F389409

General Info

Members Datasets Scaffolds Average Seq Length
289 137 264 715

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000172|Ga0496124_0000172_103431_105716
Length 761
Sequence VAVLHLDISVEHSAQRTPQTLNRRTAWLRGITPPGPPGIGYAGEHLMTRQLRQXXETSSTHTLCQRFQSVRDRTELLVEPLSAEDMVVQSMPDASPAKWHMAHTTWFFETFLLAPNLPAYEAFDPTFGYLFNSYYEAVGPRHPRPQRGLMTRPSVDQVLAYRRHVDENMTTLLMTPLSDEMTSLIELGLAHEEQHQELLLMDILHLFSLSSLKPAYSPRWPKDLLGRRGHFKPLSAGLTEIGHDGDGFSFDNEGPRHTTYLQSFEISDRLVTNGEWLSFIADGGYHTAALWLSEGWTLVQENGWNSPMYWQHDEXXXKRMSLRGLESIDPSAPVTHISYYEAAAFAQWADARLPTEAEWEAAARAGLLEQVDDVAWQWTQSAYSAYPGFKPSVGAVGEYNGKFMVNQMVLRGGASVTSPDHCRLTYRNFFHADKRWMVSGLRLARDSRQPGVVDPNDSEFARDVVAGLGAAQKTLSPKYFYDAAGSDLFEAICETPEYYPTRAETGLLKRIAGEIAATIPAGAALVEFGSGASEKTRLVLDAAPHIAVYVPIDISATALNKAARSLRQRYPSLIVAPQVDDFTRVLTLPEEADGHTRVGFFPGSTIGNFSHEQAVDFLHSAHDVLGENAHFIVGVDLVKDEQTLVAAYDDADGVTAQFNKNLLTRINRELHADFDVSAFDHLAVWNAEQACMEMHLVSRKQQSVTVAGHTFRFAAGERLHTENSHKFTVGSFTELAARAGWTVSECWISDAPQTALFSLQA

Samples

Sample ID Description Type Environment
1 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
5 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
6 2643221640 Caulobacter sp. Root342 Isolate Unclassified
7 2643221642 Caulobacter sp. Root343 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
11 2738543009 Luteibacter sp. OK325 Isolate Unclassified
12 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
13 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
14 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
15 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
16 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
17 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
18 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
19 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
20 2919085039 Luteibacter sp. 1214 Isolate Unclassified
21 2919404418 Luteibacter sp. 3190 Isolate Unclassified
22 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
23 2941471342 Luteibacter sp. 621 Isolate Unclassified
24 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
62 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
63 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
64 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.66
Metatranscriptomes 0.69
Isolates 8.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.34
Nodule 0
Rhizoplane 2.08
Rhizosphere 74.05
Stem 0
Stem Tuber 0
Unclassified 14.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000869 3300002075 Bacteria 8660
2 Ga0006562J51391_1068323 3300003578 Bacteria 9210
3 Ga0006562J51391_1068327 3300003578 Bacteria 2580
4 Ga0055536_1001913 3300003781 Bacteria 12074
5 Ga0055536_1002306 3300003781 Bacteria 10811
6 Ga0055530_10009072 3300003791 Bacteria 3873
7 Ga0055530_10012726 3300003791 Bacteria 2915
8 Ga0055531_10001446 3300003794 Bacteria 17523
9 Ga0065165_1000039 3300005262 Bacteria 208372
10 Ga0065165_1000565 3300005262 Bacteria 55180
11 Ga0070658_10036136 3300005327 Bacteria 3981
12 Ga0075369_10004262 3300006186 Bacteria 5270
13 Ga0105251_10000031 3300009011 Bacteria 124114
14 Ga0105251_10000106 3300009011 Bacteria 82337
15 Ga0105244_10021943 3300009036 Bacteria 3520
16 Ga0105250_10000406 3300009092 Bacteria 31572
17 Ga0157373_10001632 3300013100 Bacteria 17123
18 Ga0157371_10000063 3300013102 Bacteria 169490
19 Ga0157370_10000184 3300013104 Bacteria 78500
20 Ga0157369_10000364 3300013105 Bacteria 60361
21 Ga0182008_10004817 3300014497 Bacteria 7804
22 Ga0182006_1000057 3300015261 Bacteria 168707
23 Ga0182006_1000515 3300015261 Bacteria 29487
24 Ga0182005_1000096 3300015265 Bacteria 66910
25 Ga0182005_1001631 3300015265 Bacteria 8741
26 Ga0183365_10001 3300015684 Bacteria 2090444
27 Ga0163161_10002429 3300017792 Bacteria 13323
28 Ga0213872_10000135 3300021361 Bacteria 67262
29 Ga0213872_10008854 3300021361 Bacteria 4847
30 Ga0209674_100778 3300025226 Bacteria 10770
31 Ga0209437_101340 3300025233 Bacteria 6428
32 Ga0209129_1000346 3300025258 Bacteria 39518
33 Ga0209130_1000177 3300025284 Bacteria 90450
34 Ga0209676_1000200 3300025292 Bacteria 133793
35 Ga0209676_1000477 3300025292 Bacteria 66211
36 Ga0209050_1000057 3300025298 Bacteria 326289
37 Ga0209050_1000633 3300025298 Bacteria 54643
38 Ga0209051_1008698 3300025303 Bacteria 5343
39 Ga0209257_1000223 3300025304 Bacteria 134337
40 Ga0207696_1000527 3300025711 Bacteria 31580
41 Ga0207655_1003953 3300025728 Bacteria 10748
42 Ga0207713_1000042 3300025735 Bacteria 242199
43 Ga0207713_1000159 3300025735 Bacteria 101793
44 Ga0207710_10008640 3300025900 Bacteria 4295
45 Ga0207647_10000479 3300025904 Bacteria 32297
46 Ga0307412_10000718 3300031911 Bacteria 19138
47 Ga0436361_0189207 3300039447 Bacteria 31041
48 Ga0436361_0364340 3300039447 Bacteria 12665
49 Ga0436361_0649726 3300039447 Bacteria 4874
50 Ga0439436_0000034 3300041404 Bacteria 43546
51 Ga0439465_0000061 3300041413 Bacteria 23263
52 Ga0450908_000017 3300042184 Bacteria 39197
53 Ga0466982_0000138 3300044672 Bacteria 18232
54 Ga0495617_000089 3300046452 Bacteria 65101
55 Ga0495617_000133 3300046452 Bacteria 49698
56 Ga0495617_003555 3300046452 Bacteria 5828
57 Ga0495617_007342 3300046452 Bacteria 3828
58 Ga0495627_000013 3300046453 Bacteria 332765
59 Ga0495627_000064 3300046453 Bacteria 132648
60 Ga0495627_003427 3300046453 Bacteria 7009
61 Ga0495591_000041 3300046458 Bacteria 155639
62 Ga0495591_000064 3300046458 Bacteria 123820
63 Ga0495591_000802 3300046458 Bacteria 22253
64 Ga0495591_000876 3300046458 Bacteria 21126
65 Ga0495591_006551 3300046458 Bacteria 5124
66 Ga0495638_0000044 3300046460 Bacteria 221595
67 Ga0495638_0003591 3300046460 Bacteria 12147
68 Ga0495638_0022427 3300046460 Bacteria 4145
69 Ga0495653_0000180 3300046463 Bacteria 51772
70 Ga0495650_0000557 3300046471 Bacteria 52926
71 Ga0495650_0000720 3300046471 Bacteria 41984
72 Ga0495650_0001282 3300046471 Bacteria 25794
73 Ga0495650_0009360 3300046471 Bacteria 5581
74 Ga0495605_0000006 3300046474 Bacteria 361304
75 Ga0495605_0000057 3300046474 Bacteria 150333
76 Ga0495605_0000627 3300046474 Bacteria 27276
77 Ga0495605_0002035 3300046474 Bacteria 12756
78 Ga0495605_0011202 3300046474 Bacteria 5008
79 Ga0495584_0000603 3300046491 Bacteria 24146
80 Ga0495584_0002045 3300046491 Bacteria 11599
81 Ga0495584_0009625 3300046491 Bacteria 4976
82 Ga0495585_0000168 3300046492 Bacteria 70692
83 Ga0495585_0000716 3300046492 Bacteria 29779
84 Ga0495585_0002299 3300046492 Bacteria 13765
85 Ga0495585_0009191 3300046492 Bacteria 5946
86 Ga0495585_0010623 3300046492 Bacteria 5472
87 Ga0495585_0012784 3300046492 Bacteria 4937
88 Ga0495585_0023279 3300046492 Bacteria 3555
89 Ga0495607_0000046 3300046501 Bacteria 123998
90 Ga0495607_0000058 3300046501 Bacteria 109864
91 Ga0495607_0000068 3300046501 Bacteria 102009
92 Ga0495607_0000070 3300046501 Bacteria 100876
93 Ga0495607_0000266 3300046501 Bacteria 56114
94 Ga0495607_0002245 3300046501 Bacteria 15949
95 Ga0495607_0002474 3300046501 Bacteria 14994
96 Ga0495607_0010657 3300046501 Bacteria 6164
97 Ga0495607_0012514 3300046501 Bacteria 5597
98 Ga0495607_0014691 3300046501 Bacteria 5089
99 Ga0495607_0016316 3300046501 Bacteria 4793
100 Ga0495607_0016581 3300046501 Bacteria 4752
101 Ga0495607_0021575 3300046501 Bacteria 4050
102 Ga0495583_0000053 3300046506 Bacteria 210542
103 Ga0495583_0000151 3300046506 Bacteria 117627
104 Ga0495583_0000483 3300046506 Bacteria 58302
105 Ga0495583_0000788 3300046506 Bacteria 39445
106 Ga0495583_0016992 3300046506 Bacteria 3882
107 Ga0495606_0000275 3300046507 Bacteria 90456
108 Ga0495606_0000356 3300046507 Bacteria 78185
109 Ga0495606_0000387 3300046507 Bacteria 74445
110 Ga0495606_0000409 3300046507 Bacteria 72543
111 Ga0495606_0000743 3300046507 Bacteria 50416
112 Ga0495606_0005137 3300046507 Bacteria 12696
113 Ga0495606_0006531 3300046507 Bacteria 10727
114 Ga0495610_0002414 3300046512 Bacteria 15737
115 Ga0495610_0016588 3300046512 Bacteria 4231
116 Ga0495616_0000062 3300046513 Bacteria 91197
117 Ga0495616_0001680 3300046513 Bacteria 15102
118 Ga0495616_0011669 3300046513 Bacteria 5024
119 Ga0495620_0000166 3300046515 Bacteria 52419
120 Ga0495620_0000969 3300046515 Bacteria 17678
121 Ga0495620_0006548 3300046515 Bacteria 6389
122 Ga0495620_0028100 3300046515 Bacteria 2620
123 Ga0495631_0000288 3300046518 Bacteria 35151
124 Ga0495631_0000420 3300046518 Bacteria 29217
125 Ga0495631_0000721 3300046518 Bacteria 21234
126 Ga0495631_0022423 3300046518 Bacteria 2935
127 Ga0495632_0000189 3300046519 Bacteria 62424
128 Ga0495632_0005121 3300046519 Bacteria 8756
129 Ga0495632_0028602 3300046519 Bacteria 2908
130 Ga0495637_0000037 3300046520 Bacteria 120732
131 Ga0495637_0000141 3300046520 Bacteria 54791
132 Ga0495637_0003554 3300046520 Bacteria 8262
133 Ga0495637_0004858 3300046520 Bacteria 6916
134 Ga0495637_0022521 3300046520 Bacteria 2872
135 Ga0495643_0014038 3300046522 Bacteria 4776
136 Ga0495644_0000727 3300046523 Bacteria 13664
137 Ga0495644_0009289 3300046523 Bacteria 3789
138 Ga0495648_0000377 3300046524 Bacteria 48820
139 Ga0495648_0006710 3300046524 Bacteria 9314
140 Ga0495648_0015632 3300046524 Bacteria 5500
141 Ga0495648_0030216 3300046524 Bacteria 3585
142 Ga0495654_0001227 3300046530 Bacteria 18122
143 Ga0495654_0003316 3300046530 Bacteria 9913
144 Ga0495609_0000034 3300046538 Bacteria 201125
145 Ga0495609_0000075 3300046538 Bacteria 121584
146 Ga0495597_0000004 3300046542 Bacteria 307496
147 Ga0495622_0000023 3300046557 Bacteria 155188
148 Ga0495622_0029129 3300046557 Bacteria 2579
149 Ga0495633_0002026 3300046558 Bacteria 14629
150 Ga0495633_0004248 3300046558 Bacteria 9169
151 Ga0495656_0008643 3300046615 Bacteria 3643
152 Ga0495668_0000014 3300046616 Bacteria 442055
153 Ga0495668_0000071 3300046616 Bacteria 168801
154 Ga0495611_0000001 3300046648 Bacteria 2628469
155 Ga0495611_0000201 3300046648 Bacteria 41950
156 Ga0495611_0000349 3300046648 Bacteria 30120
157 Ga0495611_0003756 3300046648 Bacteria 6629
158 Ga0495625_0000001 3300046660 Bacteria 1641829
159 Ga0495625_0000089 3300046660 Bacteria 147075
160 Ga0495625_0001930 3300046660 Bacteria 23447
161 Ga0495659_0002401 3300046664 Bacteria 6048
162 Ga0495661_0000071 3300046665 Bacteria 123245
163 Ga0495661_0000101 3300046665 Bacteria 104928
164 Ga0495661_0000143 3300046665 Bacteria 83493
165 Ga0495661_0002522 3300046665 Bacteria 14059
166 Ga0495661_0007900 3300046665 Bacteria 7391
167 Ga0495670_0000748 3300046691 Bacteria 15555
168 Ga0495670_0001511 3300046691 Bacteria 11350
169 Ga0495671_0000112 3300046692 Bacteria 72401
170 Ga0495671_0000773 3300046692 Bacteria 22987
171 Ga0495671_0001680 3300046692 Bacteria 14465
172 Ga0495671_0001687 3300046692 Bacteria 14436
173 Ga0495649_0000443 3300046694 Bacteria 35820
174 Ga0495589_0000066 3300046794 Bacteria 99653
175 Ga0495660_0000097 3300046810 Bacteria 94152
176 Ga0495660_0000182 3300046810 Bacteria 67980
177 Ga0495660_0000374 3300046810 Bacteria 39217
178 Ga0495660_0004844 3300046810 Bacteria 8114
179 Ga0495660_0015632 3300046810 Bacteria 4384
180 Ga0495660_0019796 3300046810 Bacteria 3863
181 Ga0495660_0040923 3300046810 Bacteria 2567
182 Ga0495636_0000201 3300047318 Bacteria 23278
183 Ga0495672_0000074 3300047320 Bacteria 179013
184 Ga0495672_0002936 3300047320 Bacteria 15045
185 Ga0495672_0004791 3300047320 Bacteria 10911
186 Ga0495672_0006487 3300047320 Bacteria 9048
187 Ga0495672_0008591 3300047320 Bacteria 7517
188 Ga0495672_0017201 3300047320 Bacteria 4840
189 Ga0495672_0038419 3300047320 Bacteria 2920
190 Ga0495676_0000020 3300047321 Bacteria 166813
191 Ga0495676_0012959 3300047321 Bacteria 7501
192 Ga0495683_0000355 3300047323 Bacteria 37793
193 Ga0495683_0000582 3300047323 Bacteria 27553
194 Ga0495683_0001850 3300047323 Bacteria 13292
195 Ga0495683_0002964 3300047323 Bacteria 10026
196 Ga0495687_000268 3300047443 Bacteria 69524
197 Ga0495687_000376 3300047443 Bacteria 55694
198 Ga0495677_0000644 3300047445 Bacteria 14077
199 Ga0495677_0000720 3300047445 Bacteria 13367
200 Ga0495679_000001 3300047446 Bacteria 1607568
201 Ga0495679_000079 3300047446 Bacteria 90806
202 Ga0495685_000031 3300047447 Bacteria 58983
203 Ga0495673_0000001 3300047469 Bacteria 1630730
204 Ga0495673_0000030 3300047469 Bacteria 468915
205 Ga0495673_0000183 3300047469 Bacteria 101083
206 Ga0495673_0000442 3300047469 Bacteria 45981
207 Ga0495673_0000466 3300047469 Bacteria 43940
208 Ga0495673_0000579 3300047469 Bacteria 36826
209 Ga0495673_0001320 3300047469 Bacteria 20165
210 Ga0495673_0005515 3300047469 Bacteria 7637
211 Ga0495673_0008857 3300047469 Bacteria 5612
212 Ga0495673_0015076 3300047469 Bacteria 3995
213 Ga0495681_0000753 3300047470 Bacteria 24948
214 Ga0495686_0000175 3300047472 Bacteria 122163
215 Ga0495686_0000831 3300047472 Bacteria 39713
216 Ga0495686_0003760 3300047472 Bacteria 12908
217 Ga0495686_0021906 3300047472 Bacteria 4234
218 Ga0495686_0034680 3300047472 Bacteria 3248
219 Ga0495686_0036417 3300047472 Bacteria 3158
220 Ga0495626_0000041 3300048091 Bacteria 172663
221 Ga0496100_0001951 3300048903 Bacteria 10327
222 Ga0496101_0000410 3300048904 Bacteria 27774
223 Ga0496106_0052349 3300048909 Bacteria 3080
224 Ga0496110_0019889 3300048913 Bacteria 5658
225 Ga0496117_0025745 3300048920 Bacteria 4617
226 Ga0496119_0010230 3300048922 Bacteria 7914
227 Ga0496121_0000376 3300048924 Bacteria 91480
228 Ga0496121_0000521 3300048924 Bacteria 73374
229 Ga0496121_0001833 3300048924 Bacteria 34277
230 Ga0496121_0005093 3300048924 Bacteria 17137
231 Ga0496122_0000285 3300048925 Bacteria 113073
232 Ga0496122_0050182 3300048925 Bacteria 3185
233 Ga0496122_0054119 3300048925 Bacteria 3017
234 Ga0496123_0000232 3300048926 Bacteria 113073
235 Ga0496123_0005994 3300048926 Bacteria 11953
236 Ga0496123_0012880 3300048926 Bacteria 7080
237 Ga0496123_0030183 3300048926 Bacteria 3972
238 Ga0496124_0000172 3300048927 Bacteria 130204
239 Ga0496124_0000272 3300048927 Bacteria 99703
240 Ga0496124_0001091 3300048927 Bacteria 42641
241 Ga0496124_0065243 3300048927 Bacteria 3037
242 Ga0496125_0035197 3300048928 Bacteria 4400
243 Ga0496125_0075696 3300048928 Bacteria 2603
244 Ga0496126_0004054 3300048929 Bacteria 17803
245 Ga0496126_0115963 3300048929 Bacteria 2328
246 Ga0495678_000296 3300049459 Bacteria 54659
247 Ga0495678_000406 3300049459 Bacteria 43574
248 Ga0495678_001475 3300049459 Bacteria 18411
249 Ga0495678_024206 3300049459 Bacteria 2625
250 Ga0495682_0000065 3300049460 Bacteria 98530
251 Ga0495682_0000350 3300049460 Bacteria 33753
252 Ga0495682_0000480 3300049460 Bacteria 27579
253 Ga0495682_0002461 3300049460 Bacteria 8745
254 Ga0501034_0029875 3300049571 Bacteria 5540
255 Ga0501035_0001965 3300049822 Bacteria 20572
256 nmdc:mga0sz30_7513_c1 3300050516 Bacteria 4089
257 Ga0500635_0000432 3300053080 Bacteria 12152
258 Ga0500643_000002 3300053087 Bacteria 1277657
259 Ga0500555_000523 3300053103 Bacteria 15401
260 Ga0500608_000102 3300053122 Bacteria 34987
261 Ga0500608_000124 3300053122 Bacteria 31810
262 Ga0500618_000914 3300053125 Bacteria 15318
263 Ga0500633_0004859 3300053160 Bacteria 3132
264 Ga0500645_000476 3300053730 Bacteria 27430

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0016992 Ga0495583_0016992_10_1818 592
2 3300049571 Ga0501034_0029875 Ga0501034_0029875_2321_4294 636
3 3300046515 Ga0495620_0006548 Ga0495620_0006548_1022_2962 639
4 3300048927 Ga0496124_0000272 Ga0496124_0000272_35864_37882 666
5 3300046491 Ga0495584_0000603 Ga0495584_0000603_943_3099 671
6 3300005262 Ga0065165_1000039 Ga0065165_100003941 677
7 3300025284 Ga0209130_1000177 Ga0209130_100017763 677
8 3300046507 Ga0495606_0005137 Ga0495606_0005137_8720_10774 684
9 3300047320 Ga0495672_0000074 Ga0495672_0000074_58076_60211 685
10 3300046492 Ga0495585_0009191 Ga0495585_0009191_1490_3646 688
11 3300046506 Ga0495583_0000053 Ga0495583_0000053_173308_175464 688
12 3300046523 Ga0495644_0000727 Ga0495644_0000727_3631_5787 688
13 3300046524 Ga0495648_0030216 Ga0495648_0030216_1208_3364 688
14 3300046615 Ga0495656_0008643 Ga0495656_0008643_659_2815 688
15 3300046664 Ga0495659_0002401 Ga0495659_0002401_2449_4605 688
16 3300046691 Ga0495670_0001511 Ga0495670_0001511_7640_9796 688
17 3300047318 Ga0495636_0000201 Ga0495636_0000201_14158_16314 688
18 3300047443 Ga0495687_000268 Ga0495687_000268_6498_8732 688
19 3300047445 Ga0495677_0000644 Ga0495677_0000644_8304_10460 688
20 3300047447 Ga0495685_000031 Ga0495685_000031_50798_52954 688
21 3300049459 Ga0495678_001475 Ga0495678_001475_7109_9265 688
22 3300049460 Ga0495682_0002461 Ga0495682_0002461_3306_5462 688
23 3300046492 Ga0495585_0000716 Ga0495585_0000716_22874_25039 689
24 3300046501 Ga0495607_0010657 Ga0495607_0010657_1507_3663 689
25 3300046523 Ga0495644_0009289 Ga0495644_0009289_1255_3411 689
26 3300046648 Ga0495611_0003756 Ga0495611_0003756_3239_5395 689
27 3300046665 Ga0495661_0000071 Ga0495661_0000071_54793_56958 689
28 3300009011 Ga0105251_10000106 Ga0105251_1000010611 690
29 3300009092 Ga0105250_10000406 Ga0105250_1000040613 690
30 3300025711 Ga0207696_1000527 Ga0207696_100052721 690
31 3300025735 Ga0207713_1000159 Ga0207713_100015969 690
32 3300046460 Ga0495638_0022427 Ga0495638_0022427_310_2466 691
33 3300046501 Ga0495607_0016316 Ga0495607_0016316_2480_4636 691
34 3300047320 Ga0495672_0004791 Ga0495672_0004791_7801_9957 691
35 3300047323 Ga0495683_0002964 Ga0495683_0002964_6916_9072 691
36 3300047469 Ga0495673_0008857 Ga0495673_0008857_1122_3278 691
37 3300005327 Ga0070658_10036136 Ga0070658_100361363 692
38 3300046453 Ga0495627_000013 Ga0495627_000013_82343_84493 692
39 3300046463 Ga0495653_0000180 Ga0495653_0000180_45157_47322 692
40 3300046492 Ga0495585_0010623 Ga0495585_0010623_2608_4794 692
41 3300046501 Ga0495607_0012514 Ga0495607_0012514_1467_3632 692
42 3300046507 Ga0495606_0000387 Ga0495606_0000387_66496_68661 692
43 3300046558 Ga0495633_0002026 Ga0495633_0002026_3477_5642 692
44 3300046558 Ga0495633_0004248 Ga0495633_0004248_1945_4131 692
45 3300049460 Ga0495682_0000480 Ga0495682_0000480_12869_15055 692
46 3300048928 Ga0496125_0075696 Ga0496125_0075696_385_2547 693
47 3300048929 Ga0496126_0004054 Ga0496126_0004054_3777_5939 693
48 3300046507 Ga0495606_0000409 Ga0495606_0000409_28716_30803 694
49 3300021361 Ga0213872_10000135 Ga0213872_100001356 696
50 3300039447 Ga0436361_0364340 Ga0436361_0364340_4255_6402 696
51 3300046501 Ga0495607_0014691 Ga0495607_0014691_256_2403 696
52 3300046810 Ga0495660_0019796 Ga0495660_0019796_1484_3631 696
53 3300047320 Ga0495672_0038419 Ga0495672_0038419_413_2563 697
54 3300053080 Ga0500635_0000432 Ga0500635_0000432_8701_10842 697
55 3300046501 Ga0495607_0000266 Ga0495607_0000266_4990_7137 698
56 3300046519 Ga0495632_0028602 Ga0495632_0028602_508_2655 698
57 3300047323 Ga0495683_0000355 Ga0495683_0000355_13972_16137 698
58 3300053122 Ga0500608_000124 Ga0500608_000124_4138_6312 698
59 3300005262 Ga0065165_1000565 Ga0065165_100056539 699
60 3300039447 Ga0436361_0649726 Ga0436361_0649726_1600_3804 699
61 3300025904 Ga0207647_10000479 Ga0207647_1000047913 700
62 3300046616 Ga0495668_0000071 Ga0495668_0000071_45673_47799 700
63 3300047472 Ga0495686_0000831 Ga0495686_0000831_3422_5548 700
64 3300048925 Ga0496122_0050182 Ga0496122_0050182_930_3107 700
65 3300048926 Ga0496123_0030183 Ga0496123_0030183_52_2229 700
66 3300048928 Ga0496125_0035197 Ga0496125_0035197_21_2198 700
67 3300021361 Ga0213872_10008854 Ga0213872_100088545 701
68 3300039447 Ga0436361_0189207 Ga0436361_0189207_18151_20355 701
69 3300046453 Ga0495627_000064 Ga0495627_000064_7372_9516 701
70 3300046471 Ga0495650_0009360 Ga0495650_0009360_2493_4637 701
71 3300046518 Ga0495631_0000721 Ga0495631_0000721_5129_7273 701
72 3300046530 Ga0495654_0001227 Ga0495654_0001227_5507_7651 701
73 3300047320 Ga0495672_0017201 Ga0495672_0017201_1994_4138 701
74 3300013104 Ga0157370_10000184 Ga0157370_1000018452 702
75 3300015265 Ga0182005_1000096 Ga0182005_100009618 702
76 3300046453 Ga0495627_003427 Ga0495627_003427_3019_5196 702
77 3300046458 Ga0495591_000876 Ga0495591_000876_7979_10156 702
78 3300046501 Ga0495607_0002474 Ga0495607_0002474_1087_3231 702
79 3300003578 Ga0006562J51391_1068323 Ga0006562J51391_10683235 705
80 3300003578 Ga0006562J51391_1068327 Ga0006562J51391_10683272 705
81 3300049822 Ga0501035_0001965 Ga0501035_0001965_9779_11911 705
82 iso_pu_bacteria 2599185307 2599974441 705
83 iso_pu_bacteria 2600255283 2601625317 705
84 iso_pu_bacteria 2738541271 2738690792 705
85 iso_pu_bacteria 2738543016 2739266566 705
86 3300013102 Ga0157371_10000063 Ga0157371_1000006348 706
87 3300046692 Ga0495671_0001680 Ga0495671_0001680_5955_8099 707
88 iso_pu_bacteria 2585428106 2587919628 707
89 iso_pu_bacteria 2643221640 2644226439 707
90 iso_pu_bacteria 2643221642 2644235927 707
91 iso_pu_bacteria 2928531327 2928533952 707
92 3300009011 Ga0105251_10000031 Ga0105251_1000003188 708
93 3300009036 Ga0105244_10021943 Ga0105244_100219431 708
94 3300013100 Ga0157373_10001632 Ga0157373_100016323 708
95 3300025728 Ga0207655_1003953 Ga0207655_100395311 708
96 3300025735 Ga0207713_1000042 Ga0207713_100004292 708
97 3300046452 Ga0495617_007342 Ga0495617_007342_1594_3741 708
98 3300046458 Ga0495591_000041 Ga0495591_000041_65336_67486 708
99 3300046458 Ga0495591_000064 Ga0495591_000064_90884_93031 708
100 3300046458 Ga0495591_000802 Ga0495591_000802_2735_4882 708
101 3300046458 Ga0495591_006551 Ga0495591_006551_756_2903 708
102 3300046471 Ga0495650_0000557 Ga0495650_0000557_20443_22590 708
103 3300046471 Ga0495650_0001282 Ga0495650_0001282_22042_24189 708
104 3300046474 Ga0495605_0000006 Ga0495605_0000006_204240_206387 708
105 3300046474 Ga0495605_0000057 Ga0495605_0000057_127145_129292 708
106 3300046474 Ga0495605_0000627 Ga0495605_0000627_1560_3710 708
107 3300046474 Ga0495605_0002035 Ga0495605_0002035_533_2677 708
108 3300046474 Ga0495605_0011202 Ga0495605_0011202_1103_3253 708
109 3300046491 Ga0495584_0009625 Ga0495584_0009625_926_3073 708
110 3300046492 Ga0495585_0012784 Ga0495585_0012784_1610_3757 708
111 3300046501 Ga0495607_0000058 Ga0495607_0000058_86166_88313 708
112 3300046501 Ga0495607_0000070 Ga0495607_0000070_46162_48312 708
113 3300046501 Ga0495607_0021575 Ga0495607_0021575_1397_3547 708
114 3300046506 Ga0495583_0000151 Ga0495583_0000151_90866_93013 708
115 3300046506 Ga0495583_0000483 Ga0495583_0000483_31002_33149 708
116 3300046506 Ga0495583_0000788 Ga0495583_0000788_15798_17945 708
117 3300046507 Ga0495606_0000743 Ga0495606_0000743_16788_18935 708
118 3300046512 Ga0495610_0016588 Ga0495610_0016588_2016_4163 708
119 3300046513 Ga0495616_0011669 Ga0495616_0011669_1061_3208 708
120 3300046515 Ga0495620_0000166 Ga0495620_0000166_40936_43083 708
121 3300046515 Ga0495620_0028100 Ga0495620_0028100_253_2400 708
122 3300046518 Ga0495631_0022423 Ga0495631_0022423_585_2732 708
123 3300046519 Ga0495632_0000189 Ga0495632_0000189_38521_40668 708
124 3300046519 Ga0495632_0005121 Ga0495632_0005121_1275_3422 708
125 3300046520 Ga0495637_0000037 Ga0495637_0000037_50939_53086 708
126 3300046520 Ga0495637_0000141 Ga0495637_0000141_32142_34289 708
127 3300046520 Ga0495637_0004858 Ga0495637_0004858_2600_4750 708
128 3300046520 Ga0495637_0022521 Ga0495637_0022521_89_2236 708
129 3300046522 Ga0495643_0014038 Ga0495643_0014038_1806_3953 708
130 3300046524 Ga0495648_0000377 Ga0495648_0000377_30253_32400 708
131 3300046524 Ga0495648_0015632 Ga0495648_0015632_3092_5239 708
132 3300046530 Ga0495654_0003316 Ga0495654_0003316_7547_9694 708
133 3300046538 Ga0495609_0000034 Ga0495609_0000034_47527_49674 708
134 3300046538 Ga0495609_0000075 Ga0495609_0000075_45505_47652 708
135 3300046542 Ga0495597_0000004 Ga0495597_0000004_88306_90456 708
136 3300046557 Ga0495622_0029129 Ga0495622_0029129_353_2500 708
137 3300046648 Ga0495611_0000349 Ga0495611_0000349_24644_26791 708
138 3300046660 Ga0495625_0000089 Ga0495625_0000089_63040_65187 708
139 3300046665 Ga0495661_0000101 Ga0495661_0000101_39239_41386 708
140 3300046665 Ga0495661_0000143 Ga0495661_0000143_55828_57975 708
141 3300046665 Ga0495661_0007900 Ga0495661_0007900_5008_7155 708
142 3300046692 Ga0495671_0000773 Ga0495671_0000773_20581_22728 708
143 3300046810 Ga0495660_0000374 Ga0495660_0000374_19717_21867 708
144 3300046810 Ga0495660_0004844 Ga0495660_0004844_3010_5157 708
145 3300046810 Ga0495660_0015632 Ga0495660_0015632_509_2659 708
146 3300046810 Ga0495660_0040923 Ga0495660_0040923_159_2306 708
147 3300047320 Ga0495672_0006487 Ga0495672_0006487_5540_7690 708
148 3300047320 Ga0495672_0008591 Ga0495672_0008591_2237_4384 708
149 3300047321 Ga0495676_0000020 Ga0495676_0000020_58103_60250 708
150 3300047446 Ga0495679_000079 Ga0495679_000079_37255_39402 708
151 3300047469 Ga0495673_0000183 Ga0495673_0000183_28096_30327 708
152 3300047469 Ga0495673_0000442 Ga0495673_0000442_23637_25784 708
153 3300047469 Ga0495673_0000466 Ga0495673_0000466_19181_21328 708
154 3300047469 Ga0495673_0000579 Ga0495673_0000579_12728_14875 708
155 3300047469 Ga0495673_0015076 Ga0495673_0015076_971_3118 708
156 3300047470 Ga0495681_0000753 Ga0495681_0000753_15116_17263 708
157 3300048091 Ga0495626_0000041 Ga0495626_0000041_107258_109405 708
158 3300048913 Ga0496110_0019889 Ga0496110_0019889_3365_5512 708
159 3300048924 Ga0496121_0005093 Ga0496121_0005093_3812_5989 708
160 3300048925 Ga0496122_0000285 Ga0496122_0000285_94426_96603 708
161 3300048926 Ga0496123_0000232 Ga0496123_0000232_16471_18648 708
162 3300048926 Ga0496123_0012880 Ga0496123_0012880_2200_4347 708
163 3300048927 Ga0496124_0000172 Ga0496124_0000172_103431_105716 708
164 3300048927 Ga0496124_0001091 Ga0496124_0001091_3120_5267 708
165 3300049459 Ga0495678_000406 Ga0495678_000406_20503_22650 708
166 3300049459 Ga0495678_024206 Ga0495678_024206_112_2259 708
167 3300049460 Ga0495682_0000065 Ga0495682_0000065_80995_83142 708
168 iso_pu_bacteria 2857504554 2857506753 708
169 iso_pu_bacteria 2884960567 2884963865 708
170 3300015684 Ga0183365_10001 Ga0183365_100011024 709
171 3300047472 Ga0495686_0036417 Ga0495686_0036417_850_2997 709
172 3300053122 Ga0500608_000102 Ga0500608_000102_27821_29968 709
173 iso_pu_bacteria 2739367756 2739793079 709
174 3300046694 Ga0495649_0000443 Ga0495649_0000443_30437_32602 710
175 3300047321 Ga0495676_0012959 Ga0495676_0012959_2946_5111 710
176 3300053125 Ga0500618_000914 Ga0500618_000914_6040_8205 710
177 3300003781 Ga0055536_1001913 Ga0055536_100191310 712
178 3300003781 Ga0055536_1002306 Ga0055536_10023069 712
179 3300003791 Ga0055530_10009072 Ga0055530_100090722 712
180 3300003791 Ga0055530_10012726 Ga0055530_100127262 712
181 3300003794 Ga0055531_10001446 Ga0055531_100014469 712
182 3300006186 Ga0075369_10004262 Ga0075369_100042622 712
183 3300025292 Ga0209676_1000200 Ga0209676_1000200121 712
184 3300025292 Ga0209676_1000477 Ga0209676_10004779 712
185 3300025298 Ga0209050_1000057 Ga0209050_1000057238 712
186 3300025298 Ga0209050_1000633 Ga0209050_100063342 712
187 3300025304 Ga0209257_1000223 Ga0209257_100022368 712
188 3300046616 Ga0495668_0000014 Ga0495668_0000014_388225_390390 712
189 3300047472 Ga0495686_0021906 Ga0495686_0021906_1204_3366 712
190 3300050516 nmdc:mga0sz30_7513_c1 nmdc:mga0sz30_7513_c1_1308_3470 712
191 3300046460 Ga0495638_0003591 Ga0495638_0003591_2069_4243 714
192 3300046491 Ga0495584_0002045 Ga0495584_0002045_3262_5457 714
193 3300046492 Ga0495585_0023279 Ga0495585_0023279_1080_3275 714
194 3300046507 Ga0495606_0000275 Ga0495606_0000275_31143_33338 714
195 3300046513 Ga0495616_0000062 Ga0495616_0000062_59037_61232 714
196 3300046692 Ga0495671_0001687 Ga0495671_0001687_2134_4308 714
197 3300047323 Ga0495683_0001850 Ga0495683_0001850_1431_3626 714
198 3300047472 Ga0495686_0003760 Ga0495686_0003760_6327_8522 714
199 3300048924 Ga0496121_0000521 Ga0496121_0000521_39353_41548 714
200 3300046557 Ga0495622_0000023 Ga0495622_0000023_74778_76997 715
201 iso_pu_bacteria 2734482264 2735836188 715
202 iso_pu_bacteria 2919085039 2919085618 715
203 3300013105 Ga0157369_10000364 Ga0157369_1000036430 716
204 3300025303 Ga0209051_1008698 Ga0209051_10086984 716
205 3300046471 Ga0495650_0000720 Ga0495650_0000720_23576_25771 716
206 3300046518 Ga0495631_0000288 Ga0495631_0000288_23559_25754 716
207 3300046648 Ga0495611_0000201 Ga0495611_0000201_23541_25736 716
208 3300047472 Ga0495686_0034680 Ga0495686_0034680_851_3046 716
209 3300048909 Ga0496106_0052349 Ga0496106_0052349_598_2775 716
210 3300048920 Ga0496117_0025745 Ga0496117_0025745_2278_4455 716
211 3300048924 Ga0496121_0000376 Ga0496121_0000376_40046_42223 716
212 3300048925 Ga0496122_0054119 Ga0496122_0054119_294_2471 716
213 3300048929 Ga0496126_0115963 Ga0496126_0115963_54_2231 716
214 iso_pu_bacteria 2593339238 2595445906 717
215 3300046452 Ga0495617_003555 Ga0495617_003555_1572_3758 718
216 3300046492 Ga0495585_0002299 Ga0495585_0002299_6331_8517 718
217 3300046501 Ga0495607_0002245 Ga0495607_0002245_8162_10348 718
218 3300046513 Ga0495616_0001680 Ga0495616_0001680_2117_4303 718
219 3300046660 Ga0495625_0001930 Ga0495625_0001930_12150_14336 718
220 3300047320 Ga0495672_0002936 Ga0495672_0002936_2086_4272 718
221 3300047323 Ga0495683_0000582 Ga0495683_0000582_10195_12381 718
222 3300047443 Ga0495687_000376 Ga0495687_000376_41838_44024 718
223 3300047445 Ga0495677_0000720 Ga0495677_0000720_9194_11380 718
224 3300047469 Ga0495673_0005515 Ga0495673_0005515_3564_5750 718
225 iso_pu_bacteria 2818991440 2819563052 718
226 iso_pu_bacteria 2904463128 2904463668 718
227 3300046501 Ga0495607_0016581 Ga0495607_0016581_527_2686 719
228 iso_pu_bacteria 2593339239 2595452622 719
229 3300046524 Ga0495648_0006710 Ga0495648_0006710_6571_8766 720
230 3300047469 Ga0495673_0000030 Ga0495673_0000030_30868_33063 720
231 3300053160 Ga0500633_0004859 Ga0500633_0004859_890_3085 720
232 iso_pu_bacteria 2919404418 2919405179 720
233 3300025226 Ga0209674_100778 Ga0209674_10077810 721
234 3300025233 Ga0209437_101340 Ga0209437_1013404 721
235 iso_pu_bacteria 2941471342 2941473496 721
236 3300046452 Ga0495617_000089 Ga0495617_000089_49276_51465 722
237 3300046492 Ga0495585_0000168 Ga0495585_0000168_46389_48584 722
238 3300046515 Ga0495620_0000969 Ga0495620_0000969_13808_15997 722
239 3300046518 Ga0495631_0000420 Ga0495631_0000420_4941_7136 722
240 3300046665 Ga0495661_0002522 Ga0495661_0002522_9129_11324 722
241 3300047472 Ga0495686_0000175 Ga0495686_0000175_41989_44178 722
242 3300049460 Ga0495682_0000350 Ga0495682_0000350_13873_16068 722
243 3300053730 Ga0500645_000476 Ga0500645_000476_16838_19033 722
244 iso_pu_bacteria 2884338543 2884340313 722
245 3300044672 Ga0466982_0000138 Ga0466982_0000138_10792_12966 723
246 3300025258 Ga0209129_1000346 Ga0209129_100034637 724
247 3300048903 Ga0496100_0001951 Ga0496100_0001951_4965_7160 725
248 3300048904 Ga0496101_0000410 Ga0496101_0000410_22_2217 725
249 3300048926 Ga0496123_0005994 Ga0496123_0005994_3327_5522 725
250 iso_pu_bacteria 2718218334 2721027752 725
251 3300048927 Ga0496124_0065243 Ga0496124_0065243_132_2318 726
252 iso_pu_bacteria 2734482264 2735836691 726
253 iso_pu_bacteria 2738543009 2739228607 726
254 3300046501 Ga0495607_0000068 Ga0495607_0000068_1990_4182 728
255 iso_pu_bacteria 2842918807 2842918857 728
256 iso_pu_bacteria 2953994433 2953994859 728
257 3300017792 Ga0163161_10002429 Ga0163161_100024299 729
258 3300046507 Ga0495606_0000356 Ga0495606_0000356_63048_65237 729
259 3300046452 Ga0495617_000133 Ga0495617_000133_45428_47620 730
260 3300046460 Ga0495638_0000044 Ga0495638_0000044_19601_21793 730
261 3300046501 Ga0495607_0000046 Ga0495607_0000046_67580_69772 730
262 3300046520 Ga0495637_0003554 Ga0495637_0003554_1223_3415 730
263 3300046648 Ga0495611_0000001 Ga0495611_0000001_803156_805348 730
264 3300046660 Ga0495625_0000001 Ga0495625_0000001_1110699_1112891 730
265 3300046794 Ga0495589_0000066 Ga0495589_0000066_14153_16345 730
266 3300046810 Ga0495660_0000097 Ga0495660_0000097_40417_42609 730
267 3300047446 Ga0495679_000001 Ga0495679_000001_783248_785440 730
268 3300047469 Ga0495673_0001320 Ga0495673_0001320_2436_4628 730
269 3300049459 Ga0495678_000296 Ga0495678_000296_40867_43059 730
270 3300053103 Ga0500555_000523 Ga0500555_000523_211_2403 730
271 3300015261 Ga0182006_1000057 Ga0182006_1000057140 731
272 3300025900 Ga0207710_10008640 Ga0207710_100086404 731
273 3300042184 Ga0450908_000017 Ga0450908_000017_30700_32904 731
274 3300046507 Ga0495606_0006531 Ga0495606_0006531_1816_4011 731
275 3300046691 Ga0495670_0000748 Ga0495670_0000748_9037_11232 731
276 3300046692 Ga0495671_0000112 Ga0495671_0000112_53405_55600 731
277 3300046810 Ga0495660_0000182 Ga0495660_0000182_18169_20364 731
278 3300047469 Ga0495673_0000001 Ga0495673_0000001_1154098_1156293 731
279 3300048924 Ga0496121_0001833 Ga0496121_0001833_15562_17757 731
280 3300053087 Ga0500643_000002 Ga0500643_000002_1019661_1021856 731
281 3300002075 JGI24738J21930_10000869 JGI24738J21930_100008693 732
282 3300014497 Ga0182008_10004817 Ga0182008_100048174 732
283 3300015261 Ga0182006_1000515 Ga0182006_100051517 732
284 3300015265 Ga0182005_1001631 Ga0182005_10016314 732
285 3300031911 Ga0307412_10000718 Ga0307412_1000071818 732
286 3300041404 Ga0439436_0000034 Ga0439436_0000034_13509_15707 732
287 3300041413 Ga0439465_0000061 Ga0439465_0000061_4588_6786 732
288 3300046512 Ga0495610_0002414 Ga0495610_0002414_53_2251 732
289 3300048922 Ga0496119_0010230 Ga0496119_0010230_1525_3723 732

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10017

Methyltransf_33

Histidine-specific methyltransferase, SAM-dependent

460

761

0.96

PF12867

DinB_2

DinB superfamily

66

201

0.87

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

231

373

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sf5-assembly2.cif.gz_B m. tb egtd in complex with hd3 0.9444 419 729
4uy5-assembly1.cif.gz_A crystal structure of histidine-specific methyltransferase egtd from mycobacterium smegmatis 0.9399 420 732
4pip-assembly4.cif.gz_D engineered egtd variant egtd-m252v,e282a in complex with tryptophan and sah 0.9394 419 729
4pim-assembly1.cif.gz_A ergothioneine-biosynthetic methyltransferase egtd, apo form 0.934 419 729
4pin-assembly1.cif.gz_A ergothioneine-biosynthetic methyltransferase egtd in complex with n,n-dimethylhistidine 0.9337 419 729
ID Description Score Start End Superfamily
af_P9WN47_45_223_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9368 457 633 3.40.50.150
af_P9WN47_45_223_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9216 457 633 3.40.50.150
4uy7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9062 468 732 3.40.50.150
af_O94632_40_225_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8972 457 630 3.40.50.150
af_O94632_40_225_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8388 457 630 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3B9LDR2-F1-model_v4 Ergothioneine biosynthesis protein EgtB 0.9931 241 332
AF-A0A327K4S3-F1-model_v4 L-histidine N(Alpha)-methyltransferase 0.988 423 730 GO:0008168
GO:0032259
AF-A0A2G4JQG6-F1-model_v4 deleted 0.9875 601 730
AF-X1ETE9-F1-model_v4 Histidine-specific methyltransferase SAM-dependent domain-containing protein 0.986 604 731 GO:0008168
GO:0032259
AF-A0A4D7DJ90-F1-model_v4 L-histidine N(Alpha)-methyltransferase (EC 2.1.1.44) 0.9857 429 730 GO:0032259
GO:0052706

Feature Viewer

pLDDT pTM Quality
83.1 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map