058980
568 Ga0496112_0115144
569 Ga0496113_0003387
570 Ga0501202_012307
571 Ga0501207_091247
572 Ga0501227_130052
573 Ga0501239_020668
574 Ga0501247_022545
575 Ga0501249_004236
576 Ga0501253_050696
577 Ga0501268_007428
578 nmdc:mga06r32_14483_c1
579 nmdc:mga0a205_523737_c1
580 Ga0587107_074186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14352

DUF4402

Domain of unknown function (DUF4402)

69

195

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sqb-assembly1.cif.gz_B structure of the major type 1 pilus subunit fima bound to the fimc chaperone 0.5161 41 166
1z9s-assembly1.cif.gz_C crystal structure of the native chaperone:subunit:subunit caf1m:caf1:caf1 complex 0.4841 39 165
1p5u-assembly1.cif.gz_C x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex 0.484 39 165
1z9s-assembly1.cif.gz_C crystal structure of the native chaperone:subunit:subunit caf1m:caf1:caf1 complex 0.473 39 165
3me0-assembly1.cif.gz_B structure of the e. coli chaperone papd in complex with the pilin domain of the papgii adhesin 0.4706 40 166
ID Description Score Start End Superfamily
af_P76347_934_1037_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5501 36 165 2.60.40.10
af_A0A0G2K240_800_900_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5135 39 166 2.60.40.10
5d55A00 Mainly Beta;Sandwich;Immunoglobulin-like;Dr adhesin 0.4746 41 165 2.60.40.1570
af_P76347_934_1037_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4708 36 165 2.60.40.10
af_A0A0G2K240_800_900_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4691 39 166 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A1Y5PXS2-F1-model_v4 Resolvase 0.9166 33 166
AF-A0A1L3JE52-F1-model_v4 DUF4402 domain-containing protein 0.9051 77 166
AF-A0A1G8FA99-F1-model_v4 DUF4402 domain-containing protein 0.8952 35 166
AF-A0A7K4DYM8-F1-model_v4 deleted 0.8942 39 166
AF-A0A7Y3W476-F1-model_v4 DUF4402 domain-containing protein 0.8914 39 166

Map