F389407

General Info

Members Datasets Scaffolds Average Seq Length
289 187 578 103

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0425508|Ga0496120_0425508_171_512
Length 113
Sequence VTTPTLVPVFAALGDETRWSILEALGEGDASASALAGRLPVSRQAIAKHLAVLQGVGLVEPVQVGREVRYRVLGAEFAATARRLDAIGAEWDRRLAAIKRIAEGLERDGGTTR

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
86 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
87 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
88 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
89 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
109 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
113 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
174 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
175 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
176 2643221597 Microbacterium sp. Root180 Isolate Unclassified
177 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
178 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
179 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
180 2808606372 Agromyces sp. 23-23 Isolate Unclassified
181 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
182 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
183 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
184 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
185 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
186 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
187 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.12
Metatranscriptomes 1.73
Isolates 4.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0
Rhizoplane 16.96
Rhizosphere 67.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0425508 3300048923 Bacteria 582
2 JGI24740J21852_10003560 3300001979 Bacteria 6814
3 Ga0055540_1000100 3300003792 Bacteria 96138
4 Ga0070658_10078401 3300005327 Bacteria 2711
5 Ga0070683_101978806 3300005329 Bacteria 560
6 Ga0070670_101524174 3300005331 Bacteria 614
7 Ga0070670_101961821 3300005331 Bacteria 539
8 Ga0070677_10082933 3300005333 Bacteria 1376
9 Ga0070682_100961121 3300005337 Bacteria 706
10 Ga0070660_101677159 3300005339 Bacteria 541
11 Ga0070689_100425562 3300005340 Bacteria 1126
12 Ga0070692_11111728 3300005345 Bacteria 558
13 Ga0070669_100196250 3300005353 Bacteria 1586
14 Ga0070675_100123837 3300005354 Bacteria 2198
15 Ga0070675_100529679 3300005354 Bacteria 1064
16 Ga0070674_100547314 3300005356 Bacteria 971
17 Ga0070710_10000074 3300005437 Bacteria 45220
18 Ga0070710_10014710 3300005437 Bacteria 3943
19 Ga0070663_100387379 3300005455 Bacteria 1140
20 Ga0070663_100848629 3300005455 Bacteria 786
21 Ga0070684_100339602 3300005535 Bacteria 1381
22 Ga0070672_100314985 3300005543 Bacteria 1329
23 Ga0070672_100976804 3300005543 Bacteria 750
24 Ga0070672_101144822 3300005543 Bacteria 692
25 Ga0070693_100358378 3300005547 Bacteria 1000
26 Ga0070665_100393510 3300005548 Bacteria 1394
27 Ga0068857_100254861 3300005577 Bacteria 1609
28 Ga0068856_100577654 3300005614 Bacteria 1145
29 Ga0068856_101885540 3300005614 Bacteria 609
30 Ga0068852_100564275 3300005616 Bacteria 1140
31 Ga0068852_101920223 3300005616 Bacteria 614
32 Ga0068851_10243869 3300005834 Bacteria 1017
33 Ga0068863_102029834 3300005841 Bacteria 585
34 Ga0075365_11139668 3300006038 Bacteria 549
35 Ga0075364_10009029 3300006051 Bacteria 5971
36 Ga0075432_10507807 3300006058 Bacteria 538
37 Ga0105244_10285340 3300009036 Bacteria 765
38 Ga0111539_11584900 3300009094 Bacteria 759
39 Ga0111539_12658292 3300009094 Bacteria 580
40 Ga0105245_10086247 3300009098 Bacteria 2879
41 Ga0105245_10181810 3300009098 Bacteria 2009
42 Ga0105245_11545459 3300009098 Bacteria 715
43 Ga0105243_10426502 3300009148 Bacteria 1238
44 Ga0105243_11288139 3300009148 Bacteria 747
45 Ga0105248_10358712 3300009177 Bacteria 1641
46 Ga0105237_10148694 3300009545 Bacteria 2338
47 Ga0105239_10085526 3300010375 Bacteria 3476
48 Ga0105239_10705078 3300010375 Bacteria 1154
49 Ga0105246_10331496 3300011119 Bacteria 1240
50 Ga0157371_10968470 3300013102 Bacteria 648
51 Ga0157370_10096928 3300013104 Bacteria 2767
52 Ga0157370_10247371 3300013104 Bacteria 1649
53 Ga0157370_11634202 3300013104 Bacteria 579
54 Ga0157370_11806491 3300013104 Bacteria 549
55 Ga0157369_10007159 3300013105 Bacteria 12856
56 Ga0157369_10179062 3300013105 Bacteria 2231
57 Ga0157369_10571651 3300013105 Bacteria 1167
58 Ga0157369_10893146 3300013105 Bacteria 911
59 Ga0157374_11513446 3300013296 Bacteria 694
60 Ga0163162_10247712 3300013306 Bacteria 1913
61 Ga0163162_10744886 3300013306 Bacteria 1099
62 Ga0157372_10394795 3300013307 Bacteria 1612
63 Ga0157372_10420876 3300013307 Bacteria 1557
64 Ga0157372_10699617 3300013307 Bacteria 1179
65 Ga0157372_12165314 3300013307 Bacteria 639
66 Ga0157375_10023251 3300013308 Bacteria 5716
67 Ga0157375_11029274 3300013308 Bacteria 962
68 Ga0163163_10286408 3300014325 Bacteria 1699
69 Ga0163163_10488902 3300014325 Bacteria 1292
70 Ga0163163_10490665 3300014325 Bacteria 1290
71 Ga0163163_10960074 3300014325 Bacteria 918
72 Ga0163163_12331934 3300014325 Bacteria 594
73 Ga0157380_10009600 3300014326 Bacteria 6941
74 Ga0157380_10098587 3300014326 Bacteria 2428
75 Ga0157380_10254532 3300014326 Bacteria 1591
76 Ga0157377_10587803 3300014745 Bacteria 792
77 Ga0157377_10965864 3300014745 Bacteria 642
78 Ga0163161_10574223 3300017792 Bacteria 927
79 Ga0163161_10798126 3300017792 Bacteria 793
80 Ga0163161_11310045 3300017792 Bacteria 630
81 Ga0197907_11326972 3300020069 Bacteria 849
82 Ga0206356_10899866 3300020070 Bacteria 825
83 Ga0206354_10230810 3300020081 Bacteria 5414
84 Ga0206353_10297649 3300020082 Bacteria 3213
85 Ga0224712_10187029 3300022467 Bacteria 936
86 Ga0209677_101020 3300025253 Bacteria 13368
87 Ga0209051_1000188 3300025303 Bacteria 109245
88 Ga0207692_10000644 3300025898 Bacteria 12279
89 Ga0207692_10906312 3300025898 Bacteria 580
90 Ga0207688_10077207 3300025901 Bacteria 1898
91 Ga0207688_10083215 3300025901 Bacteria 1830
92 Ga0207688_10282775 3300025901 Bacteria 1011
93 Ga0207643_10070628 3300025908 Bacteria 2009
94 Ga0207671_10112816 3300025914 Bacteria 2070
95 Ga0207662_10443361 3300025918 Bacteria 887
96 Ga0207681_10280940 3300025923 Bacteria 1311
97 Ga0207681_11308742 3300025923 Bacteria 609
98 Ga0207659_10322453 3300025926 Bacteria 1275
99 Ga0207687_11397437 3300025927 Bacteria 601
100 Ga0207644_11475788 3300025931 Bacteria 571
101 Ga0207709_10349406 3300025935 Bacteria 1116
102 Ga0207670_10294774 3300025936 Bacteria 1268
103 Ga0207704_11766197 3300025938 Bacteria 532
104 Ga0207689_11209185 3300025942 Bacteria 636
105 Ga0207661_10294346 3300025944 Bacteria 1454
106 Ga0207661_10553341 3300025944 Bacteria 1054
107 Ga0207651_12094028 3300025960 Bacteria 508
108 Ga0207712_10752511 3300025961 Bacteria 854
109 Ga0207668_10163611 3300025972 Bacteria 1737
110 Ga0207640_12038913 3300025981 Bacteria 520
111 Ga0207658_11414021 3300025986 Bacteria 636
112 Ga0207677_10777140 3300026023 Bacteria 856
113 Ga0207678_10357443 3300026067 Bacteria 1260
114 Ga0207678_10425852 3300026067 Bacteria 1151
115 Ga0207678_11252716 3300026067 Bacteria 656
116 Ga0207702_10187815 3300026078 Bacteria 1907
117 Ga0207702_12013371 3300026078 Bacteria 568
118 Ga0207641_11487350 3300026088 Bacteria 679
119 Ga0207674_10145980 3300026116 Bacteria 2324
120 Ga0207675_101814769 3300026118 Bacteria 629
121 Ga0207675_101845982 3300026118 Bacteria 623
122 Ga0207683_10043545 3300026121 Bacteria 3923
123 Ga0207683_10456758 3300026121 Bacteria 1178
124 Ga0207683_10492364 3300026121 Bacteria 1132
125 Ga0207683_11639833 3300026121 Bacteria 592
126 Ga0207698_10505376 3300026142 Bacteria 1177
127 Ga0268266_10631722 3300028379 Bacteria 1030
128 Ga0268266_10951295 3300028379 Bacteria 831
129 Ga0307517_10605079 3300028786 Bacteria 539
130 Ga0307515_10697486 3300028794 Bacteria 631
131 Ga0316177_1135202 3300030731 Bacteria 4111
132 Ga0316176_1037009 3300030732 Bacteria 2264
133 Ga0314311_1114402 3300030733 Bacteria 4068
134 Ga0314311_1151910 3300030733 Bacteria 724
135 Ga0316179_1009867 3300030734 Bacteria 691
136 Ga0316178_1062044 3300030735 Bacteria 547
137 Ga0316180_1101484 3300030736 Bacteria 1755
138 Ga0307509_10160816 3300031507 Bacteria 2144
139 Ga0307408_100919728 3300031548 Bacteria 802
140 Ga0307408_101283776 3300031548 Bacteria 686
141 Ga0307514_10002953 3300031649 Bacteria 16894
142 Ga0307405_10835242 3300031731 Bacteria 774
143 Ga0307413_10318024 3300031824 Bacteria 1188
144 Ga0307410_10253219 3300031852 Bacteria 1370
145 Ga0307410_10517922 3300031852 Bacteria 984
146 Ga0307410_12120109 3300031852 Bacteria 503
147 Ga0307406_10383320 3300031901 Bacteria 1109
148 Ga0307406_10408249 3300031901 Bacteria 1079
149 Ga0307412_10734334 3300031911 Bacteria 851
150 Ga0307412_10855411 3300031911 Bacteria 794
151 Ga0307409_100357794 3300031995 Bacteria 1380
152 Ga0307409_100434596 3300031995 Bacteria 1263
153 Ga0307409_100652292 3300031995 Bacteria 1046
154 Ga0307416_100476081 3300032002 Bacteria 1308
155 Ga0307414_10474663 3300032004 Bacteria 1102
156 Ga0307415_100286694 3300032126 Bacteria 1357
157 Ga0307415_100345877 3300032126 Bacteria 1250
158 Ga0307415_100391205 3300032126 Bacteria 1184
159 Ga0307415_101819316 3300032126 Bacteria 590
160 Ga0395899_0047063 3300037312 Bacteria 3211
161 Ga0395898_0048842 3300037466 Bacteria 4148
162 Ga0395898_1685805 3300037466 Bacteria 557
163 Ga0395901_0353541 3300038443 Bacteria 1516
164 Ga0439466_0165489 3300041411 Bacteria 676
165 Ga0439465_0081632 3300041413 Bacteria 1097
166 Ga0439465_0083716 3300041413 Bacteria 1085
167 Ga0451789_0902884 3300041443 Bacteria 607
168 Ga0451791_0267933 3300041451 Bacteria 501
169 Ga0451791_0402975 3300041451 Bacteria 528
170 Ga0451793_0258207 3300041452 Bacteria 9993
171 Ga0451793_0491975 3300041452 Bacteria 620
172 Ga0451793_0882823 3300041452 Bacteria 605
173 Ga0451793_1498740 3300041452 Bacteria 601
174 Ga0451797_0889664 3300041453 Bacteria 3005
175 Ga0451795_0552328 3300041456 Bacteria 538
176 Ga0451800_0275029 3300041459 Bacteria 549
177 Ga0451807_0608873 3300041486 Bacteria 613
178 Ga0451807_0803043 3300041486 Bacteria 2211
179 Ga0451833_1126807 3300041491 Bacteria 635
180 Ga0451837_0897436 3300041494 Bacteria 562
181 Ga0451839_0027335 3300041496 Bacteria 518
182 Ga0451841_1035660 3300041498 Bacteria 3949
183 Ga0451855_1350504 3300041511 Bacteria 1353
184 Ga0451853_0872018 3300041512 Bacteria 804
185 Ga0451853_0943680 3300041512 Bacteria 542
186 Ga0451853_1850629 3300041512 Bacteria 630
187 Ga0451853_2302732 3300041512 Bacteria 912
188 Ga0451853_2799614 3300041512 Bacteria 2700
189 Ga0451853_4004348 3300041512 Bacteria 606
190 Ga0451853_4101797 3300041512 Bacteria 701
191 Ga0439448_0044862 3300042005 Bacteria 1438
192 Ga0450907_028137 3300042146 Bacteria 953
193 Ga0466972_0005228 3300044658 Bacteria 6496
194 Ga0466965_0002422 3300044683 Bacteria 7920
195 Ga0466965_0053852 3300044683 Bacteria 2000
196 Ga0466965_0062271 3300044683 Bacteria 1866
197 Ga0466968_0011207 3300044735 Bacteria 3493
198 Ga0466970_0850876 3300044765 Bacteria 535
199 Ga0466960_0001445 3300044901 Bacteria 8669
200 Ga0466967_0067981 3300045976 Bacteria 3180
201 Ga0495653_0174049 3300046463 Bacteria 1483
202 Ga0495650_0286364 3300046471 Bacteria 554
203 Ga0495580_0052251 3300046472 Bacteria 2886
204 Ga0495608_0272205 3300046511 Bacteria 1053
205 Ga0495645_0362875 3300046543 Bacteria 931
206 Ga0495633_0182889 3300046558 Bacteria 965
207 Ga0495667_0617686 3300046559 Bacteria 675
208 Ga0495635_0236318 3300046663 Bacteria 1234
209 Ga0495581_0336831 3300047315 Bacteria 881
210 Ga0495674_0384745 3300047319 Bacteria 1135
211 Ga0495672_0008524 3300047320 Bacteria 7549
212 Ga0496100_0443849 3300048903 Bacteria 994
213 Ga0496101_0423226 3300048904 Bacteria 1050
214 Ga0496101_0781976 3300048904 Bacteria 753
215 Ga0496102_0196929 3300048905 Bacteria 1899
216 Ga0496102_0296589 3300048905 Bacteria 1524
217 Ga0496102_0451276 3300048905 Bacteria 1206
218 Ga0496103_0107025 3300048906 Bacteria 1774
219 Ga0496104_0017126 3300048907 Bacteria 6593
220 Ga0496104_0205689 3300048907 Bacteria 1880
221 Ga0496104_0282137 3300048907 Bacteria 1574
222 Ga0496104_0369451 3300048907 Bacteria 1347
223 Ga0496104_0421896 3300048907 Bacteria 1246
224 Ga0496105_0281364 3300048908 Bacteria 1341
225 Ga0496105_0547480 3300048908 Bacteria 903
226 Ga0496107_0519642 3300048910 Bacteria 883
227 Ga0496108_0005421 3300048911 Bacteria 10312
228 Ga0496108_0078704 3300048911 Bacteria 2791
229 Ga0496108_0084428 3300048911 Bacteria 2695
230 Ga0496108_0267501 3300048911 Bacteria 1488
231 Ga0496108_0526065 3300048911 Bacteria 1032
232 Ga0496108_0949789 3300048911 Bacteria 736
233 Ga0496109_0015642 3300048912 Bacteria 6619
234 Ga0496109_0339721 3300048912 Bacteria 1418
235 Ga0496109_0740371 3300048912 Bacteria 921
236 Ga0496109_0749637 3300048912 Bacteria 914
237 Ga0496110_0208062 3300048913 Bacteria 1778
238 Ga0496110_0809027 3300048913 Bacteria 842
239 Ga0496111_0118024 3300048914 Bacteria 1958
240 Ga0496112_0198487 3300048915 Bacteria 1966
241 Ga0496112_0639841 3300048915 Bacteria 994
242 Ga0496113_0067059 3300048916 Bacteria 2720
243 Ga0496113_0256379 3300048916 Bacteria 1397
244 Ga0496114_0015225 3300048917 Bacteria 6183
245 Ga0496114_0160456 3300048917 Bacteria 1954
246 Ga0496114_0266368 3300048917 Bacteria 1509
247 Ga0496114_0987218 3300048917 Bacteria 725
248 Ga0496115_0147196 3300048918 Bacteria 1944
249 Ga0496117_0000367 3300048920 Bacteria 78467
250 Ga0496117_0274198 3300048920 Bacteria 907
251 Ga0496122_0065334 3300048925 Bacteria 2639
252 Ga0496126_0165426 3300048929 Bacteria 1888
253 Ga0496126_0457786 3300048929 Bacteria 1026
254 Ga0501034_0047114 3300049571 Bacteria 4354
255 Ga0501034_0687208 3300049571 Bacteria 923
256 Ga0501037_1144899 3300049573 Bacteria 503
257 Ga0501038_0464147 3300049574 Bacteria 972
258 Ga0501047_0107068 3300049581 Bacteria 2677
259 Ga0501067_0214237 3300049583 Bacteria 1073
260 Ga0501072_0015082 3300049588 Bacteria 5926
261 Ga0501073_0037849 3300049589 Bacteria 3424
262 Ga0501075_0433790 3300049591 Bacteria 1002
263 nmdc:mga00v17_838581_c1 3300050491 Bacteria 584
264 nmdc:mga0yw44_140894_c1 3300050492 Bacteria 1567
265 Ga0500635_0000505 3300053080 Bacteria 10779
266 Ga0495595_0203748 3300053084 Bacteria 985
267 Ga0500628_199734 3300053129 Bacteria 576
268 Ga0500559_0000132 3300053136 Bacteria 57521
269 Ga0500568_0001543 3300053139 Bacteria 14630
270 Ga0500568_0068486 3300053139 Bacteria 1362
271 Ga0500568_0071278 3300053139 Bacteria 1330
272 Ga0500573_0000024 3300053140 Bacteria 151713
273 Ga0500573_0001129 3300053140 Bacteria 12419
274 Ga0500573_0164140 3300053140 Bacteria 1207
275 Ga0500573_0261860 3300053140 Bacteria 885
276 Ga0500577_0109982 3300053142 Bacteria 1136
277 Ga0500620_214193 3300053155 Bacteria 653
278 2643994906 2643221597 Bacteria 3347721
279 2723640889 2721755702 Bacteria 4373124
280 2738695689 2738541272 Bacteria 6848551
281 2739326167 2738543027 Bacteria 6409078
282 2808903489 2808606372 Bacteria 4649509
283 2837271372 2837268691 Bacteria 7850704
284 2852643700 2852643534 Bacteria 3013378
285 2857739391 2857737099 Bacteria 3104305
286 2919443944 2919443155 Bacteria 4072969
287 2935410363 2935409751 Bacteria 4179611
288 8054109503 8054107350 Bacteria 5022511
289 8057347255 8057345674 Bacteria 4160394
290 Ga0496120_0425508
291 JGI24740J21852_10003560
292 Ga0055540_1000100
293 Ga0070658_10078401
294 Ga0070683_101978806
295 Ga0070670_101524174
296 Ga0070670_101961821
297 Ga0070677_10082933
298 Ga0070682_100961121
299 Ga0070660_101677159
300 Ga0070689_100425562
301 Ga0070692_11111728
302 Ga0070669_100196250
303 Ga0070675_100123837
304 Ga0070675_100529679
305 Ga0070674_100547314
306 Ga0070710_10000074
307 Ga0070710_10014710
308 Ga0070663_100387379
309 Ga0070663_100848629
310 Ga0070684_100339602
311 Ga0070672_100314985
312 Ga0070672_100976804
313 Ga0070672_101144822
314 Ga0070693_100358378
315 Ga0070665_100393510
316 Ga0068857_100254861
317 Ga0068856_100577654
318 Ga0068856_101885540
319 Ga0068852_100564275
320 Ga0068852_101920223
321 Ga0068851_10243869
322 Ga0068863_102029834
323 Ga0075365_11139668
324 Ga0075364_10009029
325 Ga0075432_10507807
326 Ga0105244_10285340
327 Ga0111539_11584900
328 Ga0111539_12658292
329 Ga0105245_10086247
330 Ga0105245_10181810
331 Ga0105245_11545459
332 Ga0105243_10426502
333 Ga0105243_11288139
334 Ga0105248_10358712
335 Ga0105237_10148694
336 Ga0105239_10085526
337 Ga0105239_10705078
338 Ga0105246_10331496
339 Ga0157371_10968470
340 Ga0157370_10096928
341 Ga0157370_10247371
342 Ga0157370_11634202
343 Ga0157370_11806491
344 Ga0157369_10007159
345 Ga0157369_10179062
346 Ga0157369_10571651
347 Ga0157369_10893146
348 Ga0157374_11513446
349 Ga0163162_10247712
350 Ga0163162_10744886
351 Ga0157372_10394795
352 Ga0157372_10420876
353 Ga0157372_10699617
354 Ga0157372_12165314
355 Ga0157375_10023251
356 Ga0157375_11029274
357 Ga0163163_10286408
358 Ga0163163_10488902
359 Ga0163163_10490665
360 Ga0163163_10960074
361 Ga0163163_12331934
362 Ga0157380_10009600
363 Ga0157380_10098587
364 Ga0157380_10254532
365 Ga0157377_10587803
366 Ga0157377_10965864
367 Ga0163161_10574223
368 Ga0163161_10798126
369 Ga0163161_11310045
370 Ga0197907_11326972
371 Ga0206356_10899866
372 Ga0206354_10230810
373 Ga0206353_10297649
374 Ga0224712_10187029
375 Ga0209677_101020
376 Ga0209051_1000188
377 Ga0207692_10000644
378 Ga0207692_10906312
379 Ga0207688_10077207
380 Ga0207688_10083215
381 Ga0207688_10282775
382 Ga0207643_10070628
383 Ga0207671_10112816
384 Ga0207662_10443361
385 Ga0207681_10280940
386 Ga0207681_11308742
387 Ga0207659_10322453
388 Ga0207687_11397437
389 Ga0207644_11475788
390 Ga0207709_10349406
391 Ga0207670_10294774
392 Ga0207704_11766197
393 Ga0207689_11209185
394 Ga0207661_10294346
395 Ga0207661_10553341
396 Ga0207651_12094028
397 Ga0207712_10752511
398 Ga0207668_10163611
399 Ga0207640_12038913
400 Ga0207658_11414021
401 Ga0207677_10777140
402 Ga0207678_10357443
403 Ga0207678_10425852
404 Ga0207678_11252716
405 Ga0207702_10187815
406 Ga0207702_12013371
407 Ga0207641_11487350
408 Ga0207674_10145980
409 Ga0207675_101814769
410 Ga0207675_101845982
411 Ga0207683_10043545
412 Ga0207683_10456758
413 Ga0207683_10492364
414 Ga0207683_11639833
415 Ga0207698_10505376
416 Ga0268266_10631722
417 Ga0268266_10951295
418 Ga0307517_10605079
419 Ga0307515_10697486
420 Ga0316177_1135202
421 Ga0316176_1037009
422 Ga0314311_1114402
423 Ga0314311_1151910
424 Ga0316179_1009867
425 Ga0316178_1062044
426 Ga0316180_1101484
427 Ga0307509_10160816
428 Ga0307408_100919728
429 Ga0307408_101283776
430 Ga0307514_10002953
431 Ga0307405_10835242
432 Ga0307413_10318024
433 Ga0307410_10253219
434 Ga0307410_10517922
435 Ga0307410_12120109
436 Ga0307406_10383320
437 Ga0307406_10408249
438 Ga0307412_10734334
439 Ga0307412_10855411
440 Ga0307409_100357794
441 Ga0307409_100434596
442 Ga0307409_100652292
443 Ga0307416_100476081
444 Ga0307414_10474663
445 Ga0307415_100286694
446 Ga0307415_100345877
447 Ga0307415_100391205
448 Ga0307415_101819316
449 Ga0395899_0047063
450 Ga0395898_0048842
451 Ga0395898_1685805
452 Ga0395901_0353541
453 Ga0439466_0165489
454 Ga0439465_0081632
455 Ga0439465_0083716
456 Ga0451789_0902884
457 Ga0451791_0267933
458 Ga0451791_0402975
459 Ga0451793_0258207
460 Ga0451793_0491975
461 Ga0451793_0882823
462 Ga0451793_1498740
463 Ga0451797_0889664
464 Ga0451795_0552328
465 Ga0451800_0275029
466 Ga0451807_0608873
467 Ga0451807_0803043
468 Ga0451833_1126807
469 Ga0451837_0897436
470 Ga0451839_0027335
471 Ga0451841_1035660
472 Ga0451855_1350504
473 Ga0451853_0872018
474 Ga0451853_0943680
475 Ga0451853_1850629
476 Ga0451853_2302732
477 Ga0451853_2799614
478 Ga0451853_4004348
479 Ga0451853_4101797
480 Ga0439448_0044862
481 Ga0450907_028137
482 Ga0466972_0005228
483 Ga0466965_0002422
484 Ga0466965_0053852
485 Ga0466965_0062271
486 Ga0466968_0011207
487 Ga0466970_0850876
488 Ga0466960_0001445
489 Ga0466967_0067981
490 Ga0495653_0174049
491 Ga0495650_0286364
492 Ga0495580_0052251
493 Ga0495608_0272205
494 Ga0495645_0362875
495 Ga0495633_0182889
496 Ga0495667_0617686
497 Ga0495635_0236318
498 Ga0495581_0336831
499 Ga0495674_0384745
500 Ga0495672_0008524
501 Ga0496100_0443849
502 Ga0496101_0423226
503 Ga0496101_0781976
504 Ga0496102_0196929
505 Ga0496102_0296589
506 Ga0496102_0451276
507 Ga0496103_0107025
508 Ga0496104_0017126
509 Ga0496104_0205689
510 Ga0496104_0282137
511 Ga0496104_0369451
512 Ga0496104_0421896
513 Ga0496105_0281364
514 Ga0496105_0547480
515 Ga0496107_0519642
516 Ga0496108_0005421
517 Ga0496108_0078704
518 Ga0496108_0084428
519 Ga0496108_0267501
520 Ga0496108_0526065
521 Ga0496108_0949789
522 Ga0496109_0015642
523 Ga0496109_0339721
524 Ga0496109_0740371
525 Ga0496109_0749637
526 Ga0496110_0208062
527 Ga0496110_0809027
528 Ga0496111_0118024
529 Ga0496112_0198487
530 Ga0496112_0639841
531 Ga0496113_0067059
532 Ga0496113_0256379
533 Ga0496114_0015225
534 Ga0496114_0160456
535 Ga0496114_0266368
536 Ga0496114_0987218
537 Ga0496115_0147196
538 Ga0496117_0000367
539 Ga0496117_0274198
540 Ga0496122_0065334
541 Ga0496126_0165426
542 Ga0496126_0457786
543 Ga0501034_0047114
544 Ga0501034_0687208
545 Ga0501037_1144899
546 Ga0501038_0464147
547 Ga0501047_0107068
548 Ga0501067_0214237
549 Ga0501072_0015082
550 Ga0501073_0037849
551 Ga0501075_0433790
552 nmdc:mga00v17_838581_c1
553 nmdc:mga0yw44_140894_c1
554 Ga0500635_0000505
555 Ga0495595_0203748
556 Ga0500628_199734
557 Ga0500559_0000132
558 Ga0500568_0001543
559 Ga0500568_0068486
560 Ga0500568_0071278
561 Ga0500573_0000024
562 Ga0500573_0001129
563 Ga0500573_0164140
564 Ga0500573_0261860
565 Ga0500577_0109982
566 Ga0500620_214193
567 2643994906
568 2723640889
569 2738695689
570 2739326167
571 2808903489
572 2837271372
573 2852643700
574 2857739391
575 2919443944
576 2935410363
577 8054109503
578 8057347255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

15

61

0.98

PF12840

HTH_20

Helix-turn-helix domain

13

62

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqg-assembly1.cif.gz_B arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9499 5 104
2oqg-assembly1.cif.gz_D arsr-like transcriptional regulator from rhodococcus sp. rha1 0.9438 5 101
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9208 5 86
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9203 15 72
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9154 8 81
ID Description Score Start End Superfamily
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9765 19 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9573 14 70 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9556 12 76 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.955 5 83 1.10.10.10
2oqgC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9459 5 102 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X7Y0X6-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9886 4 88 GO:0003700
AF-T3DBA9-F1-model_v4 deleted 0.9881 5 86
AF-A0A7X8D0U1-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9861 4 87 GO:0003700
AF-A0A847N997-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9858 4 87 GO:0003700
AF-A0A7C6M866-F1-model_v4 deleted 0.9857 4 88

Map