F389310

General Info

Members Datasets Scaffolds Average Seq Length
289 135 578 186

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0185590|Ga0395899_0185590_668_1315
Length 215
Sequence LAISIRHPAGPSYGRFHLGERLWHKSGVNSFRKGRRAPPPLDQAKLEELALRYVGKYATTRAKLRSYLARKVRERGWQADREPDFEGLANRFAELGYIDDASYALGQSRSLSARGFGKRRLADKLRVAGVDEADSGAAHAHADGEAVTAALRLAERRRIGPFAAAQADREQQRKWIAAMIRAGHSFALARAIAAIPPGAAVDFSELRNRAGLSED

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
110 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
111 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
112 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 3.46
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 4.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0185590 3300037312 Bacteria 1457
2 JGI24741J21665_1002408 3300001915 Bacteria 4872
3 JGI24740J21852_10000772 3300001979 Bacteria 14030
4 JGI24739J22299_10000789 3300001989 Bacteria 11558
5 JGI24737J22298_10005717 3300001990 Bacteria 4281
6 JGI24737J22298_10009140 3300001990 Bacteria 3302
7 JGI24735J21928_10001231 3300002067 Bacteria 9095
8 Ga0070658_10000360 3300005327 Bacteria 39619
9 Ga0070658_10011538 3300005327 Bacteria 7087
10 Ga0070676_10344382 3300005328 Bacteria 1023
11 Ga0070683_100007904 3300005329 Bacteria 9016
12 Ga0070683_100011780 3300005329 Bacteria 7573
13 Ga0070683_100049812 3300005329 Bacteria 3875
14 Ga0070690_100113304 3300005330 Bacteria 1812
15 Ga0070670_100101551 3300005331 Bacteria 2476
16 Ga0070670_100133926 3300005331 Bacteria 2141
17 Ga0070666_10086038 3300005335 Bacteria 2154
18 Ga0070680_100023849 3300005336 Bacteria 4884
19 Ga0070680_100069249 3300005336 Bacteria 2897
20 Ga0070682_100002715 3300005337 Bacteria 9800
21 Ga0070682_100110916 3300005337 Bacteria 1828
22 Ga0068868_100452872 3300005338 Bacteria 1117
23 Ga0070660_100000075 3300005339 Bacteria 59407
24 Ga0070660_100111311 3300005339 Bacteria 2179
25 Ga0070661_100000273 3300005344 Bacteria 41798
26 Ga0070661_100039016 3300005344 Bacteria 3459
27 Ga0070661_100044278 3300005344 Bacteria 3251
28 Ga0070661_100068537 3300005344 Bacteria 2607
29 Ga0070661_100072944 3300005344 Bacteria 2527
30 Ga0070692_10001697 3300005345 Bacteria 8172
31 Ga0070671_100021622 3300005355 Bacteria 5254
32 Ga0070673_100062104 3300005364 Bacteria 2967
33 Ga0070673_100755380 3300005364 Bacteria 896
34 Ga0070659_100000084 3300005366 Bacteria 71138
35 Ga0070659_100017835 3300005366 Bacteria 5347
36 Ga0070659_100027664 3300005366 Bacteria 4371
37 Ga0070659_100450718 3300005366 Bacteria 1091
38 Ga0070667_100007596 3300005367 Bacteria 8991
39 Ga0070667_100045565 3300005367 Bacteria 3688
40 Ga0070694_100025441 3300005444 Bacteria 3829
41 Ga0070663_100014657 3300005455 Bacteria 5037
42 Ga0070662_100000058 3300005457 Bacteria 59818
43 Ga0070662_100120394 3300005457 Bacteria 2011
44 Ga0070662_100277858 3300005457 Bacteria 1354
45 Ga0070681_10249938 3300005458 Bacteria 1686
46 Ga0070681_10766188 3300005458 Unclassified 882
47 Ga0070684_100113017 3300005535 Bacteria 2437
48 Ga0070684_100242168 3300005535 Bacteria 1648
49 Ga0070684_100344133 3300005535 Bacteria 1371
50 Ga0068853_100000223 3300005539 Bacteria 40165
51 Ga0068853_100004484 3300005539 Bacteria 10829
52 Ga0068853_100054987 3300005539 Bacteria 3430
53 Ga0068853_100090188 3300005539 Bacteria 2694
54 Ga0070672_100246952 3300005543 Bacteria 1502
55 Ga0070695_100019213 3300005545 Bacteria 4157
56 Ga0070693_100002223 3300005547 Bacteria 8916
57 Ga0070665_100004855 3300005548 Bacteria 13970
58 Ga0070665_100012634 3300005548 Bacteria 8502
59 Ga0068855_100004348 3300005563 Bacteria 17327
60 Ga0068855_100008388 3300005563 Bacteria 12494
61 Ga0068855_100285872 3300005563 Bacteria 1830
62 Ga0070664_100000032 3300005564 Bacteria 88298
63 Ga0070664_100001145 3300005564 Bacteria 21000
64 Ga0070664_100036854 3300005564 Bacteria 4109
65 Ga0070664_100163987 3300005564 Bacteria 1968
66 Ga0068857_100009594 3300005577 Bacteria 8410
67 Ga0068857_100047564 3300005577 Bacteria 3808
68 Ga0068854_100022118 3300005578 Bacteria 4325
69 Ga0068854_100066988 3300005578 Bacteria 2615
70 Ga0068854_100120625 3300005578 Bacteria 1990
71 Ga0068854_100455994 3300005578 Bacteria 1069
72 Ga0068856_100000161 3300005614 Bacteria 69696
73 Ga0068852_100002629 3300005616 Bacteria 12411
74 Ga0068852_100013368 3300005616 Bacteria 6283
75 Ga0068852_100043711 3300005616 Bacteria 3801
76 Ga0068859_100266716 3300005617 Bacteria 1804
77 Ga0068864_100042528 3300005618 Bacteria 3888
78 Ga0068864_100080064 3300005618 Bacteria 2862
79 Ga0068864_101095406 3300005618 Unclassified 793
80 Ga0068858_100049615 3300005842 Bacteria 3887
81 Ga0068858_100437622 3300005842 Bacteria 1259
82 Ga0068862_100091780 3300005844 Bacteria 2646
83 Ga0097621_100098174 3300006237 Bacteria 2460
84 Ga0097620_100266740 3300006931 Bacteria 1804
85 Ga0105240_10029253 3300009093 Bacteria 7183
86 Ga0111539_10085774 3300009094 Bacteria 3700
87 Ga0105241_10094108 3300009174 Bacteria 2369
88 Ga0105241_10242183 3300009174 Bacteria 1525
89 Ga0105248_10000223 3300009177 Bacteria 65010
90 Ga0105248_10000678 3300009177 Bacteria 38605
91 Ga0105248_10407546 3300009177 Bacteria 1531
92 Ga0105238_10083731 3300009551 Bacteria 3179
93 Ga0157373_10010304 3300013100 Bacteria 6886
94 Ga0157373_10051136 3300013100 Bacteria 2943
95 Ga0157371_10001103 3300013102 Bacteria 29269
96 Ga0157371_10031859 3300013102 Bacteria 3796
97 Ga0157371_10103658 3300013102 Bacteria 2018
98 Ga0157370_10001094 3300013104 Bacteria 33972
99 Ga0157370_10108091 3300013104 Bacteria 2601
100 Ga0157369_10042136 3300013105 Bacteria 4981
101 Ga0157369_10099548 3300013105 Bacteria 3099
102 Ga0157369_10487779 3300013105 Bacteria 1275
103 Ga0157369_10861331 3300013105 Bacteria 930
104 Ga0163162_10122642 3300013306 Bacteria 2704
105 Ga0157372_10016489 3300013307 Bacteria 7928
106 Ga0163163_10000567 3300014325 Bacteria 32441
107 Ga0157379_10143464 3300014968 Unclassified 2153
108 Ga0157376_11187054 3300014969 Bacteria 791
109 Ga0207656_10032829 3300025321 Bacteria 2158
110 Ga0207688_10249715 3300025901 Unclassified 1074
111 Ga0207647_10012918 3300025904 Bacteria 5803
112 Ga0207645_10010343 3300025907 Bacteria 6404
113 Ga0207705_10000918 3300025909 Bacteria 24102
114 Ga0207705_10015789 3300025909 Bacteria 5422
115 Ga0207707_10006776 3300025912 Bacteria 9996
116 Ga0207707_10034897 3300025912 Bacteria 4400
117 Ga0207707_10192196 3300025912 Bacteria 1781
118 Ga0207707_10349986 3300025912 Bacteria 1273
119 Ga0207695_10038486 3300025913 Bacteria 5148
120 Ga0207660_10027635 3300025917 Bacteria 3874
121 Ga0207660_10048277 3300025917 Bacteria 3012
122 Ga0207657_10000164 3300025919 Bacteria 67184
123 Ga0207657_10007625 3300025919 Bacteria 11074
124 Ga0207657_10010138 3300025919 Bacteria 9417
125 Ga0207657_10111976 3300025919 Bacteria 2253
126 Ga0207649_10000580 3300025920 Bacteria 25006
127 Ga0207649_10002698 3300025920 Bacteria 9835
128 Ga0207649_10101649 3300025920 Bacteria 1904
129 Ga0207652_10002403 3300025921 Bacteria 15807
130 Ga0207652_10169293 3300025921 Bacteria 1960
131 Ga0207694_10000992 3300025924 Bacteria 24842
132 Ga0207650_10091190 3300025925 Bacteria 2328
133 Ga0207650_10156304 3300025925 Bacteria 1803
134 Ga0207644_10005888 3300025931 Bacteria 7995
135 Ga0207644_10022111 3300025931 Bacteria 4341
136 Ga0207690_10000800 3300025932 Bacteria 20216
137 Ga0207690_10003062 3300025932 Bacteria 10072
138 Ga0207690_10038633 3300025932 Bacteria 3108
139 Ga0207690_10073124 3300025932 Bacteria 2370
140 Ga0207690_10144284 3300025932 Bacteria 1758
141 Ga0207706_10000196 3300025933 Bacteria 67184
142 Ga0207706_10003899 3300025933 Bacteria 14158
143 Ga0207706_10027171 3300025933 Bacteria 5119
144 Ga0207706_10051945 3300025933 Bacteria 3619
145 Ga0207711_10000123 3300025941 Bacteria 80861
146 Ga0207711_10000698 3300025941 Bacteria 33120
147 Ga0207711_10054096 3300025941 Bacteria 3443
148 Ga0207661_10007562 3300025944 Bacteria 7728
149 Ga0207661_10032800 3300025944 Bacteria 4027
150 Ga0207679_10001145 3300025945 Bacteria 16891
151 Ga0207679_10007849 3300025945 Bacteria 6782
152 Ga0207679_10054713 3300025945 Bacteria 2939
153 Ga0207679_10110728 3300025945 Bacteria 2167
154 Ga0207679_10346558 3300025945 Bacteria 1293
155 Ga0207679_10580682 3300025945 Unclassified 1008
156 Ga0207667_10001975 3300025949 Bacteria 25689
157 Ga0207667_10074000 3300025949 Bacteria 3539
158 Ga0207667_10077053 3300025949 Bacteria 3458
159 Ga0207667_10105298 3300025949 Bacteria 2910
160 Ga0207651_10197171 3300025960 Bacteria 1610
161 Ga0207640_10051772 3300025981 Bacteria 2671
162 Ga0207640_10100686 3300025981 Bacteria 2025
163 Ga0207658_10010805 3300025986 Bacteria 6211
164 Ga0207658_10237724 3300025986 Bacteria 1541
165 Ga0207677_10095572 3300026023 Bacteria 2172
166 Ga0207703_10111613 3300026035 Bacteria 2334
167 Ga0207639_10001229 3300026041 Bacteria 17375
168 Ga0207639_10001939 3300026041 Bacteria 13893
169 Ga0207639_10002338 3300026041 Bacteria 12738
170 Ga0207639_10005669 3300026041 Bacteria 8449
171 Ga0207639_10054215 3300026041 Bacteria 3064
172 Ga0207639_10057352 3300026041 Bacteria 2990
173 Ga0207639_10544248 3300026041 Bacteria 1065
174 Ga0207678_10000864 3300026067 Bacteria 27765
175 Ga0207678_10009242 3300026067 Bacteria 8674
176 Ga0207678_10069929 3300026067 Bacteria 3010
177 Ga0207702_10000435 3300026078 Bacteria 47593
178 Ga0207648_10014059 3300026089 Bacteria 7408
179 Ga0207676_10001817 3300026095 Bacteria 15638
180 Ga0207676_10034636 3300026095 Bacteria 3824
181 Ga0207674_10001518 3300026116 Bacteria 29932
182 Ga0207674_10003272 3300026116 Bacteria 19933
183 Ga0207674_10051166 3300026116 Bacteria 4216
184 Ga0207698_10003125 3300026142 Bacteria 9926
185 Ga0207698_10068674 3300026142 Bacteria 2799
186 Ga0207698_10083604 3300026142 Bacteria 2584
187 Ga0207698_10150951 3300026142 Bacteria 2016
188 Ga0207428_10218075 3300027907 Bacteria 1431
189 Ga0268266_10008238 3300028379 Bacteria 9288
190 Ga0268266_10014311 3300028379 Bacteria 6823
191 Ga0268265_10108713 3300028380 Bacteria 2258
192 Ga0307405_10006118 3300031731 Bacteria 5892
193 Ga0307413_10132275 3300031824 Bacteria 1710
194 Ga0307413_11034831 3300031824 Bacteria 706
195 Ga0307410_10087547 3300031852 Bacteria 2203
196 Ga0307410_10141544 3300031852 Bacteria 1780
197 Ga0307410_10575751 3300031852 Unclassified 936
198 Ga0307406_10110677 3300031901 Bacteria 1890
199 Ga0307406_10136832 3300031901 Bacteria 1728
200 Ga0307407_10054987 3300031903 Bacteria 2298
201 Ga0307409_100161499 3300031995 Bacteria 1960
202 Ga0307409_100383836 3300031995 Bacteria 1336
203 Ga0307409_100532496 3300031995 Bacteria 1150
204 Ga0307416_100080427 3300032002 Bacteria 2751
205 Ga0307416_100732424 3300032002 Bacteria 1080
206 Ga0307414_10263397 3300032004 Bacteria 1440
207 Ga0307414_11298242 3300032004 Bacteria 675
208 Ga0307411_10665784 3300032005 Unclassified 903
209 Ga0373949_0121456 3300035090 Bacteria 734
210 Ga0373931_0029315 3300035691 Bacteria 2824
211 Ga0395899_0004100 3300037312 Bacteria 11473
212 Ga0395899_0162560 3300037312 Bacteria 1576
213 Ga0395899_0167425 3300037312 Bacteria 1549
214 Ga0395900_0010699 3300037418 Bacteria 9383
215 Ga0395900_0031534 3300037418 Bacteria 5447
216 Ga0395900_0102777 3300037418 Bacteria 2935
217 Ga0395900_0217246 3300037418 Bacteria 1929
218 Ga0395900_0295483 3300037418 Bacteria 1607
219 Ga0395898_0011614 3300037466 Bacteria 9140
220 Ga0395898_0163056 3300037466 Bacteria 2132
221 Ga0395898_0917695 3300037466 Bacteria 813
222 Ga0395905_0094638 3300037471 Bacteria 2802
223 Ga0395905_0223150 3300037471 Bacteria 1763
224 Ga0395905_0286498 3300037471 Unclassified 1534
225 Ga0395905_0296075 3300037471 Bacteria 1505
226 Ga0395905_0432133 3300037471 Bacteria 1213
227 Ga0395905_0505673 3300037471 Bacteria 1108
228 Ga0395905_0906365 3300037471 Bacteria 784
229 Ga0395905_1205267 3300037471 Unclassified 660
230 Ga0395901_0001546 3300038443 Bacteria 23839
231 Ga0395901_0525486 3300038443 Bacteria 1202
232 Ga0395901_0573025 3300038443 Bacteria 1141
233 Ga0395901_1328317 3300038443 Bacteria 680
234 Ga0450917_000492 3300042120 Bacteria 2982
235 Ga0450890_002096 3300042127 Bacteria 2796
236 Ga0450905_000863 3300042142 Bacteria 3774
237 Ga0450889_000056 3300042144 Bacteria 9945
238 Ga0439458_0024994 3300042157 Bacteria 1399
239 Ga0466969_0001211 3300044656 Bacteria 13930
240 Ga0466969_0043116 3300044656 Unclassified 2249
241 Ga0466969_0060017 3300044656 Bacteria 1849
242 Ga0466966_0030850 3300044684 Bacteria 3477
243 Ga0466961_0020510 3300044693 Bacteria 4254
244 Ga0466961_0036956 3300044693 Bacteria 3134
245 Ga0466961_0098543 3300044693 Bacteria 1843
246 Ga0466963_0001361 3300044694 Bacteria 13074
247 Ga0466963_0004194 3300044694 Bacteria 8351
248 Ga0466963_0006457 3300044694 Bacteria 6937
249 Ga0466963_0007656 3300044694 Bacteria 6448
250 Ga0466963_0045878 3300044694 Bacteria 2879
251 Ga0466963_0052776 3300044694 Bacteria 2698
252 Ga0466963_0062841 3300044694 Bacteria 2484
253 Ga0466963_0129404 3300044694 Bacteria 1743
254 Ga0466964_0025702 3300044706 Bacteria 2301
255 Ga0466964_0169285 3300044706 Bacteria 1027
256 Ga0466957_0003980 3300044842 Bacteria 8169
257 Ga0466957_0004650 3300044842 Bacteria 7669
258 Ga0466957_0074240 3300044842 Bacteria 2108
259 Ga0466957_0178750 3300044842 Bacteria 1385
260 Ga0466957_0227780 3300044842 Unclassified 1233
261 Ga0466957_0273614 3300044842 Unclassified 1128
262 Ga0466959_0182652 3300045049 Bacteria 1466
263 Ga0466958_0002397 3300045836 Bacteria 9389
264 Ga0466958_0003120 3300045836 Bacteria 8520
265 Ga0466967_0012995 3300045976 Bacteria 6406
266 Ga0466967_0050550 3300045976 Bacteria 3641
267 Ga0466967_0056132 3300045976 Bacteria 3471
268 Ga0466967_0056271 3300045976 Bacteria 3467
269 Ga0466967_0086223 3300045976 Bacteria 2844
270 Ga0466967_0358453 3300045976 Bacteria 1412
271 Ga0466967_0393387 3300045976 Bacteria 1347
272 Ga0466967_0601878 3300045976 Bacteria 1085
273 Ga0466967_0631408 3300045976 Bacteria 1058
274 Ga0466967_0786467 3300045976 Unclassified 944
275 Ga0495669_0009081 3300046684 Bacteria 4189
276 Ga0495669_0010265 3300046684 Bacteria 3957
277 Ga0496100_0015490 3300048903 Bacteria 4455
278 Ga0496105_0744233 3300048908 Bacteria 749
279 Ga0496106_0025703 3300048909 Bacteria 4383
280 Ga0496107_0007643 3300048910 Bacteria 7462
281 Ga0496108_0032448 3300048911 Bacteria 4338
282 Ga0496109_0003591 3300048912 Bacteria 12952
283 Ga0496111_0015798 3300048914 Bacteria 5192
284 Ga0496111_0418258 3300048914 Bacteria 990
285 Ga0496112_0002186 3300048915 Bacteria 15560
286 Ga0496113_0002270 3300048916 Bacteria 11090
287 Ga0501073_0246356 3300049589 Bacteria 1234
288 nmdc:mga05p37_706353_c1 3300050507 Bacteria 1119
289 Ga0500616_0000254 3300053153 Bacteria 82664
290 Ga0395899_0185590
291 JGI24741J21665_1002408
292 JGI24740J21852_10000772
293 JGI24739J22299_10000789
294 JGI24737J22298_10005717
295 JGI24737J22298_10009140
296 JGI24735J21928_10001231
297 Ga0070658_10000360
298 Ga0070658_10011538
299 Ga0070676_10344382
300 Ga0070683_100007904
301 Ga0070683_100011780
302 Ga0070683_100049812
303 Ga0070690_100113304
304 Ga0070670_100101551
305 Ga0070670_100133926
306 Ga0070666_10086038
307 Ga0070680_100023849
308 Ga0070680_100069249
309 Ga0070682_100002715
310 Ga0070682_100110916
311 Ga0068868_100452872
312 Ga0070660_100000075
313 Ga0070660_100111311
314 Ga0070661_100000273
315 Ga0070661_100039016
316 Ga0070661_100044278
317 Ga0070661_100068537
318 Ga0070661_100072944
319 Ga0070692_10001697
320 Ga0070671_100021622
321 Ga0070673_100062104
322 Ga0070673_100755380
323 Ga0070659_100000084
324 Ga0070659_100017835
325 Ga0070659_100027664
326 Ga0070659_100450718
327 Ga0070667_100007596
328 Ga0070667_100045565
329 Ga0070694_100025441
330 Ga0070663_100014657
331 Ga0070662_100000058
332 Ga0070662_100120394
333 Ga0070662_100277858
334 Ga0070681_10249938
335 Ga0070681_10766188
336 Ga0070684_100113017
337 Ga0070684_100242168
338 Ga0070684_100344133
339 Ga0068853_100000223
340 Ga0068853_100004484
341 Ga0068853_100054987
342 Ga0068853_100090188
343 Ga0070672_100246952
344 Ga0070695_100019213
345 Ga0070693_100002223
346 Ga0070665_100004855
347 Ga0070665_100012634
348 Ga0068855_100004348
349 Ga0068855_100008388
350 Ga0068855_100285872
351 Ga0070664_100000032
352 Ga0070664_100001145
353 Ga0070664_100036854
354 Ga0070664_100163987
355 Ga0068857_100009594
356 Ga0068857_100047564
357 Ga0068854_100022118
358 Ga0068854_100066988
359 Ga0068854_100120625
360 Ga0068854_100455994
361 Ga0068856_100000161
362 Ga0068852_100002629
363 Ga0068852_100013368
364 Ga0068852_100043711
365 Ga0068859_100266716
366 Ga0068864_100042528
367 Ga0068864_100080064
368 Ga0068864_101095406
369 Ga0068858_100049615
370 Ga0068858_100437622
371 Ga0068862_100091780
372 Ga0097621_100098174
373 Ga0097620_100266740
374 Ga0105240_10029253
375 Ga0111539_10085774
376 Ga0105241_10094108
377 Ga0105241_10242183
378 Ga0105248_10000223
379 Ga0105248_10000678
380 Ga0105248_10407546
381 Ga0105238_10083731
382 Ga0157373_10010304
383 Ga0157373_10051136
384 Ga0157371_10001103
385 Ga0157371_10031859
386 Ga0157371_10103658
387 Ga0157370_10001094
388 Ga0157370_10108091
389 Ga0157369_10042136
390 Ga0157369_10099548
391 Ga0157369_10487779
392 Ga0157369_10861331
393 Ga0163162_10122642
394 Ga0157372_10016489
395 Ga0163163_10000567
396 Ga0157379_10143464
397 Ga0157376_11187054
398 Ga0207656_10032829
399 Ga0207688_10249715
400 Ga0207647_10012918
401 Ga0207645_10010343
402 Ga0207705_10000918
403 Ga0207705_10015789
404 Ga0207707_10006776
405 Ga0207707_10034897
406 Ga0207707_10192196
407 Ga0207707_10349986
408 Ga0207695_10038486
409 Ga0207660_10027635
410 Ga0207660_10048277
411 Ga0207657_10000164
412 Ga0207657_10007625
413 Ga0207657_10010138
414 Ga0207657_10111976
415 Ga0207649_10000580
416 Ga0207649_10002698
417 Ga0207649_10101649
418 Ga0207652_10002403
419 Ga0207652_10169293
420 Ga0207694_10000992
421 Ga0207650_10091190
422 Ga0207650_10156304
423 Ga0207644_10005888
424 Ga0207644_10022111
425 Ga0207690_10000800
426 Ga0207690_10003062
427 Ga0207690_10038633
428 Ga0207690_10073124
429 Ga0207690_10144284
430 Ga0207706_10000196
431 Ga0207706_10003899
432 Ga0207706_10027171
433 Ga0207706_10051945
434 Ga0207711_10000123
435 Ga0207711_10000698
436 Ga0207711_10054096
437 Ga0207661_10007562
438 Ga0207661_10032800
439 Ga0207679_10001145
440 Ga0207679_10007849
441 Ga0207679_10054713
442 Ga0207679_10110728
443 Ga0207679_10346558
444 Ga0207679_10580682
445 Ga0207667_10001975
446 Ga0207667_10074000
447 Ga0207667_10077053
448 Ga0207667_10105298
449 Ga0207651_10197171
450 Ga0207640_10051772
451 Ga0207640_10100686
452 Ga0207658_10010805
453 Ga0207658_10237724
454 Ga0207677_10095572
455 Ga0207703_10111613
456 Ga0207639_10001229
457 Ga0207639_10001939
458 Ga0207639_10002338
459 Ga0207639_10005669
460 Ga0207639_10054215
461 Ga0207639_10057352
462 Ga0207639_10544248
463 Ga0207678_10000864
464 Ga0207678_10009242
465 Ga0207678_10069929
466 Ga0207702_10000435
467 Ga0207648_10014059
468 Ga0207676_10001817
469 Ga0207676_10034636
470 Ga0207674_10001518
471 Ga0207674_10003272
472 Ga0207674_10051166
473 Ga0207698_10003125
474 Ga0207698_10068674
475 Ga0207698_10083604
476 Ga0207698_10150951
477 Ga0207428_10218075
478 Ga0268266_10008238
479 Ga0268266_10014311
480 Ga0268265_10108713
481 Ga0307405_10006118
482 Ga0307413_10132275
483 Ga0307413_11034831
484 Ga0307410_10087547
485 Ga0307410_10141544
486 Ga0307410_10575751
487 Ga0307406_10110677
488 Ga0307406_10136832
489 Ga0307407_10054987
490 Ga0307409_100161499
491 Ga0307409_100383836
492 Ga0307409_100532496
493 Ga0307416_100080427
494 Ga0307416_100732424
495 Ga0307414_10263397
496 Ga0307414_11298242
497 Ga0307411_10665784
498 Ga0373949_0121456
499 Ga0373931_0029315
500 Ga0395899_0004100
501 Ga0395899_0162560
502 Ga0395899_0167425
503 Ga0395900_0010699
504 Ga0395900_0031534
505 Ga0395900_0102777
506 Ga0395900_0217246
507 Ga0395900_0295483
508 Ga0395898_0011614
509 Ga0395898_0163056
510 Ga0395898_0917695
511 Ga0395905_0094638
512 Ga0395905_0223150
513 Ga0395905_0286498
514 Ga0395905_0296075
515 Ga0395905_0432133
516 Ga0395905_0505673
517 Ga0395905_0906365
518 Ga0395905_1205267
519 Ga0395901_0001546
520 Ga0395901_0525486
521 Ga0395901_0573025
522 Ga0395901_1328317
523 Ga0450917_000492
524 Ga0450890_002096
525 Ga0450905_000863
526 Ga0450889_000056
527 Ga0439458_0024994
528 Ga0466969_0001211
529 Ga0466969_0043116
530 Ga0466969_0060017
531 Ga0466966_0030850
532 Ga0466961_0020510
533 Ga0466961_0036956
534 Ga0466961_0098543
535 Ga0466963_0001361
536 Ga0466963_0004194
537 Ga0466963_0006457
538 Ga0466963_0007656
539 Ga0466963_0045878
540 Ga0466963_0052776
541 Ga0466963_0062841
542 Ga0466963_0129404
543 Ga0466964_0025702
544 Ga0466964_0169285
545 Ga0466957_0003980
546 Ga0466957_0004650
547 Ga0466957_0074240
548 Ga0466957_0178750
549 Ga0466957_0227780
550 Ga0466957_0273614
551 Ga0466959_0182652
552 Ga0466958_0002397
553 Ga0466958_0003120
554 Ga0466967_0012995
555 Ga0466967_0050550
556 Ga0466967_0056132
557 Ga0466967_0056271
558 Ga0466967_0086223
559 Ga0466967_0358453
560 Ga0466967_0393387
561 Ga0466967_0601878
562 Ga0466967_0631408
563 Ga0466967_0786467
564 Ga0495669_0009081
565 Ga0495669_0010265
566 Ga0496100_0015490
567 Ga0496105_0744233
568 Ga0496106_0025703
569 Ga0496107_0007643
570 Ga0496108_0032448
571 Ga0496109_0003591
572 Ga0496111_0015798
573 Ga0496111_0418258
574 Ga0496112_0002186
575 Ga0496113_0002270
576 Ga0501073_0246356
577 nmdc:mga05p37_706353_c1
578 Ga0500616_0000254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1d-assembly3.cif.gz_A x-ray crystal structure of recx 0.7864 18 157
3dfg-assembly1.cif.gz_A crystal structure of recx: a potent inhibitor protein of reca from xanthomonas campestris 0.7576 18 162
3dfg-assembly1.cif.gz_A crystal structure of recx: a potent inhibitor protein of reca from xanthomonas campestris 0.7351 18 162
3e3v-assembly1.cif.gz_A crystal structure of recx from lactobacillus salivarius 0.7324 16 165
3c1d-assembly3.cif.gz_B x-ray crystal structure of recx 0.7226 18 158
ID Description Score Start End Superfamily
af_Q4DDK0_675_831_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.6746 119 162 3.30.230.10
af_Q2G2G9_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5184 41 117 1.10.10.10
2r8kB03 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.5132 23 67 1.10.150.20
af_Q2G2G9_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.3767 41 117 1.10.10.10
2r8kB03 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.3594 23 67 1.10.150.20
ID Description Score Start End GO Terms
AF-A0A7W6PUM3-F1-model_v4 Regulatory protein 0.9755 8 174
AF-A0A2A5YMP8-F1-model_v4 RecX family transcriptional regulator 0.975 5 162
AF-A0A1S1HC60-F1-model_v4 Regulatory protein RecX 0.9714 19 174 GO:0005737
AF-A0A0Q4QJ78-F1-model_v4 Regulatory protein RecX 0.968 22 170 GO:0005737
AF-T0GRX0-F1-model_v4 Uncharacterized protein 0.9646 5 107

Map