F389443

General Info

Members Datasets Scaffolds Average Seq Length
289 180 578 235

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0170063|Ga0501080_0170063_904_1596
Length 230
Sequence MSRLMVIGAHSADFVWRAGGVIAVTTAAGGTARVLALSYGERGESGELWREPGQTVERVKEIRHGEAERAAAALGAEFECLDLGDYPLEIDRDGLVAIADRIREHAPEIVITHTDRDPFNPDHAAAFFAVERARALAAGAETVEPPELLLFEPHQPELCNFTPTTFVDITPVIERKNAAMAEMKAQAYLHTYYSQRAEQRGNHARRSSGNAGIRYAEAFQRVTPQVVTEL

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.96
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0170063 3300049742 Bacteria 2010
2 Ga0070683_100154340 3300005329 Bacteria 2177
3 Ga0070690_100023851 3300005330 Bacteria 3757
4 Ga0068868_100356105 3300005338 Bacteria 1254
5 Ga0070671_100157821 3300005355 Bacteria 1917
6 Ga0070674_100071646 3300005356 Bacteria 2452
7 Ga0070673_100894535 3300005364 Bacteria 823
8 Ga0070713_100236554 3300005436 Bacteria 1662
9 Ga0070700_100112616 3300005441 Bacteria 1812
10 Ga0070700_100439579 3300005441 Bacteria 990
11 Ga0070694_100449172 3300005444 Bacteria 1018
12 Ga0070708_100108407 3300005445 Bacteria 2551
13 Ga0068867_100265264 3300005459 Bacteria 1402
14 Ga0070685_10099975 3300005466 Bacteria 1770
15 Ga0070685_10140733 3300005466 Bacteria 1519
16 Ga0070706_100613137 3300005467 Unclassified 1011
17 Ga0070684_100166897 3300005535 Bacteria 1999
18 Ga0068853_100029727 3300005539 Bacteria 4609
19 Ga0070672_100204512 3300005543 Bacteria 1652
20 Ga0070686_100090715 3300005544 Bacteria 2043
21 Ga0070665_100205688 3300005548 Bacteria 1969
22 Ga0068857_100041784 3300005577 Bacteria 4065
23 Ga0068856_100913566 3300005614 Bacteria 897
24 Ga0070702_100228037 3300005615 Bacteria 1250
25 Ga0068864_100138070 3300005618 Bacteria 2196
26 Ga0068861_100165395 3300005719 Bacteria 1829
27 Ga0068870_10020023 3300005840 Bacteria 3252
28 Ga0068858_100285327 3300005842 Bacteria 1572
29 Ga0081455_10057534 3300005937 Bacteria 3295
30 Ga0081538_10002397 3300005981 Bacteria 18394
31 Ga0070717_10146936 3300006028 Bacteria 2037
32 Ga0075428_100274301 3300006844 Bacteria 1815
33 Ga0075430_100676807 3300006846 Bacteria 851
34 Ga0075433_10188094 3300006852 Bacteria 1837
35 Ga0075434_100049265 3300006871 Bacteria 4182
36 Ga0105240_10628185 3300009093 Bacteria 1180
37 Ga0111539_10053130 3300009094 Bacteria 4823
38 Ga0105245_10097161 3300009098 Bacteria 2719
39 Ga0105245_10795893 3300009098 Bacteria 983
40 Ga0105245_10970769 3300009098 Bacteria 893
41 Ga0105247_10043515 3300009101 Bacteria 2751
42 Ga0114129_10041170 3300009147 Bacteria 6512
43 Ga0114129_10472775 3300009147 Bacteria 1641
44 Ga0114129_10888264 3300009147 Bacteria 1130
45 Ga0105243_10150078 3300009148 Bacteria 1998
46 Ga0105241_10869614 3300009174 Bacteria 835
47 Ga0105242_10689853 3300009176 Bacteria 998
48 Ga0105248_10254019 3300009177 Bacteria 1978
49 Ga0105249_10021223 3300009553 Bacteria 5815
50 Ga0105239_10096705 3300010375 Bacteria 3262
51 Ga0105239_10406222 3300010375 Bacteria 1542
52 Ga0105239_10668505 3300010375 Bacteria 1187
53 Ga0105246_10093311 3300011119 Bacteria 2174
54 Ga0157372_11012083 3300013307 Bacteria 962
55 Ga0163163_10016760 3300014325 Bacteria 6817
56 Ga0163163_10369689 3300014325 Bacteria 1491
57 Ga0157377_10033688 3300014745 Bacteria 2798
58 Ga0157379_10421364 3300014968 Bacteria 1229
59 Ga0157376_10401444 3300014969 Bacteria 1326
60 Ga0207656_10105842 3300025321 Bacteria 1294
61 Ga0207645_10119189 3300025907 Bacteria 1712
62 Ga0207643_10006966 3300025908 Bacteria 6064
63 Ga0207643_10026009 3300025908 Bacteria 3238
64 Ga0207660_10261120 3300025917 Bacteria 1370
65 Ga0207652_10624937 3300025921 Bacteria 964
66 Ga0207646_10117631 3300025922 Bacteria 2387
67 Ga0207650_10001237 3300025925 Bacteria 18593
68 Ga0207650_10146321 3300025925 Bacteria 1861
69 Ga0207659_10155655 3300025926 Bacteria 1789
70 Ga0207687_10167941 3300025927 Bacteria 1690
71 Ga0207687_10202968 3300025927 Bacteria 1551
72 Ga0207700_10061762 3300025928 Bacteria 2843
73 Ga0207644_10325204 3300025931 Bacteria 1244
74 Ga0207686_10138787 3300025934 Bacteria 1677
75 Ga0207709_10546131 3300025935 Bacteria 911
76 Ga0207704_10307919 3300025938 Bacteria 1216
77 Ga0207711_10781545 3300025941 Bacteria 889
78 Ga0207689_10123258 3300025942 Bacteria 2131
79 Ga0207689_10611971 3300025942 Bacteria 917
80 Ga0207661_10573915 3300025944 Bacteria 1034
81 Ga0207667_11030558 3300025949 Bacteria 809
82 Ga0207651_10128295 3300025960 Bacteria 1937
83 Ga0207712_10022400 3300025961 Bacteria 4159
84 Ga0207712_10220650 3300025961 Bacteria 1515
85 Ga0207640_10398942 3300025981 Bacteria 1120
86 Ga0207703_10363264 3300026035 Bacteria 1336
87 Ga0207639_10068525 3300026041 Bacteria 2765
88 Ga0207708_10016793 3300026075 Bacteria 5510
89 Ga0207702_10395643 3300026078 Bacteria 1331
90 Ga0207648_10151610 3300026089 Bacteria 2045
91 Ga0207674_10066317 3300026116 Bacteria 3636
92 Ga0207675_100043612 3300026118 Bacteria 4189
93 Ga0207675_100259635 3300026118 Bacteria 1683
94 Ga0207675_100399184 3300026118 Bacteria 1355
95 Ga0207683_10073560 3300026121 Bacteria 3023
96 Ga0207683_10389908 3300026121 Bacteria 1281
97 Ga0268266_10013150 3300028379 Bacteria 7137
98 Ga0268265_10166907 3300028380 Bacteria 1877
99 Ga0265318_10056759 3300028577 Bacteria 1464
100 Ga0265338_10002813 3300028800 Bacteria 25403
101 Ga0265340_10019964 3300031247 Bacteria 3447
102 Ga0265339_10061899 3300031249 Bacteria 2012
103 Ga0265339_10079578 3300031249 Bacteria 1734
104 Ga0265316_10029903 3300031344 Bacteria 4472
105 Ga0307408_100304648 3300031548 Bacteria 1336
106 Ga0265313_10048483 3300031595 Bacteria 2049
107 Ga0265314_10004605 3300031711 Bacteria 12721
108 Ga0307413_10208883 3300031824 Bacteria 1416
109 Ga0307410_10362693 3300031852 Bacteria 1161
110 Ga0307406_10008987 3300031901 Bacteria 5589
111 Ga0307407_10042837 3300031903 Bacteria 2541
112 Ga0307409_100012065 3300031995 Bacteria 5487
113 Ga0307409_100880077 3300031995 Bacteria 908
114 Ga0307416_100101690 3300032002 Bacteria 2504
115 Ga0307416_100329643 3300032002 Bacteria 1533
116 Ga0307415_100185471 3300032126 Bacteria 1636
117 Ga0395899_0036197 3300037312 Bacteria 3703
118 Ga0395900_0216116 3300037418 Bacteria 1934
119 Ga0395900_0242886 3300037418 Bacteria 1805
120 Ga0395898_0001780 3300037466 Bacteria 28036
121 Ga0395898_0002438 3300037466 Bacteria 21980
122 Ga0395898_0843732 3300037466 Bacteria 856
123 Ga0436364_1264011 3300037853 Bacteria 7715
124 Ga0395901_0001312 3300038443 Bacteria 26230
125 Ga0436365_0135810 3300039437 Bacteria 6430
126 Ga0436365_0530409 3300039437 Bacteria 4710
127 Ga0436363_0588310 3300039450 Bacteria 1275
128 Ga0436362_0998221 3300039453 Bacteria 7312
129 Ga0466963_0067916 3300044694 Bacteria 2393
130 Ga0466971_0041199 3300044719 Bacteria 2074
131 Ga0466970_0107394 3300044765 Bacteria 1523
132 Ga0466957_0373548 3300044842 Bacteria 971
133 Ga0466959_0026515 3300045049 Bacteria 4295
134 Ga0466959_0096934 3300045049 Bacteria 2114
135 Ga0466958_0073028 3300045836 Bacteria 2101
136 Ga0466967_0005466 3300045976 Bacteria 8809
137 Ga0466967_0008269 3300045976 Bacteria 7602
138 Ga0466967_0071977 3300045976 Bacteria 3097
139 Ga0466967_0634221 3300045976 Unclassified 1056
140 Ga0495629_0484969 3300046459 Bacteria 835
141 Ga0495651_0084640 3300046462 Bacteria 2389
142 Ga0495628_0061929 3300046516 Bacteria 2934
143 Ga0495637_0142776 3300046520 Bacteria 908
144 Ga0495642_0295326 3300046528 Bacteria 710
145 Ga0495652_0096710 3300046529 Bacteria 2404
146 Ga0495609_0145747 3300046538 Bacteria 1009
147 Ga0495667_0063319 3300046559 Bacteria 2421
148 Ga0495656_0069087 3300046615 Bacteria 1564
149 Ga0495657_0027294 3300046675 Bacteria 4032
150 Ga0495600_0222620 3300046809 Bacteria 1207
151 Ga0495604_0097940 3300047317 Bacteria 2162
152 Ga0495684_0235659 3300047471 Bacteria 1337
153 Ga0495602_0019516 3300048088 Bacteria 6725
154 Ga0495602_0264553 3300048088 Bacteria 1274
155 Ga0496101_0102185 3300048904 Bacteria 2147
156 Ga0496102_0540156 3300048905 Bacteria 1088
157 Ga0496103_0283788 3300048906 Bacteria 1065
158 Ga0496104_0012809 3300048907 Bacteria 7553
159 Ga0496104_0022160 3300048907 Bacteria 5837
160 Ga0496106_0044438 3300048909 Bacteria 3334
161 Ga0496107_0325032 3300048910 Bacteria 1145
162 Ga0496108_0000326 3300048911 Bacteria 40459
163 Ga0496109_0000675 3300048912 Bacteria 28319
164 Ga0496109_0007356 3300048912 Bacteria 9316
165 Ga0496109_0067865 3300048912 Bacteria 3268
166 Ga0496109_0134457 3300048912 Bacteria 2310
167 Ga0496110_0016061 3300048913 Bacteria 6242
168 Ga0496110_0019173 3300048913 Bacteria 5752
169 Ga0496111_0008527 3300048914 Bacteria 6790
170 Ga0496111_0217721 3300048914 Bacteria 1418
171 Ga0496112_0045987 3300048915 Bacteria 4280
172 Ga0496112_0085279 3300048915 Bacteria 3125
173 Ga0496112_0138888 3300048915 Bacteria 2400
174 Ga0496112_0400919 3300048915 Bacteria 1311
175 Ga0496113_0031338 3300048916 Bacteria 3858
176 Ga0496113_0079820 3300048916 Bacteria 2505
177 Ga0496115_0223252 3300048918 Bacteria 1555
178 Ga0496126_0038163 3300048929 Bacteria 4472
179 Ga0501031_0023859 3300049568 Bacteria 3988
180 Ga0501031_0062115 3300049568 Bacteria 2434
181 Ga0501031_0374166 3300049568 Bacteria 922
182 Ga0501032_0011717 3300049569 Bacteria 6286
183 Ga0501032_0068554 3300049569 Bacteria 2368
184 Ga0501033_0005758 3300049570 Bacteria 9757
185 Ga0501033_0231638 3300049570 Bacteria 1312
186 Ga0501034_0364273 3300049571 Bacteria 1372
187 Ga0501036_0021461 3300049572 Bacteria 5429
188 Ga0501036_0464640 3300049572 Bacteria 1054
189 Ga0501037_0009929 3300049573 Bacteria 6981
190 Ga0501037_0203799 3300049573 Bacteria 1397
191 Ga0501038_0081646 3300049574 Bacteria 2724
192 Ga0501039_0004124 3300049575 Bacteria 10926
193 Ga0501039_0009432 3300049575 Bacteria 7441
194 Ga0501039_0039038 3300049575 Bacteria 3667
195 Ga0501039_0061181 3300049575 Bacteria 2916
196 Ga0501040_0001647 3300049576 Bacteria 14254
197 Ga0501040_0003871 3300049576 Bacteria 9709
198 Ga0501041_0000451 3300049577 Bacteria 20829
199 Ga0501041_0018461 3300049577 Bacteria 4155
200 Ga0501041_0076857 3300049577 Bacteria 2054
201 Ga0501041_0135547 3300049577 Bacteria 1534
202 Ga0501041_0550146 3300049577 Bacteria 735
203 Ga0501042_0056078 3300049578 Bacteria 2811
204 Ga0501042_0057579 3300049578 Bacteria 2773
205 Ga0501042_0157423 3300049578 Bacteria 1639
206 Ga0501043_0302690 3300049579 Bacteria 1221
207 Ga0501046_0001168 3300049580 Bacteria 25539
208 Ga0501046_0252719 3300049580 Bacteria 1297
209 Ga0501048_0012434 3300049582 Bacteria 6331
210 Ga0501048_0013101 3300049582 Bacteria 6156
211 Ga0501067_0011131 3300049583 Bacteria 4976
212 Ga0501067_0034128 3300049583 Bacteria 2823
213 Ga0501068_0001041 3300049584 Bacteria 14673
214 Ga0501068_0010222 3300049584 Bacteria 5268
215 Ga0501069_0003324 3300049585 Bacteria 8250
216 Ga0501069_0014495 3300049585 Bacteria 4215
217 Ga0501069_0016853 3300049585 Bacteria 3926
218 Ga0501070_0005458 3300049586 Bacteria 10852
219 Ga0501070_0033876 3300049586 Bacteria 4273
220 Ga0501070_0121251 3300049586 Bacteria 2161
221 Ga0501071_0006442 3300049587 Bacteria 7618
222 Ga0501071_0014698 3300049587 Bacteria 5357
223 Ga0501071_0026246 3300049587 Bacteria 4087
224 Ga0501072_0001708 3300049588 Bacteria 16339
225 Ga0501072_0003539 3300049588 Bacteria 11748
226 Ga0501072_0010340 3300049588 Bacteria 7110
227 Ga0501072_0086138 3300049588 Bacteria 2493
228 Ga0501072_0172301 3300049588 Bacteria 1727
229 Ga0501073_0127803 3300049589 Bacteria 1762
230 Ga0501074_0005785 3300049590 Bacteria 8917
231 Ga0501074_0451584 3300049590 Bacteria 911
232 Ga0501075_0002815 3300049591 Bacteria 11665
233 Ga0501075_0099648 3300049591 Bacteria 2206
234 Ga0501075_0104677 3300049591 Bacteria 2151
235 Ga0501075_0318039 3300049591 Bacteria 1186
236 Ga0501076_0000881 3300049592 Bacteria 19517
237 Ga0501076_0006103 3300049592 Bacteria 8718
238 Ga0501076_0020136 3300049592 Bacteria 5105
239 Ga0501076_0064757 3300049592 Bacteria 2914
240 Ga0501076_0561283 3300049592 Bacteria 941
241 Ga0501077_0005623 3300049593 Bacteria 7639
242 Ga0501077_0010915 3300049593 Bacteria 5661
243 Ga0501077_0011644 3300049593 Bacteria 5497
244 Ga0501079_0006745 3300049741 Bacteria 8637
245 Ga0501079_0030982 3300049741 Bacteria 4110
246 Ga0501079_0071345 3300049741 Bacteria 2683
247 Ga0501079_0258459 3300049741 Bacteria 1361
248 Ga0501079_0303373 3300049741 Bacteria 1250
249 Ga0501080_0014090 3300049742 Bacteria 7359
250 Ga0501080_0199266 3300049742 Bacteria 1838
251 Ga0501080_0341809 3300049742 Bacteria 1352
252 Ga0501081_0005024 3300049743 Bacteria 8514
253 Ga0501081_0013947 3300049743 Bacteria 5291
254 Ga0501081_0270446 3300049743 Bacteria 1243
255 Ga0501081_0505789 3300049743 Bacteria 901
256 Ga0501083_0065583 3300049744 Bacteria 2418
257 Ga0501035_0231011 3300049822 Bacteria 1576
258 Ga0501044_0085060 3300049823 Bacteria 3196
259 Ga0501044_0527992 3300049823 Bacteria 1079
260 Ga0501045_0013289 3300049824 Bacteria 5811
261 Ga0501045_0038733 3300049824 Bacteria 3468
262 Ga0501045_0049391 3300049824 Bacteria 3067
263 Ga0501045_0059555 3300049824 Bacteria 2798
264 Ga0501045_0232235 3300049824 Bacteria 1373
265 nmdc:mga05p37_35087_c1 3300050507 Bacteria 6149
266 nmdc:mga05p37_364866_c1 3300050507 Bacteria 1697
267 nmdc:mga08y16_240150_c1 3300050511 Bacteria 1873
268 nmdc:mga0n895_205578_c1 3300050512 Bacteria 2000
269 nmdc:mga0n895_339278_c1 3300050512 Bacteria 1522
270 nmdc:mga0n895_92356_c1 3300050512 Bacteria 3029
271 nmdc:mga0a205_549961_c1 3300050515 Bacteria 1009
272 Ga0495601_0019092 3300053077 Bacteria 4178
273 Ga0495601_0025581 3300053077 Bacteria 3641
274 Ga0495655_0062889 3300053083 Bacteria 1017
275 Ga0495619_0038314 3300053085 Bacteria 3127
276 Ga0501084_0015918 3300054114 Bacteria 6238
277 Ga0501084_0019858 3300054114 Bacteria 5599
278 Ga0501084_0068962 3300054114 Bacteria 2960
279 Ga0501084_0113564 3300054114 Bacteria 2277
280 Ga0501084_0506070 3300054114 Bacteria 1021
281 Ga0501082_0005045 3300060353 Bacteria 11515
282 Ga0501082_0118362 3300060353 Bacteria 2295
283 Ga0501082_0283705 3300060353 Bacteria 1441
284 Ga0501082_0458301 3300060353 Bacteria 1114
285 Ga0530510_0002141 3300061734 Bacteria 13561
286 Ga0530510_0075155 3300061734 Bacteria 2454
287 Ga0530510_0175641 3300061734 Bacteria 1587
288 Ga0530510_0250811 3300061734 Bacteria 1319
289 Ga0530510_0423036 3300061734 Bacteria 1005
290 Ga0501080_0170063
291 Ga0070683_100154340
292 Ga0070690_100023851
293 Ga0068868_100356105
294 Ga0070671_100157821
295 Ga0070674_100071646
296 Ga0070673_100894535
297 Ga0070713_100236554
298 Ga0070700_100112616
299 Ga0070700_100439579
300 Ga0070694_100449172
301 Ga0070708_100108407
302 Ga0068867_100265264
303 Ga0070685_10099975
304 Ga0070685_10140733
305 Ga0070706_100613137
306 Ga0070684_100166897
307 Ga0068853_100029727
308 Ga0070672_100204512
309 Ga0070686_100090715
310 Ga0070665_100205688
311 Ga0068857_100041784
312 Ga0068856_100913566
313 Ga0070702_100228037
314 Ga0068864_100138070
315 Ga0068861_100165395
316 Ga0068870_10020023
317 Ga0068858_100285327
318 Ga0081455_10057534
319 Ga0081538_10002397
320 Ga0070717_10146936
321 Ga0075428_100274301
322 Ga0075430_100676807
323 Ga0075433_10188094
324 Ga0075434_100049265
325 Ga0105240_10628185
326 Ga0111539_10053130
327 Ga0105245_10097161
328 Ga0105245_10795893
329 Ga0105245_10970769
330 Ga0105247_10043515
331 Ga0114129_10041170
332 Ga0114129_10472775
333 Ga0114129_10888264
334 Ga0105243_10150078
335 Ga0105241_10869614
336 Ga0105242_10689853
337 Ga0105248_10254019
338 Ga0105249_10021223
339 Ga0105239_10096705
340 Ga0105239_10406222
341 Ga0105239_10668505
342 Ga0105246_10093311
343 Ga0157372_11012083
344 Ga0163163_10016760
345 Ga0163163_10369689
346 Ga0157377_10033688
347 Ga0157379_10421364
348 Ga0157376_10401444
349 Ga0207656_10105842
350 Ga0207645_10119189
351 Ga0207643_10006966
352 Ga0207643_10026009
353 Ga0207660_10261120
354 Ga0207652_10624937
355 Ga0207646_10117631
356 Ga0207650_10001237
357 Ga0207650_10146321
358 Ga0207659_10155655
359 Ga0207687_10167941
360 Ga0207687_10202968
361 Ga0207700_10061762
362 Ga0207644_10325204
363 Ga0207686_10138787
364 Ga0207709_10546131
365 Ga0207704_10307919
366 Ga0207711_10781545
367 Ga0207689_10123258
368 Ga0207689_10611971
369 Ga0207661_10573915
370 Ga0207667_11030558
371 Ga0207651_10128295
372 Ga0207712_10022400
373 Ga0207712_10220650
374 Ga0207640_10398942
375 Ga0207703_10363264
376 Ga0207639_10068525
377 Ga0207708_10016793
378 Ga0207702_10395643
379 Ga0207648_10151610
380 Ga0207674_10066317
381 Ga0207675_100043612
382 Ga0207675_100259635
383 Ga0207675_100399184
384 Ga0207683_10073560
385 Ga0207683_10389908
386 Ga0268266_10013150
387 Ga0268265_10166907
388 Ga0265318_10056759
389 Ga0265338_10002813
390 Ga0265340_10019964
391 Ga0265339_10061899
392 Ga0265339_10079578
393 Ga0265316_10029903
394 Ga0307408_100304648
395 Ga0265313_10048483
396 Ga0265314_10004605
397 Ga0307413_10208883
398 Ga0307410_10362693
399 Ga0307406_10008987
400 Ga0307407_10042837
401 Ga0307409_100012065
402 Ga0307409_100880077
403 Ga0307416_100101690
404 Ga0307416_100329643
405 Ga0307415_100185471
406 Ga0395899_0036197
407 Ga0395900_0216116
408 Ga0395900_0242886
409 Ga0395898_0001780
410 Ga0395898_0002438
411 Ga0395898_0843732
412 Ga0436364_1264011
413 Ga0395901_0001312
414 Ga0436365_0135810
415 Ga0436365_0530409
416 Ga0436363_0588310
417 Ga0436362_0998221
418 Ga0466963_0067916
419 Ga0466971_0041199
420 Ga0466970_0107394
421 Ga0466957_0373548
422 Ga0466959_0026515
423 Ga0466959_0096934
424 Ga0466958_0073028
425 Ga0466967_0005466
426 Ga0466967_0008269
427 Ga0466967_0071977
428 Ga0466967_0634221
429 Ga0495629_0484969
430 Ga0495651_0084640
431 Ga0495628_0061929
432 Ga0495637_0142776
433 Ga0495642_0295326
434 Ga0495652_0096710
435 Ga0495609_0145747
436 Ga0495667_0063319
437 Ga0495656_0069087
438 Ga0495657_0027294
439 Ga0495600_0222620
440 Ga0495604_0097940
441 Ga0495684_0235659
442 Ga0495602_0019516
443 Ga0495602_0264553
444 Ga0496101_0102185
445 Ga0496102_0540156
446 Ga0496103_0283788
447 Ga0496104_0012809
448 Ga0496104_0022160
449 Ga0496106_0044438
450 Ga0496107_0325032
451 Ga0496108_0000326
452 Ga0496109_0000675
453 Ga0496109_0007356
454 Ga0496109_0067865
455 Ga0496109_0134457
456 Ga0496110_0016061
457 Ga0496110_0019173
458 Ga0496111_0008527
459 Ga0496111_0217721
460 Ga0496112_0045987
461 Ga0496112_0085279
462 Ga0496112_0138888
463 Ga0496112_0400919
464 Ga0496113_0031338
465 Ga0496113_0079820
466 Ga0496115_0223252
467 Ga0496126_0038163
468 Ga0501031_0023859
469 Ga0501031_0062115
470 Ga0501031_0374166
471 Ga0501032_0011717
472 Ga0501032_0068554
473 Ga0501033_0005758
474 Ga0501033_0231638
475 Ga0501034_0364273
476 Ga0501036_0021461
477 Ga0501036_0464640
478 Ga0501037_0009929
479 Ga0501037_0203799
480 Ga0501038_0081646
481 Ga0501039_0004124
482 Ga0501039_0009432
483 Ga0501039_0039038
484 Ga0501039_0061181
485 Ga0501040_0001647
486 Ga0501040_0003871
487 Ga0501041_0000451
488 Ga0501041_0018461
489 Ga0501041_0076857
490 Ga0501041_0135547
491 Ga0501041_0550146
492 Ga0501042_0056078
493 Ga0501042_0057579
494 Ga0501042_0157423
495 Ga0501043_0302690
496 Ga0501046_0001168
497 Ga0501046_0252719
498 Ga0501048_0012434
499 Ga0501048_0013101
500 Ga0501067_0011131
501 Ga0501067_0034128
502 Ga0501068_0001041
503 Ga0501068_0010222
504 Ga0501069_0003324
505 Ga0501069_0014495
506 Ga0501069_0016853
507 Ga0501070_0005458
508 Ga0501070_0033876
509 Ga0501070_0121251
510 Ga0501071_0006442
511 Ga0501071_0014698
512 Ga0501071_0026246
513 Ga0501072_0001708
514 Ga0501072_0003539
515 Ga0501072_0010340
516 Ga0501072_0086138
517 Ga0501072_0172301
518 Ga0501073_0127803
519 Ga0501074_0005785
520 Ga0501074_0451584
521 Ga0501075_0002815
522 Ga0501075_0099648
523 Ga0501075_0104677
524 Ga0501075_0318039
525 Ga0501076_0000881
526 Ga0501076_0006103
527 Ga0501076_0020136
528 Ga0501076_0064757
529 Ga0501076_0561283
530 Ga0501077_0005623
531 Ga0501077_0010915
532 Ga0501077_0011644
533 Ga0501079_0006745
534 Ga0501079_0030982
535 Ga0501079_0071345
536 Ga0501079_0258459
537 Ga0501079_0303373
538 Ga0501080_0014090
539 Ga0501080_0199266
540 Ga0501080_0341809
541 Ga0501081_0005024
542 Ga0501081_0013947
543 Ga0501081_0270446
544 Ga0501081_0505789
545 Ga0501083_0065583
546 Ga0501035_0231011
547 Ga0501044_0085060
548 Ga0501044_0527992
549 Ga0501045_0013289
550 Ga0501045_0038733
551 Ga0501045_0049391
552 Ga0501045_0059555
553 Ga0501045_0232235
554 nmdc:mga05p37_35087_c1
555 nmdc:mga05p37_364866_c1
556 nmdc:mga08y16_240150_c1
557 nmdc:mga0n895_205578_c1
558 nmdc:mga0n895_339278_c1
559 nmdc:mga0n895_92356_c1
560 nmdc:mga0a205_549961_c1
561 Ga0495601_0019092
562 Ga0495601_0025581
563 Ga0495655_0062889
564 Ga0495619_0038314
565 Ga0501084_0015918
566 Ga0501084_0019858
567 Ga0501084_0068962
568 Ga0501084_0113564
569 Ga0501084_0506070
570 Ga0501082_0005045
571 Ga0501082_0118362
572 Ga0501082_0283705
573 Ga0501082_0458301
574 Ga0530510_0002141
575 Ga0530510_0075155
576 Ga0530510_0175641
577 Ga0530510_0250811
578 Ga0530510_0423036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

5

134

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cgz-assembly1.cif.gz_A crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 0.947 3 232
5cgz-assembly1.cif.gz_A crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 0.9351 3 232
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.78 1 229
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.7778 3 229
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.777 2 224
ID Description Score Start End Superfamily
5cgzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.947 3 232 3.40.50.10320
5cgzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9351 3 232 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.78 1 229 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7778 3 229 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7708 3 224 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7D7VQH9-F1-model_v4 Regulator of ribonuclease activity homolog 0.9818 4 227 GO:0046872
AF-A0A399EFS8-F1-model_v4 4-oxalmesaconate hydratase (EC 4.2.1.83) 0.9806 87 232 GO:0047584
AF-G8NDK4-F1-model_v4 deleted 0.9746 3 232
AF-A0A399EFS8-F1-model_v4 4-oxalmesaconate hydratase (EC 4.2.1.83) 0.9676 87 232 GO:0047584
AF-A0A060CK70-F1-model_v4 PIG-L 0.9639 24 191

Map