F389549

General Info

Members Datasets Scaffolds Average Seq Length
290 194 580 160

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10001060|JGI25407J50210_100010602
Length 169
Sequence MSTFSGTLEVVTTTRWLTPKEDRAWRGYRRMRALLDLQINRDLAHDAGLSEPDYDVLSNVSESPGRSMRMNELAARMLWTRTRVSHHVRRMERRGLVTRAACEDDARGAMVVLTEQGWRAIEAAAPDHVRSVRENLIDLLTPEQVDVLGDVAELVIDRLSVVDAAPAPT

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
70 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
170 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
192 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
193 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
194 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0
Rhizoplane 0.69
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 7.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10001060 3300003373 Bacteria 6034
2 JGI25407J50210_10010256 3300003373 Bacteria 2382
3 JGI25405J52794_10042553 3300003911 Bacteria 962
4 Ga0070683_100027941 3300005329 Bacteria 5093
5 Ga0070670_100549396 3300005331 Bacteria 1030
6 Ga0068869_100016552 3300005334 Bacteria 4972
7 Ga0070682_100472535 3300005337 Bacteria 965
8 Ga0068868_100023136 3300005338 Bacteria 4699
9 Ga0070689_100855852 3300005340 Bacteria 802
10 Ga0070692_10045433 3300005345 Bacteria 2265
11 Ga0070692_10549321 3300005345 Unclassified 756
12 Ga0070668_100017078 3300005347 Bacteria 5430
13 Ga0070675_100042281 3300005354 Bacteria 3723
14 Ga0070674_100173032 3300005356 Bacteria 1648
15 Ga0070673_100170556 3300005364 Bacteria 1857
16 Ga0070659_100031659 3300005366 Bacteria 4098
17 Ga0070659_100675443 3300005366 Bacteria 892
18 Ga0070667_100352531 3300005367 Bacteria 1333
19 Ga0070667_101296102 3300005367 Bacteria 682
20 Ga0070713_100043606 3300005436 Bacteria 3668
21 Ga0070701_10093350 3300005438 Bacteria 1653
22 Ga0070694_100372880 3300005444 Bacteria 1111
23 Ga0070708_100108573 3300005445 Bacteria 2549
24 Ga0070663_100015667 3300005455 Bacteria 4902
25 Ga0070678_100134206 3300005456 Bacteria 1972
26 Ga0070662_100003119 3300005457 Bacteria 10292
27 Ga0070662_100029486 3300005457 Bacteria 3830
28 Ga0070706_100694865 3300005467 Unclassified 943
29 Ga0070707_100099254 3300005468 Bacteria 2821
30 Ga0070684_100016018 3300005535 Bacteria 6124
31 Ga0068853_100897342 3300005539 Bacteria 851
32 Ga0070693_100443632 3300005547 Bacteria 909
33 Ga0070664_100006305 3300005564 Bacteria 9571
34 Ga0068857_100005744 3300005577 Bacteria 10610
35 Ga0068857_100034324 3300005577 Bacteria 4487
36 Ga0068857_100943393 3300005577 Bacteria 829
37 Ga0068854_100189097 3300005578 Bacteria 1612
38 Ga0068854_101625927 3300005578 Unclassified 589
39 Ga0068856_100755639 3300005614 Bacteria 992
40 Ga0070702_100097193 3300005615 Bacteria 1799
41 Ga0068852_100212280 3300005616 Bacteria 1837
42 Ga0068852_100252780 3300005616 Bacteria 1689
43 Ga0068859_100376453 3300005617 Bacteria 1515
44 Ga0068864_100093929 3300005618 Bacteria 2650
45 Ga0068866_10127630 3300005718 Bacteria 1442
46 Ga0068861_100069313 3300005719 Bacteria 2728
47 Ga0068861_100330300 3300005719 Bacteria 1331
48 Ga0068870_10089244 3300005840 Bacteria 1720
49 Ga0068863_102099950 3300005841 Bacteria 575
50 Ga0068858_100352234 3300005842 Bacteria 1410
51 Ga0068862_100008194 3300005844 Bacteria 8639
52 Ga0081455_10000309 3300005937 Bacteria 64374
53 Ga0081455_10000362 3300005937 Bacteria 59852
54 Ga0081455_10004527 3300005937 Bacteria 15527
55 Ga0081455_10011378 3300005937 Bacteria 8944
56 Ga0081455_10011850 3300005937 Bacteria 8730
57 Ga0081455_10015851 3300005937 Bacteria 7297
58 Ga0081455_10187645 3300005937 Bacteria 1560
59 Ga0081455_10248466 3300005937 Bacteria 1303
60 Ga0081455_10315789 3300005937 Bacteria 1115
61 Ga0081455_10436823 3300005937 Bacteria 898
62 Ga0081538_10000215 3300005981 Bacteria 64732
63 Ga0081538_10004834 3300005981 Bacteria 12281
64 Ga0081538_10143359 3300005981 Bacteria 1096
65 Ga0075365_10030905 3300006038 Bacteria 3434
66 Ga0075365_10089255 3300006038 Bacteria 2098
67 Ga0075365_10575347 3300006038 Bacteria 797
68 Ga0075363_100476018 3300006048 Bacteria 740
69 Ga0075364_10060231 3300006051 Bacteria 2489
70 Ga0075364_10227374 3300006051 Bacteria 1267
71 Ga0075364_10794563 3300006051 Bacteria 645
72 Ga0075432_10000678 3300006058 Bacteria 10471
73 Ga0075367_10742506 3300006178 Bacteria 625
74 Ga0075370_10347544 3300006353 Bacteria 886
75 Ga0075428_100027052 3300006844 Bacteria 6350
76 Ga0075428_100766997 3300006844 Bacteria 1026
77 Ga0075428_100828659 3300006844 Bacteria 983
78 Ga0075431_100028766 3300006847 Bacteria 5714
79 Ga0075431_100525268 3300006847 Bacteria 1173
80 Ga0075431_101058467 3300006847 Unclassified 777
81 Ga0075433_10013254 3300006852 Bacteria 6696
82 Ga0075433_10050379 3300006852 Bacteria 3625
83 Ga0075434_100003995 3300006871 Bacteria 13211
84 Ga0075429_100000609 3300006880 Bacteria 27555
85 Ga0075436_100005810 3300006914 Bacteria 8472
86 Ga0075436_100578139 3300006914 Unclassified 826
87 Ga0097620_100376473 3300006931 Bacteria 1515
88 Ga0075435_100006641 3300007076 Bacteria 8198
89 Ga0075435_100128323 3300007076 Bacteria 2121
90 Ga0105240_11523228 3300009093 Bacteria 701
91 Ga0111539_10001727 3300009094 Bacteria 29086
92 Ga0111539_10008812 3300009094 Bacteria 12791
93 Ga0111539_10027595 3300009094 Bacteria 6934
94 Ga0111539_10077822 3300009094 Bacteria 3903
95 Ga0111539_10399959 3300009094 Bacteria 1600
96 Ga0105245_10014826 3300009098 Bacteria 6788
97 Ga0105245_10087475 3300009098 Bacteria 2860
98 Ga0105245_11419344 3300009098 Unclassified 744
99 Ga0114129_10204382 3300009147 Bacteria 2673
100 Ga0105243_10495165 3300009148 Bacteria 1157
101 Ga0105243_10674764 3300009148 Bacteria 1004
102 Ga0105242_10023574 3300009176 Bacteria 4850
103 Ga0105237_10769106 3300009545 Unclassified 970
104 Ga0105238_10361560 3300009551 Bacteria 1441
105 Ga0105238_10658896 3300009551 Bacteria 1057
106 Ga0105249_10006799 3300009553 Bacteria 9968
107 Ga0105249_11965564 3300009553 Unclassified 657
108 Ga0105239_10218089 3300010375 Bacteria 2139
109 Ga0105239_12217668 3300010375 Bacteria 639
110 Ga0105246_10101554 3300011119 Bacteria 2095
111 Ga0157339_1011340 3300012505 Bacteria 820
112 Ga0157316_1032317 3300012510 Bacteria 641
113 Ga0157371_10241291 3300013102 Unclassified 1300
114 Ga0163162_10046767 3300013306 Bacteria 4338
115 Ga0163162_10175767 3300013306 Bacteria 2267
116 Ga0157372_10068903 3300013307 Bacteria 3978
117 Ga0157372_10317203 3300013307 Bacteria 1815
118 Ga0157372_10476814 3300013307 Bacteria 1454
119 Ga0157375_10282492 3300013308 Bacteria 1823
120 Ga0157380_13013005 3300014326 Bacteria 537
121 Ga0182008_10067638 3300014497 Bacteria 1758
122 Ga0157376_10378043 3300014969 Bacteria 1364
123 Ga0207642_10123503 3300025899 Bacteria 1339
124 Ga0207688_10019599 3300025901 Bacteria 3687
125 Ga0207688_10043588 3300025901 Bacteria 2498
126 Ga0207688_10127916 3300025901 Bacteria 1487
127 Ga0207643_10056699 3300025908 Bacteria 2228
128 Ga0207684_10591417 3300025910 Unclassified 948
129 Ga0207707_10863202 3300025912 Bacteria 750
130 Ga0207649_10022942 3300025920 Bacteria 3608
131 Ga0207646_10098393 3300025922 Bacteria 2622
132 Ga0207694_10816732 3300025924 Bacteria 788
133 Ga0207650_10478560 3300025925 Bacteria 1039
134 Ga0207687_10058532 3300025927 Bacteria 2711
135 Ga0207687_10426153 3300025927 Unclassified 1096
136 Ga0207664_10000445 3300025929 Bacteria 29415
137 Ga0207690_10276668 3300025932 Bacteria 1306
138 Ga0207706_10018271 3300025933 Bacteria 6309
139 Ga0207706_10083759 3300025933 Bacteria 2804
140 Ga0207706_10370747 3300025933 Bacteria 1243
141 Ga0207686_10104929 3300025934 Bacteria 1894
142 Ga0207709_10037843 3300025935 Unclassified 2869
143 Ga0207709_10111416 3300025935 Bacteria 1830
144 Ga0207669_10390416 3300025937 Bacteria 1087
145 Ga0207704_10024022 3300025938 Bacteria 3296
146 Ga0207691_10408578 3300025940 Bacteria 1157
147 Ga0207689_10006222 3300025942 Bacteria 10570
148 Ga0207661_10091221 3300025944 Bacteria 2538
149 Ga0207679_10015555 3300025945 Bacteria 5032
150 Ga0207712_10212674 3300025961 Bacteria 1541
151 Ga0207712_10963725 3300025961 Bacteria 756
152 Ga0207668_10015514 3300025972 Bacteria 4736
153 Ga0207640_10250403 3300025981 Bacteria 1375
154 Ga0207640_11456460 3300025981 Bacteria 614
155 Ga0207658_10263987 3300025986 Bacteria 1469
156 Ga0207677_10034737 3300026023 Bacteria 3268
157 Ga0207677_10929278 3300026023 Bacteria 785
158 Ga0207703_10285875 3300026035 Bacteria 1499
159 Ga0207639_10568349 3300026041 Bacteria 1043
160 Ga0207678_10013624 3300026067 Bacteria 7141
161 Ga0207678_10617827 3300026067 Bacteria 951
162 Ga0207708_10011845 3300026075 Bacteria 6493
163 Ga0207702_10697017 3300026078 Bacteria 1001
164 Ga0207674_10053748 3300026116 Bacteria 4103
165 Ga0207675_100094126 3300026118 Bacteria 2818
166 Ga0207675_100623104 3300026118 Bacteria 1083
167 Ga0207683_10064780 3300026121 Bacteria 3221
168 Ga0207698_10226520 3300026142 Bacteria 1694
169 Ga0209813_10254549 3300027866 Bacteria 668
170 Ga0207428_10001284 3300027907 Bacteria 26882
171 Ga0207428_10028284 3300027907 Bacteria 4658
172 Ga0207428_10200648 3300027907 Bacteria 1501
173 Ga0268265_10018856 3300028380 Bacteria 4787
174 Ga0268264_10836450 3300028381 Bacteria 921
175 Ga0307512_10270984 3300030522 Bacteria 822
176 Ga0307408_100005832 3300031548 Bacteria 8193
177 Ga0307408_100137398 3300031548 Bacteria 1914
178 Ga0307408_100338488 3300031548 Bacteria 1273
179 Ga0307405_10259028 3300031731 Bacteria 1298
180 Ga0307405_10405357 3300031731 Bacteria 1068
181 Ga0307413_10018015 3300031824 Bacteria 3694
182 Ga0307413_10046689 3300031824 Bacteria 2577
183 Ga0307410_10001201 3300031852 Bacteria 11490
184 Ga0307410_10299405 3300031852 Bacteria 1268
185 Ga0307406_10000083 3300031901 Bacteria 52941
186 Ga0307406_10033043 3300031901 Bacteria 3163
187 Ga0307406_10084120 3300031901 Bacteria 2124
188 Ga0307407_10004180 3300031903 Bacteria 6085
189 Ga0307407_10007892 3300031903 Bacteria 4850
190 Ga0307412_10071379 3300031911 Bacteria 2370
191 Ga0307412_10762733 3300031911 Unclassified 836
192 Ga0307409_100000288 3300031995 Bacteria 20426
193 Ga0307409_100012965 3300031995 Bacteria 5339
194 Ga0307409_100060244 3300031995 Bacteria 2959
195 Ga0307409_100253107 3300031995 Bacteria 1611
196 Ga0307409_100926602 3300031995 Bacteria 886
197 Ga0307409_101043901 3300031995 Unclassified 837
198 Ga0307416_100000105 3300032002 Bacteria 51970
199 Ga0307416_100089436 3300032002 Bacteria 2636
200 Ga0307416_100217058 3300032002 Bacteria 1830
201 Ga0307414_10044521 3300032004 Bacteria 3032
202 Ga0307414_10140222 3300032004 Bacteria 1891
203 Ga0307414_11089453 3300032004 Unclassified 737
204 Ga0307411_10028306 3300032005 Bacteria 3405
205 Ga0307415_100003474 3300032126 Bacteria 8030
206 Ga0307415_100005395 3300032126 Bacteria 6783
207 Ga0307415_100491157 3300032126 Bacteria 1071
208 Ga0307415_102014097 3300032126 Unclassified 562
209 Ga0439448_0303104 3300042005 Bacteria 567
210 Ga0439450_064762 3300042008 Bacteria 889
211 Ga0439454_038326 3300042011 Unclassified 776
212 Ga0439455_0003589 3300042012 Bacteria 2984
213 Ga0439455_0054983 3300042012 Unclassified 1046
214 Ga0439463_008895 3300042016 Bacteria 2471
215 Ga0439444_0038256 3300042437 Bacteria 931
216 Ga0439459_0018761 3300042438 Unclassified 1304
217 Ga0439464_0002289 3300042439 Bacteria 4687
218 Ga0439464_0052905 3300042439 Bacteria 1177
219 Ga0439460_0006917 3300042461 Bacteria 2826
220 Ga0439440_0142624 3300042993 Bacteria 681
221 Ga0466967_1792645 3300045976 Bacteria 611
222 Ga0495617_023363 3300046452 Bacteria 2089
223 Ga0495603_0120409 3300046455 Bacteria 1529
224 Ga0495638_0263234 3300046460 Bacteria 945
225 Ga0495605_0233584 3300046474 Bacteria 791
226 Ga0495584_0494994 3300046491 Bacteria 623
227 Ga0495584_0529175 3300046491 Unclassified 601
228 Ga0495585_0019905 3300046492 Bacteria 3864
229 Ga0495585_0340433 3300046492 Bacteria 730
230 Ga0495594_0009542 3300046499 Bacteria 5016
231 Ga0495607_0042140 3300046501 Bacteria 2708
232 Ga0495583_0229404 3300046506 Bacteria 749
233 Ga0495628_0129988 3300046516 Bacteria 1927
234 Ga0495663_0202558 3300046525 Bacteria 693
235 Ga0495666_0054064 3300046526 Bacteria 1926
236 Ga0495598_0345719 3300046537 Unclassified 572
237 Ga0495622_0000764 3300046557 Bacteria 17980
238 Ga0495633_0162114 3300046558 Bacteria 1032
239 Ga0495656_0043125 3300046615 Bacteria 1893
240 Ga0495611_0020643 3300046648 Bacteria 2837
241 Ga0495611_0025997 3300046648 Bacteria 2553
242 Ga0495625_0084609 3300046660 Bacteria 2203
243 Ga0495625_0483241 3300046660 Bacteria 760
244 Ga0495670_0156613 3300046691 Unclassified 1196
245 Ga0495589_0027216 3300046794 Bacteria 2892
246 Ga0495687_019976 3300047443 Bacteria 3274
247 Ga0495685_015060 3300047447 Bacteria 2634
248 Ga0496102_0689359 3300048905 Bacteria 945
249 Ga0496112_0086223 3300048915 Bacteria 3107
250 Ga0501040_1383213 3300049576 Bacteria 511
251 Ga0501046_0029580 3300049580 Bacteria 4452
252 Ga0501047_0059925 3300049581 Bacteria 3675
253 Ga0501047_0945767 3300049581 Bacteria 675
254 Ga0501067_0591849 3300049583 Bacteria 622
255 Ga0501216_051494 3300049660 Bacteria 810
256 Ga0501259_067702 3300049688 Unclassified 760
257 Ga0501044_0216914 3300049823 Bacteria 1865
258 nmdc:mga03683_394022_c1 3300050489 Bacteria 660
259 nmdc:mga03n38_20748_c1 3300050490 Bacteria 2634
260 nmdc:mga00v17_67208_c1 3300050491 Bacteria 2214
261 nmdc:mga00v17_7414_c2 3300050491 Bacteria 4244
262 nmdc:mga0yw44_139325_c1 3300050492 Bacteria 1576
263 nmdc:mga0yw44_293372_c1 3300050492 Bacteria 1089
264 nmdc:mga0yw44_41392_c1 3300050492 Bacteria 2743
265 nmdc:mga0yw44_966287_c1 3300050492 Bacteria 577
266 nmdc:mga06z11_87513_c1 3300050494 Bacteria 1685
267 nmdc:mga04h51_187082_c1 3300050495 Bacteria 808
268 nmdc:mga07m45_142246_c1 3300050496 Bacteria 1389
269 nmdc:mga05p37_1674_c1 3300050507 Bacteria 25768
270 nmdc:mga09592_1084_c1 3300050508 Bacteria 21623
271 nmdc:mga09592_253773_c1 3300050508 Bacteria 1524
272 nmdc:mga0qj67_980846_c1 3300050509 Bacteria 663
273 nmdc:mga06r32_9965_c1 3300050510 Bacteria 8574
274 nmdc:mga08y16_14506_c1 3300050511 Bacteria 8291
275 nmdc:mga08y16_1531312_c1 3300050511 Bacteria 626
276 nmdc:mga08y16_167485_c1 3300050511 Bacteria 2283
277 nmdc:mga08y16_50938_c1 3300050511 Bacteria 4333
278 nmdc:mga08y16_5117_c1 3300050511 Bacteria 13700
279 nmdc:mga0n895_2886_c1 3300050512 Bacteria 13634
280 nmdc:mga0rr50_1775_c1 3300050513 Bacteria 11913
281 nmdc:mga08x19_5884_c1 3300050514 Bacteria 7254
282 nmdc:mga0a205_133200_c1 3300050515 Bacteria 2386
283 nmdc:mga0a205_5837_c1 3300050515 Bacteria 11092
284 Ga0500644_0149502 3300053088 Bacteria 935
285 Ga0500620_017274 3300053155 Bacteria 2079
286 Ga0530510_1168678 3300061734 Bacteria 590
287 2753263743 2751185782 Bacteria 11227053
288 2809589993 2808606522 Bacteria 9488490
289 2884699689 2884693830 Bacteria 11273186
290 2895443108 2895442618 Bacteria 11027144
291 JGI25407J50210_10001060
292 JGI25407J50210_10010256
293 JGI25405J52794_10042553
294 Ga0070683_100027941
295 Ga0070670_100549396
296 Ga0068869_100016552
297 Ga0070682_100472535
298 Ga0068868_100023136
299 Ga0070689_100855852
300 Ga0070692_10045433
301 Ga0070692_10549321
302 Ga0070668_100017078
303 Ga0070675_100042281
304 Ga0070674_100173032
305 Ga0070673_100170556
306 Ga0070659_100031659
307 Ga0070659_100675443
308 Ga0070667_100352531
309 Ga0070667_101296102
310 Ga0070713_100043606
311 Ga0070701_10093350
312 Ga0070694_100372880
313 Ga0070708_100108573
314 Ga0070663_100015667
315 Ga0070678_100134206
316 Ga0070662_100003119
317 Ga0070662_100029486
318 Ga0070706_100694865
319 Ga0070707_100099254
320 Ga0070684_100016018
321 Ga0068853_100897342
322 Ga0070693_100443632
323 Ga0070664_100006305
324 Ga0068857_100005744
325 Ga0068857_100034324
326 Ga0068857_100943393
327 Ga0068854_100189097
328 Ga0068854_101625927
329 Ga0068856_100755639
330 Ga0070702_100097193
331 Ga0068852_100212280
332 Ga0068852_100252780
333 Ga0068859_100376453
334 Ga0068864_100093929
335 Ga0068866_10127630
336 Ga0068861_100069313
337 Ga0068861_100330300
338 Ga0068870_10089244
339 Ga0068863_102099950
340 Ga0068858_100352234
341 Ga0068862_100008194
342 Ga0081455_10000309
343 Ga0081455_10000362
344 Ga0081455_10004527
345 Ga0081455_10011378
346 Ga0081455_10011850
347 Ga0081455_10015851
348 Ga0081455_10187645
349 Ga0081455_10248466
350 Ga0081455_10315789
351 Ga0081455_10436823
352 Ga0081538_10000215
353 Ga0081538_10004834
354 Ga0081538_10143359
355 Ga0075365_10030905
356 Ga0075365_10089255
357 Ga0075365_10575347
358 Ga0075363_100476018
359 Ga0075364_10060231
360 Ga0075364_10227374
361 Ga0075364_10794563
362 Ga0075432_10000678
363 Ga0075367_10742506
364 Ga0075370_10347544
365 Ga0075428_100027052
366 Ga0075428_100766997
367 Ga0075428_100828659
368 Ga0075431_100028766
369 Ga0075431_100525268
370 Ga0075431_101058467
371 Ga0075433_10013254
372 Ga0075433_10050379
373 Ga0075434_100003995
374 Ga0075429_100000609
375 Ga0075436_100005810
376 Ga0075436_100578139
377 Ga0097620_100376473
378 Ga0075435_100006641
379 Ga0075435_100128323
380 Ga0105240_11523228
381 Ga0111539_10001727
382 Ga0111539_10008812
383 Ga0111539_10027595
384 Ga0111539_10077822
385 Ga0111539_10399959
386 Ga0105245_10014826
387 Ga0105245_10087475
388 Ga0105245_11419344
389 Ga0114129_10204382
390 Ga0105243_10495165
391 Ga0105243_10674764
392 Ga0105242_10023574
393 Ga0105237_10769106
394 Ga0105238_10361560
395 Ga0105238_10658896
396 Ga0105249_10006799
397 Ga0105249_11965564
398 Ga0105239_10218089
399 Ga0105239_12217668
400 Ga0105246_10101554
401 Ga0157339_1011340
402 Ga0157316_1032317
403 Ga0157371_10241291
404 Ga0163162_10046767
405 Ga0163162_10175767
406 Ga0157372_10068903
407 Ga0157372_10317203
408 Ga0157372_10476814
409 Ga0157375_10282492
410 Ga0157380_13013005
411 Ga0182008_10067638
412 Ga0157376_10378043
413 Ga0207642_10123503
414 Ga0207688_10019599
415 Ga0207688_10043588
416 Ga0207688_10127916
417 Ga0207643_10056699
418 Ga0207684_10591417
419 Ga0207707_10863202
420 Ga0207649_10022942
421 Ga0207646_10098393
422 Ga0207694_10816732
423 Ga0207650_10478560
424 Ga0207687_10058532
425 Ga0207687_10426153
426 Ga0207664_10000445
427 Ga0207690_10276668
428 Ga0207706_10018271
429 Ga0207706_10083759
430 Ga0207706_10370747
431 Ga0207686_10104929
432 Ga0207709_10037843
433 Ga0207709_10111416
434 Ga0207669_10390416
435 Ga0207704_10024022
436 Ga0207691_10408578
437 Ga0207689_10006222
438 Ga0207661_10091221
439 Ga0207679_10015555
440 Ga0207712_10212674
441 Ga0207712_10963725
442 Ga0207668_10015514
443 Ga0207640_10250403
444 Ga0207640_11456460
445 Ga0207658_10263987
446 Ga0207677_10034737
447 Ga0207677_10929278
448 Ga0207703_10285875
449 Ga0207639_10568349
450 Ga0207678_10013624
451 Ga0207678_10617827
452 Ga0207708_10011845
453 Ga0207702_10697017
454 Ga0207674_10053748
455 Ga0207675_100094126
456 Ga0207675_100623104
457 Ga0207683_10064780
458 Ga0207698_10226520
459 Ga0209813_10254549
460 Ga0207428_10001284
461 Ga0207428_10028284
462 Ga0207428_10200648
463 Ga0268265_10018856
464 Ga0268264_10836450
465 Ga0307512_10270984
466 Ga0307408_100005832
467 Ga0307408_100137398
468 Ga0307408_100338488
469 Ga0307405_10259028
470 Ga0307405_10405357
471 Ga0307413_10018015
472 Ga0307413_10046689
473 Ga0307410_10001201
474 Ga0307410_10299405
475 Ga0307406_10000083
476 Ga0307406_10033043
477 Ga0307406_10084120
478 Ga0307407_10004180
479 Ga0307407_10007892
480 Ga0307412_10071379
481 Ga0307412_10762733
482 Ga0307409_100000288
483 Ga0307409_100012965
484 Ga0307409_100060244
485 Ga0307409_100253107
486 Ga0307409_100926602
487 Ga0307409_101043901
488 Ga0307416_100000105
489 Ga0307416_100089436
490 Ga0307416_100217058
491 Ga0307414_10044521
492 Ga0307414_10140222
493 Ga0307414_11089453
494 Ga0307411_10028306
495 Ga0307415_100003474
496 Ga0307415_100005395
497 Ga0307415_100491157
498 Ga0307415_102014097
499 Ga0439448_0303104
500 Ga0439450_064762
501 Ga0439454_038326
502 Ga0439455_0003589
503 Ga0439455_0054983
504 Ga0439463_008895
505 Ga0439444_0038256
506 Ga0439459_0018761
507 Ga0439464_0002289
508 Ga0439464_0052905
509 Ga0439460_0006917
510 Ga0439440_0142624
511 Ga0466967_1792645
512 Ga0495617_023363
513 Ga0495603_0120409
514 Ga0495638_0263234
515 Ga0495605_0233584
516 Ga0495584_0494994
517 Ga0495584_0529175
518 Ga0495585_0019905
519 Ga0495585_0340433
520 Ga0495594_0009542
521 Ga0495607_0042140
522 Ga0495583_0229404
523 Ga0495628_0129988
524 Ga0495663_0202558
525 Ga0495666_0054064
526 Ga0495598_0345719
527 Ga0495622_0000764
528 Ga0495633_0162114
529 Ga0495656_0043125
530 Ga0495611_0020643
531 Ga0495611_0025997
532 Ga0495625_0084609
533 Ga0495625_0483241
534 Ga0495670_0156613
535 Ga0495589_0027216
536 Ga0495687_019976
537 Ga0495685_015060
538 Ga0496102_0689359
539 Ga0496112_0086223
540 Ga0501040_1383213
541 Ga0501046_0029580
542 Ga0501047_0059925
543 Ga0501047_0945767
544 Ga0501067_0591849
545 Ga0501216_051494
546 Ga0501259_067702
547 Ga0501044_0216914
548 nmdc:mga03683_394022_c1
549 nmdc:mga03n38_20748_c1
550 nmdc:mga00v17_67208_c1
551 nmdc:mga00v17_7414_c2
552 nmdc:mga0yw44_139325_c1
553 nmdc:mga0yw44_293372_c1
554 nmdc:mga0yw44_41392_c1
555 nmdc:mga0yw44_966287_c1
556 nmdc:mga06z11_87513_c1
557 nmdc:mga04h51_187082_c1
558 nmdc:mga07m45_142246_c1
559 nmdc:mga05p37_1674_c1
560 nmdc:mga09592_1084_c1
561 nmdc:mga09592_253773_c1
562 nmdc:mga0qj67_980846_c1
563 nmdc:mga06r32_9965_c1
564 nmdc:mga08y16_14506_c1
565 nmdc:mga08y16_1531312_c1
566 nmdc:mga08y16_167485_c1
567 nmdc:mga08y16_50938_c1
568 nmdc:mga08y16_5117_c1
569 nmdc:mga0n895_2886_c1
570 nmdc:mga0rr50_1775_c1
571 nmdc:mga08x19_5884_c1
572 nmdc:mga0a205_133200_c1
573 nmdc:mga0a205_5837_c1
574 Ga0500644_0149502
575 Ga0500620_017274
576 Ga0530510_1168678
577 2753263743
578 2809589993
579 2884699689
580 2895443108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

47

108

0.98

PF01047

MarR

MarR family

49

108

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zmd-assembly2.cif.gz_D crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor 0.9746 14 160
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9682 16 159
3zpl-assembly2.cif.gz_E crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9645 14 159
3zmd-assembly2.cif.gz_D crystal structure of absc, a marr family transcriptional regulator from streptomyces coelicolor 0.9553 14 160
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9427 14 169
ID Description Score Start End Superfamily
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.958 14 159 1.10.10.10
3zplA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9362 14 169 1.10.10.10
3zmdA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.933 14 159 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9207 54 122 1.10.10.10
1s3jB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9199 49 114 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6I5ZWU9-F1-model_v4 MarR family transcriptional regulator 0.9921 13 161 GO:0003700
GO:0006950
AF-A0A7J9WZM0-F1-model_v4 MarR family transcriptional regulator 0.9869 13 165 GO:0003700
GO:0006950
AF-A0A538H3T5-F1-model_v4 MarR family transcriptional regulator 0.9868 14 163 GO:0003700
GO:0006950
AF-A0A6J7TF39-F1-model_v4 Unannotated protein 0.9849 14 161 GO:0003700
GO:0006950
AF-A0A7Y4NXA0-F1-model_v4 MarR family transcriptional regulator 0.9849 14 156 GO:0003677
GO:0003700
GO:0006950

Map