F389252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 289 | 192 | 289 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10315150|Ga0207683_103151504 |
| Length | 157 |
| Sequence | MILVDANLLIYAHVSSFEQHAPAVSWLDAQLNGGGRVGLPWPSLLGFLRIVTNPRVFERPEPVARAWRQVQAWLEPDAVWIPQPTERHPDLLGSLVNAAGVQANLVPDAHLAALAIEHGLLLCTTDGDFGRFAGLRWQNPLTETRLGSNESPALSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 125 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 126 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 127 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 128 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 129 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 130 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 131 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.19 |
| Rhizosphere | 93.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5781307 | 2162886012 | Bacteria | 975 |
| 2 | rootL2_10184862 | 3300003322 | Bacteria | 1499 |
| 3 | Ga0065715_10152902 | 3300005293 | Bacteria | 1708 |
| 4 | Ga0070683_100616222 | 3300005329 | Unclassified | 1039 |
| 5 | Ga0070666_10273614 | 3300005335 | Bacteria | 1199 |
| 6 | Ga0070682_100723767 | 3300005337 | Bacteria | 800 |
| 7 | Ga0070660_100469123 | 3300005339 | Bacteria | 1045 |
| 8 | Ga0070689_100369646 | 3300005340 | Unclassified | 1206 |
| 9 | Ga0070687_100848892 | 3300005343 | Bacteria | 651 |
| 10 | Ga0070661_100032915 | 3300005344 | Bacteria | 3754 |
| 11 | Ga0070669_100136846 | 3300005353 | Bacteria | 1885 |
| 12 | Ga0070669_100584779 | 3300005353 | Bacteria | 934 |
| 13 | Ga0070675_100038608 | 3300005354 | Bacteria | 3893 |
| 14 | Ga0070675_100791085 | 3300005354 | Bacteria | 867 |
| 15 | Ga0070673_100021649 | 3300005364 | Bacteria | 4667 |
| 16 | Ga0070673_101575369 | 3300005364 | Bacteria | 620 |
| 17 | Ga0070688_100267400 | 3300005365 | Bacteria | 1224 |
| 18 | Ga0070659_100012804 | 3300005366 | Bacteria | 6228 |
| 19 | Ga0070667_100485136 | 3300005367 | Bacteria | 1132 |
| 20 | Ga0070667_100534680 | 3300005367 | Unclassified | 1076 |
| 21 | Ga0070711_100305696 | 3300005439 | Bacteria | 1266 |
| 22 | Ga0070705_100052918 | 3300005440 | Bacteria | 2374 |
| 23 | Ga0070708_100109882 | 3300005445 | Unclassified | 2533 |
| 24 | Ga0070708_100749967 | 3300005445 | Bacteria | 918 |
| 25 | Ga0070708_100894200 | 3300005445 | Unclassified | 834 |
| 26 | Ga0070663_100028161 | 3300005455 | Bacteria | 3822 |
| 27 | Ga0070663_100039064 | 3300005455 | Bacteria | 3315 |
| 28 | Ga0070662_100028743 | 3300005457 | Bacteria | 3872 |
| 29 | Ga0070681_10518510 | 3300005458 | Bacteria | 1105 |
| 30 | Ga0068867_100391495 | 3300005459 | Bacteria | 1170 |
| 31 | Ga0068867_101259079 | 3300005459 | Unclassified | 681 |
| 32 | Ga0070685_10516511 | 3300005466 | Unclassified | 847 |
| 33 | Ga0070706_100031551 | 3300005467 | Unclassified | 4885 |
| 34 | Ga0070706_100143292 | 3300005467 | Bacteria | 2231 |
| 35 | Ga0070706_100386205 | 3300005467 | Bacteria | 1303 |
| 36 | Ga0070707_100009263 | 3300005468 | Bacteria | 9138 |
| 37 | Ga0070699_100085374 | 3300005518 | Bacteria | 2755 |
| 38 | Ga0070699_100578908 | 3300005518 | Bacteria | 1023 |
| 39 | Ga0070699_100584325 | 3300005518 | Bacteria | 1018 |
| 40 | Ga0070679_100194572 | 3300005530 | Bacteria | 1996 |
| 41 | Ga0070679_100579890 | 3300005530 | Bacteria | 1065 |
| 42 | Ga0070697_100024459 | 3300005536 | Unclassified | 4807 |
| 43 | Ga0070697_100094831 | 3300005536 | Bacteria | 2473 |
| 44 | Ga0070697_100348175 | 3300005536 | Unclassified | 1279 |
| 45 | Ga0068853_100313762 | 3300005539 | Unclassified | 1452 |
| 46 | Ga0068853_100934766 | 3300005539 | Unclassified | 833 |
| 47 | Ga0070672_100051737 | 3300005543 | Bacteria | 3205 |
| 48 | Ga0070695_100356793 | 3300005545 | Bacteria | 1097 |
| 49 | Ga0070696_100009186 | 3300005546 | Bacteria | 6617 |
| 50 | Ga0070693_101053830 | 3300005547 | Bacteria | 618 |
| 51 | Ga0070704_100679110 | 3300005549 | Unclassified | 912 |
| 52 | Ga0068855_100405029 | 3300005563 | Unclassified | 1494 |
| 53 | Ga0068855_100548198 | 3300005563 | Bacteria | 1252 |
| 54 | Ga0068855_100928026 | 3300005563 | Unclassified | 918 |
| 55 | Ga0070664_100053525 | 3300005564 | Bacteria | 3421 |
| 56 | Ga0068854_100592936 | 3300005578 | Unclassified | 945 |
| 57 | Ga0068854_101266158 | 3300005578 | Bacteria | 663 |
| 58 | Ga0068856_100150368 | 3300005614 | Bacteria | 2337 |
| 59 | Ga0068856_100531937 | 3300005614 | Unclassified | 1197 |
| 60 | Ga0068852_100027989 | 3300005616 | Bacteria | 4605 |
| 61 | Ga0068852_100336334 | 3300005616 | Bacteria | 1470 |
| 62 | Ga0068859_100290359 | 3300005617 | Unclassified | 1728 |
| 63 | Ga0068859_100635118 | 3300005617 | Bacteria | 1160 |
| 64 | Ga0068859_100655505 | 3300005617 | Bacteria | 1142 |
| 65 | Ga0068864_100218932 | 3300005618 | Bacteria | 1756 |
| 66 | Ga0068863_100543397 | 3300005841 | Bacteria | 1147 |
| 67 | Ga0068858_100206608 | 3300005842 | Bacteria | 1858 |
| 68 | Ga0068860_100671324 | 3300005843 | Bacteria | 1045 |
| 69 | Ga0070712_100114010 | 3300006175 | Unclassified | 2023 |
| 70 | Ga0097621_100119557 | 3300006237 | Bacteria | 2233 |
| 71 | Ga0097621_100479107 | 3300006237 | Bacteria | 1125 |
| 72 | Ga0068871_100336994 | 3300006358 | Bacteria | 1331 |
| 73 | Ga0075428_100807161 | 3300006844 | Bacteria | 997 |
| 74 | Ga0075433_10090782 | 3300006852 | Unclassified | 2700 |
| 75 | Ga0075434_100901538 | 3300006871 | Bacteria | 899 |
| 76 | Ga0068865_100192050 | 3300006881 | Bacteria | 1580 |
| 77 | Ga0068865_100458014 | 3300006881 | Bacteria | 1056 |
| 78 | Ga0075436_100005947 | 3300006914 | Bacteria | 8381 |
| 79 | Ga0097620_100290356 | 3300006931 | Unclassified | 1728 |
| 80 | Ga0097620_100635248 | 3300006931 | Bacteria | 1160 |
| 81 | Ga0097620_100655532 | 3300006931 | Bacteria | 1142 |
| 82 | Ga0105240_10263257 | 3300009093 | Bacteria | 1988 |
| 83 | Ga0105240_10442592 | 3300009093 | Unclassified | 1456 |
| 84 | Ga0111539_11332561 | 3300009094 | Bacteria | 833 |
| 85 | Ga0105247_10113503 | 3300009101 | Unclassified | 1746 |
| 86 | Ga0105243_10483968 | 3300009148 | Bacteria | 1169 |
| 87 | Ga0105241_10083578 | 3300009174 | Bacteria | 2505 |
| 88 | Ga0105238_10456390 | 3300009551 | Unclassified | 1275 |
| 89 | Ga0105249_10214757 | 3300009553 | Bacteria | 1890 |
| 90 | Ga0105249_10565821 | 3300009553 | Bacteria | 1189 |
| 91 | Ga0105239_10934173 | 3300010375 | Unclassified | 996 |
| 92 | Ga0157370_10026850 | 3300013104 | Bacteria | 5680 |
| 93 | Ga0157369_10082072 | 3300013105 | Bacteria | 3449 |
| 94 | Ga0157369_10841372 | 3300013105 | Unclassified | 942 |
| 95 | Ga0157374_10418182 | 3300013296 | Bacteria | 1339 |
| 96 | Ga0157374_11666708 | 3300013296 | Unclassified | 662 |
| 97 | Ga0157378_10418046 | 3300013297 | Bacteria | 1325 |
| 98 | Ga0157378_11263465 | 3300013297 | Bacteria | 779 |
| 99 | Ga0157378_11616042 | 3300013297 | Bacteria | 694 |
| 100 | Ga0157378_13248015 | 3300013297 | Unclassified | 505 |
| 101 | Ga0163162_10381859 | 3300013306 | Bacteria | 1542 |
| 102 | Ga0157375_10711342 | 3300013308 | Bacteria | 1158 |
| 103 | Ga0163163_10044223 | 3300014325 | Bacteria | 4368 |
| 104 | Ga0157376_10300743 | 3300014969 | Bacteria | 1519 |
| 105 | Ga0163161_10151313 | 3300017792 | Bacteria | 1764 |
| 106 | Ga0207692_10546202 | 3300025898 | Unclassified | 740 |
| 107 | Ga0207680_10247294 | 3300025903 | Bacteria | 1231 |
| 108 | Ga0207684_10238168 | 3300025910 | Unclassified | 1570 |
| 109 | Ga0207684_10356222 | 3300025910 | Unclassified | 1259 |
| 110 | Ga0207684_10869514 | 3300025910 | Unclassified | 759 |
| 111 | Ga0207695_10051403 | 3300025913 | Unclassified | 4328 |
| 112 | Ga0207695_10202140 | 3300025913 | Bacteria | 1900 |
| 113 | Ga0207693_10115413 | 3300025915 | Unclassified | 2108 |
| 114 | Ga0207663_10465014 | 3300025916 | Bacteria | 978 |
| 115 | Ga0207657_10001461 | 3300025919 | Bacteria | 25304 |
| 116 | Ga0207657_10239010 | 3300025919 | Unclassified | 1451 |
| 117 | Ga0207649_10480899 | 3300025920 | Unclassified | 942 |
| 118 | Ga0207652_10486517 | 3300025921 | Bacteria | 1111 |
| 119 | Ga0207652_11177588 | 3300025921 | Unclassified | 668 |
| 120 | Ga0207646_10012067 | 3300025922 | Bacteria | 8319 |
| 121 | Ga0207681_10284727 | 3300025923 | Bacteria | 1303 |
| 122 | Ga0207694_10168388 | 3300025924 | Unclassified | 1773 |
| 123 | Ga0207659_10056300 | 3300025926 | Bacteria | 2816 |
| 124 | Ga0207659_10083196 | 3300025926 | Bacteria | 2372 |
| 125 | Ga0207700_10660735 | 3300025928 | Bacteria | 932 |
| 126 | Ga0207644_10254528 | 3300025931 | Bacteria | 1402 |
| 127 | Ga0207706_10000040 | 3300025933 | Bacteria | 132285 |
| 128 | Ga0207691_10061252 | 3300025940 | Bacteria | 3418 |
| 129 | Ga0207689_10182301 | 3300025942 | Bacteria | 1731 |
| 130 | Ga0207679_10241998 | 3300025945 | Bacteria | 1529 |
| 131 | Ga0207679_10503125 | 3300025945 | Bacteria | 1081 |
| 132 | Ga0207667_10019238 | 3300025949 | Bacteria | 7633 |
| 133 | Ga0207667_10027421 | 3300025949 | Bacteria | 6200 |
| 134 | Ga0207667_10625301 | 3300025949 | Unclassified | 1084 |
| 135 | Ga0207651_10044756 | 3300025960 | Bacteria | 2965 |
| 136 | Ga0207712_10359158 | 3300025961 | Bacteria | 1213 |
| 137 | Ga0207640_11423493 | 3300025981 | Bacteria | 621 |
| 138 | Ga0207658_10142804 | 3300025986 | Bacteria | 1940 |
| 139 | Ga0207658_10357821 | 3300025986 | Unclassified | 1273 |
| 140 | Ga0207703_10231569 | 3300026035 | Bacteria | 1656 |
| 141 | Ga0207639_10086100 | 3300026041 | Bacteria | 2501 |
| 142 | Ga0207678_10317164 | 3300026067 | Bacteria | 1341 |
| 143 | Ga0207708_10266940 | 3300026075 | Bacteria | 1383 |
| 144 | Ga0207641_10661231 | 3300026088 | Bacteria | 1027 |
| 145 | Ga0207648_10145909 | 3300026089 | Bacteria | 2087 |
| 146 | Ga0207648_10335833 | 3300026089 | Bacteria | 1360 |
| 147 | Ga0207676_10384102 | 3300026095 | Bacteria | 1308 |
| 148 | Ga0207683_10132085 | 3300026121 | Bacteria | 2246 |
| 149 | Ga0207683_10315150 | 3300026121 | Unclassified | 1432 |
| 150 | Ga0209983_1056047 | 3300027665 | Bacteria | 867 |
| 151 | Ga0209971_1041172 | 3300027682 | Unclassified | 1112 |
| 152 | Ga0209966_1119218 | 3300027695 | Bacteria | 604 |
| 153 | Ga0209974_10076710 | 3300027876 | Bacteria | 1145 |
| 154 | Ga0207428_10555945 | 3300027907 | Bacteria | 830 |
| 155 | Ga0268266_11412361 | 3300028379 | Bacteria | 672 |
| 156 | Ga0265319_1006498 | 3300028563 | Bacteria | 5408 |
| 157 | Ga0265320_10000110 | 3300031240 | Bacteria | 71074 |
| 158 | Ga0265339_10251065 | 3300031249 | Unclassified | 856 |
| 159 | Ga0307408_100957929 | 3300031548 | Unclassified | 786 |
| 160 | Ga0265313_10021866 | 3300031595 | Bacteria | 3487 |
| 161 | Ga0265342_10145161 | 3300031712 | Bacteria | 1321 |
| 162 | Ga0307405_10339630 | 3300031731 | Bacteria | 1154 |
| 163 | Ga0316577_10204619 | 3300031733 | Bacteria | 1116 |
| 164 | Ga0307413_11068577 | 3300031824 | Unclassified | 695 |
| 165 | Ga0307409_100089359 | 3300031995 | Bacteria | 2518 |
| 166 | Ga0373931_0175888 | 3300035691 | Bacteria | 1264 |
| 167 | Ga0373927_0003249 | 3300035695 | Bacteria | 11693 |
| 168 | Ga0373947_0526835 | 3300035725 | Unclassified | 804 |
| 169 | Ga0395905_0098953 | 3300037471 | Bacteria | 2739 |
| 170 | Ga0436364_1300406 | 3300037853 | Bacteria | 4192 |
| 171 | Ga0400483_271477 | 3300039062 | Bacteria | 2544 |
| 172 | Ga0436365_1637745 | 3300039437 | Bacteria | 6778 |
| 173 | Ga0436360_0195559 | 3300039438 | Unclassified | 1100 |
| 174 | Ga0436360_0929293 | 3300039438 | Unclassified | 608 |
| 175 | Ga0436363_0497578 | 3300039450 | Unclassified | 950 |
| 176 | Ga0466963_0975211 | 3300044694 | Unclassified | 597 |
| 177 | Ga0466967_0107256 | 3300045976 | Bacteria | 2562 |
| 178 | Ga0466967_0733193 | 3300045976 | Bacteria | 980 |
| 179 | Ga0495629_0094657 | 3300046459 | Unclassified | 2084 |
| 180 | Ga0495580_0742025 | 3300046472 | Bacteria | 640 |
| 181 | Ga0495662_0180028 | 3300046476 | Bacteria | 1042 |
| 182 | Ga0495662_0294206 | 3300046476 | Unclassified | 799 |
| 183 | Ga0495640_0031593 | 3300046533 | Bacteria | 3777 |
| 184 | Ga0495667_0348525 | 3300046559 | Unclassified | 936 |
| 185 | Ga0495667_0455344 | 3300046559 | Bacteria | 804 |
| 186 | Ga0495634_0205350 | 3300046642 | Unclassified | 1222 |
| 187 | Ga0495635_0540881 | 3300046663 | Unclassified | 764 |
| 188 | Ga0495658_0367999 | 3300046683 | Unclassified | 914 |
| 189 | Ga0495613_0296003 | 3300046689 | Unclassified | 1121 |
| 190 | Ga0495600_0381879 | 3300046809 | Unclassified | 879 |
| 191 | Ga0495581_0061891 | 3300047315 | Unclassified | 2163 |
| 192 | Ga0495674_0133850 | 3300047319 | Unclassified | 2087 |
| 193 | Ga0495684_0043267 | 3300047471 | Bacteria | 3448 |
| 194 | Ga0495684_0872302 | 3300047471 | Unclassified | 582 |
| 195 | Ga0496100_0486694 | 3300048903 | Unclassified | 949 |
| 196 | Ga0496102_0224247 | 3300048905 | Bacteria | 1772 |
| 197 | Ga0496104_0209258 | 3300048907 | Bacteria | 1862 |
| 198 | Ga0496104_1294941 | 3300048907 | Unclassified | 632 |
| 199 | Ga0496105_0261344 | 3300048908 | Bacteria | 1400 |
| 200 | Ga0496105_0289820 | 3300048908 | Bacteria | 1318 |
| 201 | Ga0496106_0010685 | 3300048909 | Bacteria | 6785 |
| 202 | Ga0496107_0022136 | 3300048910 | Bacteria | 4491 |
| 203 | Ga0496107_0196824 | 3300048910 | Unclassified | 1498 |
| 204 | Ga0496108_0097284 | 3300048911 | Bacteria | 2508 |
| 205 | Ga0496109_1662758 | 3300048912 | Unclassified | 572 |
| 206 | Ga0496110_0245393 | 3300048913 | Bacteria | 1630 |
| 207 | Ga0496111_1298531 | 3300048914 | Bacteria | 513 |
| 208 | Ga0496114_0316448 | 3300048917 | Bacteria | 1379 |
| 209 | Ga0496115_0174904 | 3300048918 | Bacteria | 1775 |
| 210 | Ga0501033_0027594 | 3300049570 | Bacteria | 4269 |
| 211 | Ga0501034_1035507 | 3300049571 | Bacteria | 704 |
| 212 | Ga0501036_0073606 | 3300049572 | Bacteria | 2888 |
| 213 | Ga0501036_0640742 | 3300049572 | Unclassified | 880 |
| 214 | Ga0501039_0299878 | 3300049575 | Bacteria | 1263 |
| 215 | Ga0501040_0343731 | 3300049576 | Unclassified | 1068 |
| 216 | Ga0501041_0014021 | 3300049577 | Bacteria | 4755 |
| 217 | Ga0501041_0162554 | 3300049577 | Unclassified | 1396 |
| 218 | Ga0501041_0369515 | 3300049577 | Unclassified | 907 |
| 219 | Ga0501042_0134497 | 3300049578 | Bacteria | 1782 |
| 220 | Ga0501042_0728306 | 3300049578 | Bacteria | 721 |
| 221 | Ga0501043_0185698 | 3300049579 | Bacteria | 1619 |
| 222 | Ga0501043_0537335 | 3300049579 | Unclassified | 870 |
| 223 | Ga0501046_0043985 | 3300049580 | Bacteria | 3553 |
| 224 | Ga0501048_0016147 | 3300049582 | Bacteria | 5504 |
| 225 | Ga0501048_0072574 | 3300049582 | Bacteria | 2430 |
| 226 | Ga0501048_0680621 | 3300049582 | Unclassified | 739 |
| 227 | Ga0501067_0432001 | 3300049583 | Unclassified | 735 |
| 228 | Ga0501068_0129147 | 3300049584 | Bacteria | 1580 |
| 229 | Ga0501068_0526451 | 3300049584 | Unclassified | 768 |
| 230 | Ga0501068_0781700 | 3300049584 | Bacteria | 626 |
| 231 | Ga0501070_0879707 | 3300049586 | Unclassified | 700 |
| 232 | Ga0501071_0037468 | 3300049587 | Bacteria | 3463 |
| 233 | Ga0501072_0001691 | 3300049588 | Bacteria | 16435 |
| 234 | Ga0501072_0004033 | 3300049588 | Bacteria | 11114 |
| 235 | Ga0501072_0106310 | 3300049588 | Bacteria | 2232 |
| 236 | Ga0501072_0265250 | 3300049588 | Bacteria | 1367 |
| 237 | Ga0501072_0282135 | 3300049588 | Bacteria | 1321 |
| 238 | Ga0501073_0263210 | 3300049589 | Bacteria | 1190 |
| 239 | Ga0501074_0187060 | 3300049590 | Unclassified | 1477 |
| 240 | Ga0501074_0399505 | 3300049590 | Bacteria | 975 |
| 241 | Ga0501075_0000008 | 3300049591 | Bacteria | 99121 |
| 242 | Ga0501075_0052953 | 3300049591 | Bacteria | 3052 |
| 243 | Ga0501075_0811532 | 3300049591 | Unclassified | 712 |
| 244 | Ga0501076_0000004 | 3300049592 | Bacteria | 149972 |
| 245 | Ga0501076_0013348 | 3300049592 | Bacteria | 6160 |
| 246 | Ga0501076_0198078 | 3300049592 | Bacteria | 1640 |
| 247 | Ga0501076_0376383 | 3300049592 | Unclassified | 1167 |
| 248 | Ga0501076_0636473 | 3300049592 | Bacteria | 880 |
| 249 | Ga0501077_0385026 | 3300049593 | Bacteria | 896 |
| 250 | Ga0501079_0274248 | 3300049741 | Unclassified | 1318 |
| 251 | Ga0501079_0294033 | 3300049741 | Bacteria | 1270 |
| 252 | Ga0501079_1027820 | 3300049741 | Bacteria | 649 |
| 253 | Ga0501079_1043139 | 3300049741 | Unclassified | 644 |
| 254 | Ga0501080_0171973 | 3300049742 | Bacteria | 1998 |
| 255 | Ga0501080_0191720 | 3300049742 | Bacteria | 1878 |
| 256 | Ga0501080_0384394 | 3300049742 | Bacteria | 1264 |
| 257 | Ga0501080_0682717 | 3300049742 | Unclassified | 907 |
| 258 | Ga0501081_0000572 | 3300049743 | Bacteria | 20956 |
| 259 | Ga0501081_0135607 | 3300049743 | Bacteria | 1762 |
| 260 | Ga0501081_0196172 | 3300049743 | Bacteria | 1463 |
| 261 | Ga0501035_0140046 | 3300049822 | Bacteria | 2104 |
| 262 | Ga0501045_0017614 | 3300049824 | Bacteria | 5072 |
| 263 | Ga0501045_0033211 | 3300049824 | Bacteria | 3742 |
| 264 | Ga0501045_0246429 | 3300049824 | Bacteria | 1330 |
| 265 | nmdc:mga05p37_75833_c1 | 3300050507 | Unclassified | 4140 |
| 266 | nmdc:mga09592_23916_c1 | 3300050508 | Bacteria | 5049 |
| 267 | nmdc:mga08y16_682427_c1 | 3300050511 | Bacteria | 1029 |
| 268 | nmdc:mga0rr50_1126911_c1 | 3300050513 | Unclassified | 667 |
| 269 | nmdc:mga08x19_162677_c1 | 3300050514 | Bacteria | 1516 |
| 270 | nmdc:mga08x19_974_c2 | 3300050514 | Bacteria | 6866 |
| 271 | nmdc:mga0a205_1318969_c1 | 3300050515 | Unclassified | 569 |
| 272 | Ga0495601_0011453 | 3300053077 | Bacteria | 5305 |
| 273 | Ga0495601_0592337 | 3300053077 | Unclassified | 712 |
| 274 | Ga0495655_0178317 | 3300053083 | Unclassified | 684 |
| 275 | Ga0495619_0007276 | 3300053085 | Bacteria | 7009 |
| 276 | Ga0495619_1160682 | 3300053085 | Unclassified | 512 |
| 277 | Ga0501084_0005113 | 3300054114 | Bacteria | 10739 |
| 278 | Ga0501084_0034388 | 3300054114 | Bacteria | 4239 |
| 279 | Ga0501084_0123668 | 3300054114 | Bacteria | 2176 |
| 280 | Ga0501084_0359458 | 3300054114 | Bacteria | 1230 |
| 281 | Ga0501082_0008013 | 3300060353 | Bacteria | 9120 |
| 282 | Ga0501082_0274401 | 3300060353 | Bacteria | 1468 |
| 283 | Ga0501082_0563990 | 3300060353 | Bacteria | 996 |
| 284 | Ga0501082_0636045 | 3300060353 | Bacteria | 934 |
| 285 | Ga0530510_0000005 | 3300061734 | Bacteria | 198759 |
| 286 | Ga0530510_0004398 | 3300061734 | Bacteria | 9757 |
| 287 | Ga0530510_0220324 | 3300061734 | Bacteria | 1410 |
| 288 | Ga0530510_0259356 | 3300061734 | Bacteria | 1296 |
| 289 | Ga0530510_0396086 | 3300061734 | Unclassified | 1040 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039062 | Ga0400483_271477 | Ga0400483_271477_1776_2201 | 140 |
| 2 | 3300005337 | Ga0070682_100723767 | Ga0070682_1007237671 | 141 |
| 3 | 3300005455 | Ga0070663_100028161 | Ga0070663_1000281613 | 141 |
| 4 | 3300005563 | Ga0068855_100548198 | Ga0068855_1005481982 | 141 |
| 5 | 3300009093 | Ga0105240_10263257 | Ga0105240_102632573 | 141 |
| 6 | 3300013296 | Ga0157374_10418182 | Ga0157374_104181822 | 141 |
| 7 | 3300025913 | Ga0207695_10202140 | Ga0207695_102021403 | 141 |
| 8 | 3300025949 | Ga0207667_10027421 | Ga0207667_100274213 | 141 |
| 9 | 3300028563 | Ga0265319_1006498 | Ga0265319_10064984 | 141 |
| 10 | 3300031240 | Ga0265320_10000110 | Ga0265320_1000011016 | 141 |
| 11 | 3300044694 | Ga0466963_0975211 | Ga0466963_0975211_52_477 | 141 |
| 12 | 3300045976 | Ga0466967_0733193 | Ga0466967_0733193_110_535 | 141 |
| 13 | 3300048917 | Ga0496114_0316448 | Ga0496114_0316448_796_1221 | 141 |
| 14 | 3300050515 | nmdc:mga0a205_1318969_c1 | nmdc:mga0a205_1318969_c1_65_490 | 141 |
| 15 | 3300053077 | Ga0495601_0592337 | Ga0495601_0592337_188_613 | 141 |
| 16 | 3300005364 | Ga0070673_101575369 | Ga0070673_1015753691 | 142 |
| 17 | 3300005439 | Ga0070711_100305696 | Ga0070711_1003056962 | 142 |
| 18 | 3300005440 | Ga0070705_100052918 | Ga0070705_1000529183 | 142 |
| 19 | 3300005458 | Ga0070681_10518510 | Ga0070681_105185102 | 142 |
| 20 | 3300005530 | Ga0070679_100579890 | Ga0070679_1005798901 | 142 |
| 21 | 3300005545 | Ga0070695_100356793 | Ga0070695_1003567932 | 142 |
| 22 | 3300005546 | Ga0070696_100009186 | Ga0070696_1000091867 | 142 |
| 23 | 3300005547 | Ga0070693_101053830 | Ga0070693_1010538302 | 142 |
| 24 | 3300005563 | Ga0068855_100928026 | Ga0068855_1009280262 | 142 |
| 25 | 3300006871 | Ga0075434_100901538 | Ga0075434_1009015382 | 142 |
| 26 | 3300013105 | Ga0157369_10841372 | Ga0157369_108413722 | 142 |
| 27 | 3300013297 | Ga0157378_11263465 | Ga0157378_112634652 | 142 |
| 28 | 3300025910 | Ga0207684_10869514 | Ga0207684_108695141 | 142 |
| 29 | 3300025928 | Ga0207700_10660735 | Ga0207700_106607352 | 142 |
| 30 | 3300025931 | Ga0207644_10254528 | Ga0207644_102545283 | 142 |
| 31 | 3300031733 | Ga0316577_10204619 | Ga0316577_102046192 | 142 |
| 32 | 3300035695 | Ga0373927_0003249 | Ga0373927_0003249_10755_11183 | 142 |
| 33 | 3300039438 | Ga0436360_0195559 | Ga0436360_0195559_81_509 | 142 |
| 34 | 3300049571 | Ga0501034_1035507 | Ga0501034_1035507_85_513 | 142 |
| 35 | 3300049572 | Ga0501036_0640742 | Ga0501036_0640742_47_475 | 142 |
| 36 | 3300049576 | Ga0501040_0343731 | Ga0501040_0343731_135_563 | 142 |
| 37 | 3300049577 | Ga0501041_0162554 | Ga0501041_0162554_698_1126 | 142 |
| 38 | 3300049577 | Ga0501041_0369515 | Ga0501041_0369515_349_777 | 142 |
| 39 | 3300049578 | Ga0501042_0728306 | Ga0501042_0728306_41_469 | 142 |
| 40 | 3300049579 | Ga0501043_0537335 | Ga0501043_0537335_73_501 | 142 |
| 41 | 3300049582 | Ga0501048_0680621 | Ga0501048_0680621_130_582 | 142 |
| 42 | 3300049587 | Ga0501071_0037468 | Ga0501071_0037468_1233_1661 | 142 |
| 43 | 3300049588 | Ga0501072_0106310 | Ga0501072_0106310_415_843 | 142 |
| 44 | 3300049588 | Ga0501072_0265250 | Ga0501072_0265250_334_786 | 142 |
| 45 | 3300049590 | Ga0501074_0187060 | Ga0501074_0187060_622_1050 | 142 |
| 46 | 3300049590 | Ga0501074_0399505 | Ga0501074_0399505_422_874 | 142 |
| 47 | 3300049591 | Ga0501075_0052953 | Ga0501075_0052953_2214_2642 | 142 |
| 48 | 3300049592 | Ga0501076_0013348 | Ga0501076_0013348_5210_5638 | 142 |
| 49 | 3300049592 | Ga0501076_0376383 | Ga0501076_0376383_502_930 | 142 |
| 50 | 3300049593 | Ga0501077_0385026 | Ga0501077_0385026_34_462 | 142 |
| 51 | 3300049741 | Ga0501079_0274248 | Ga0501079_0274248_332_760 | 142 |
| 52 | 3300049741 | Ga0501079_0294033 | Ga0501079_0294033_106_558 | 142 |
| 53 | 3300049742 | Ga0501080_0171973 | Ga0501080_0171973_1261_1689 | 142 |
| 54 | 3300049742 | Ga0501080_0682717 | Ga0501080_0682717_80_532 | 142 |
| 55 | 3300049743 | Ga0501081_0135607 | Ga0501081_0135607_724_1176 | 142 |
| 56 | 3300049824 | Ga0501045_0033211 | Ga0501045_0033211_1742_2170 | 142 |
| 57 | 3300053085 | Ga0495619_1160682 | Ga0495619_1160682_12_440 | 142 |
| 58 | 3300054114 | Ga0501084_0034388 | Ga0501084_0034388_1746_2174 | 142 |
| 59 | 3300054114 | Ga0501084_0123668 | Ga0501084_0123668_1347_1799 | 142 |
| 60 | 3300060353 | Ga0501082_0563990 | Ga0501082_0563990_253_705 | 142 |
| 61 | 3300060353 | Ga0501082_0636045 | Ga0501082_0636045_310_738 | 142 |
| 62 | 3300061734 | Ga0530510_0004398 | Ga0530510_0004398_1622_2050 | 142 |
| 63 | 3300061734 | Ga0530510_0220324 | Ga0530510_0220324_850_1278 | 142 |
| 64 | 2162886012 | MBSR1b_contig_5781307 | MBSR1b_0217.00003380 | 143 |
| 65 | 3300003322 | rootL2_10184862 | rootL2_101848623 | 143 |
| 66 | 3300005293 | Ga0065715_10152902 | Ga0065715_101529022 | 143 |
| 67 | 3300005329 | Ga0070683_100616222 | Ga0070683_1006162222 | 143 |
| 68 | 3300005335 | Ga0070666_10273614 | Ga0070666_102736143 | 143 |
| 69 | 3300005339 | Ga0070660_100469123 | Ga0070660_1004691232 | 143 |
| 70 | 3300005340 | Ga0070689_100369646 | Ga0070689_1003696462 | 143 |
| 71 | 3300005343 | Ga0070687_100848892 | Ga0070687_1008488922 | 143 |
| 72 | 3300005344 | Ga0070661_100032915 | Ga0070661_1000329153 | 143 |
| 73 | 3300005353 | Ga0070669_100136846 | Ga0070669_1001368463 | 143 |
| 74 | 3300005353 | Ga0070669_100584779 | Ga0070669_1005847793 | 143 |
| 75 | 3300005354 | Ga0070675_100038608 | Ga0070675_1000386087 | 143 |
| 76 | 3300005354 | Ga0070675_100791085 | Ga0070675_1007910852 | 143 |
| 77 | 3300005364 | Ga0070673_100021649 | Ga0070673_1000216493 | 143 |
| 78 | 3300005365 | Ga0070688_100267400 | Ga0070688_1002674003 | 143 |
| 79 | 3300005366 | Ga0070659_100012804 | Ga0070659_1000128045 | 143 |
| 80 | 3300005367 | Ga0070667_100485136 | Ga0070667_1004851361 | 143 |
| 81 | 3300005367 | Ga0070667_100534680 | Ga0070667_1005346802 | 143 |
| 82 | 3300005445 | Ga0070708_100109882 | Ga0070708_1001098825 | 143 |
| 83 | 3300005445 | Ga0070708_100749967 | Ga0070708_1007499672 | 143 |
| 84 | 3300005445 | Ga0070708_100894200 | Ga0070708_1008942001 | 143 |
| 85 | 3300005455 | Ga0070663_100039064 | Ga0070663_1000390642 | 143 |
| 86 | 3300005457 | Ga0070662_100028743 | Ga0070662_1000287432 | 143 |
| 87 | 3300005459 | Ga0068867_100391495 | Ga0068867_1003914952 | 143 |
| 88 | 3300005459 | Ga0068867_101259079 | Ga0068867_1012590791 | 143 |
| 89 | 3300005466 | Ga0070685_10516511 | Ga0070685_105165111 | 143 |
| 90 | 3300005467 | Ga0070706_100031551 | Ga0070706_1000315513 | 143 |
| 91 | 3300005467 | Ga0070706_100143292 | Ga0070706_1001432923 | 143 |
| 92 | 3300005467 | Ga0070706_100386205 | Ga0070706_1003862052 | 143 |
| 93 | 3300005468 | Ga0070707_100009263 | Ga0070707_1000092637 | 143 |
| 94 | 3300005518 | Ga0070699_100085374 | Ga0070699_1000853743 | 143 |
| 95 | 3300005518 | Ga0070699_100578908 | Ga0070699_1005789081 | 143 |
| 96 | 3300005518 | Ga0070699_100584325 | Ga0070699_1005843252 | 143 |
| 97 | 3300005530 | Ga0070679_100194572 | Ga0070679_1001945722 | 143 |
| 98 | 3300005536 | Ga0070697_100024459 | Ga0070697_1000244592 | 143 |
| 99 | 3300005536 | Ga0070697_100094831 | Ga0070697_1000948313 | 143 |
| 100 | 3300005536 | Ga0070697_100348175 | Ga0070697_1003481753 | 143 |
| 101 | 3300005539 | Ga0068853_100313762 | Ga0068853_1003137622 | 143 |
| 102 | 3300005539 | Ga0068853_100934766 | Ga0068853_1009347662 | 143 |
| 103 | 3300005543 | Ga0070672_100051737 | Ga0070672_1000517374 | 143 |
| 104 | 3300005549 | Ga0070704_100679110 | Ga0070704_1006791102 | 143 |
| 105 | 3300005563 | Ga0068855_100405029 | Ga0068855_1004050292 | 143 |
| 106 | 3300005564 | Ga0070664_100053525 | Ga0070664_1000535256 | 143 |
| 107 | 3300005578 | Ga0068854_100592936 | Ga0068854_1005929362 | 143 |
| 108 | 3300005578 | Ga0068854_101266158 | Ga0068854_1012661582 | 143 |
| 109 | 3300005614 | Ga0068856_100150368 | Ga0068856_1001503683 | 143 |
| 110 | 3300005614 | Ga0068856_100531937 | Ga0068856_1005319372 | 143 |
| 111 | 3300005616 | Ga0068852_100027989 | Ga0068852_1000279892 | 143 |
| 112 | 3300005616 | Ga0068852_100336334 | Ga0068852_1003363342 | 143 |
| 113 | 3300005617 | Ga0068859_100290359 | Ga0068859_1002903592 | 143 |
| 114 | 3300005617 | Ga0068859_100635118 | Ga0068859_1006351182 | 143 |
| 115 | 3300005617 | Ga0068859_100655505 | Ga0068859_1006555052 | 143 |
| 116 | 3300005618 | Ga0068864_100218932 | Ga0068864_1002189323 | 143 |
| 117 | 3300005841 | Ga0068863_100543397 | Ga0068863_1005433973 | 143 |
| 118 | 3300005842 | Ga0068858_100206608 | Ga0068858_1002066083 | 143 |
| 119 | 3300005843 | Ga0068860_100671324 | Ga0068860_1006713241 | 143 |
| 120 | 3300006175 | Ga0070712_100114010 | Ga0070712_1001140102 | 143 |
| 121 | 3300006237 | Ga0097621_100119557 | Ga0097621_1001195572 | 143 |
| 122 | 3300006237 | Ga0097621_100479107 | Ga0097621_1004791073 | 143 |
| 123 | 3300006358 | Ga0068871_100336994 | Ga0068871_1003369943 | 143 |
| 124 | 3300006844 | Ga0075428_100807161 | Ga0075428_1008071611 | 143 |
| 125 | 3300006852 | Ga0075433_10090782 | Ga0075433_100907824 | 143 |
| 126 | 3300006881 | Ga0068865_100192050 | Ga0068865_1001920502 | 143 |
| 127 | 3300006881 | Ga0068865_100458014 | Ga0068865_1004580142 | 143 |
| 128 | 3300006914 | Ga0075436_100005947 | Ga0075436_1000059475 | 143 |
| 129 | 3300006931 | Ga0097620_100290356 | Ga0097620_1002903562 | 143 |
| 130 | 3300006931 | Ga0097620_100635248 | Ga0097620_1006352482 | 143 |
| 131 | 3300006931 | Ga0097620_100655532 | Ga0097620_1006555322 | 143 |
| 132 | 3300009093 | Ga0105240_10442592 | Ga0105240_104425923 | 143 |
| 133 | 3300009094 | Ga0111539_11332561 | Ga0111539_113325612 | 143 |
| 134 | 3300009101 | Ga0105247_10113503 | Ga0105247_101135034 | 143 |
| 135 | 3300009148 | Ga0105243_10483968 | Ga0105243_104839683 | 143 |
| 136 | 3300009174 | Ga0105241_10083578 | Ga0105241_100835785 | 143 |
| 137 | 3300009551 | Ga0105238_10456390 | Ga0105238_104563903 | 143 |
| 138 | 3300009553 | Ga0105249_10214757 | Ga0105249_102147573 | 143 |
| 139 | 3300009553 | Ga0105249_10565821 | Ga0105249_105658212 | 143 |
| 140 | 3300010375 | Ga0105239_10934173 | Ga0105239_109341733 | 143 |
| 141 | 3300013104 | Ga0157370_10026850 | Ga0157370_100268508 | 143 |
| 142 | 3300013105 | Ga0157369_10082072 | Ga0157369_100820723 | 143 |
| 143 | 3300013296 | Ga0157374_11666708 | Ga0157374_116667082 | 143 |
| 144 | 3300013297 | Ga0157378_10418046 | Ga0157378_104180463 | 143 |
| 145 | 3300013297 | Ga0157378_11616042 | Ga0157378_116160422 | 143 |
| 146 | 3300013297 | Ga0157378_13248015 | Ga0157378_132480151 | 143 |
| 147 | 3300013306 | Ga0163162_10381859 | Ga0163162_103818592 | 143 |
| 148 | 3300013308 | Ga0157375_10711342 | Ga0157375_107113422 | 143 |
| 149 | 3300014325 | Ga0163163_10044223 | Ga0163163_100442234 | 143 |
| 150 | 3300014969 | Ga0157376_10300743 | Ga0157376_103007433 | 143 |
| 151 | 3300017792 | Ga0163161_10151313 | Ga0163161_101513132 | 143 |
| 152 | 3300025898 | Ga0207692_10546202 | Ga0207692_105462022 | 143 |
| 153 | 3300025903 | Ga0207680_10247294 | Ga0207680_102472942 | 143 |
| 154 | 3300025910 | Ga0207684_10238168 | Ga0207684_102381683 | 143 |
| 155 | 3300025910 | Ga0207684_10356222 | Ga0207684_103562222 | 143 |
| 156 | 3300025913 | Ga0207695_10051403 | Ga0207695_100514037 | 143 |
| 157 | 3300025915 | Ga0207693_10115413 | Ga0207693_101154134 | 143 |
| 158 | 3300025916 | Ga0207663_10465014 | Ga0207663_104650142 | 143 |
| 159 | 3300025919 | Ga0207657_10001461 | Ga0207657_100014613 | 143 |
| 160 | 3300025919 | Ga0207657_10239010 | Ga0207657_102390103 | 143 |
| 161 | 3300025920 | Ga0207649_10480899 | Ga0207649_104808992 | 143 |
| 162 | 3300025921 | Ga0207652_10486517 | Ga0207652_104865172 | 143 |
| 163 | 3300025921 | Ga0207652_11177588 | Ga0207652_111775881 | 143 |
| 164 | 3300025922 | Ga0207646_10012067 | Ga0207646_100120675 | 143 |
| 165 | 3300025923 | Ga0207681_10284727 | Ga0207681_102847272 | 143 |
| 166 | 3300025924 | Ga0207694_10168388 | Ga0207694_101683884 | 143 |
| 167 | 3300025926 | Ga0207659_10056300 | Ga0207659_100563004 | 143 |
| 168 | 3300025926 | Ga0207659_10083196 | Ga0207659_100831964 | 143 |
| 169 | 3300025933 | Ga0207706_10000040 | Ga0207706_10000040107 | 143 |
| 170 | 3300025940 | Ga0207691_10061252 | Ga0207691_100612524 | 143 |
| 171 | 3300025942 | Ga0207689_10182301 | Ga0207689_101823013 | 143 |
| 172 | 3300025945 | Ga0207679_10241998 | Ga0207679_102419983 | 143 |
| 173 | 3300025945 | Ga0207679_10503125 | Ga0207679_105031252 | 143 |
| 174 | 3300025949 | Ga0207667_10019238 | Ga0207667_100192383 | 143 |
| 175 | 3300025949 | Ga0207667_10625301 | Ga0207667_106253011 | 143 |
| 176 | 3300025960 | Ga0207651_10044756 | Ga0207651_100447565 | 143 |
| 177 | 3300025961 | Ga0207712_10359158 | Ga0207712_103591582 | 143 |
| 178 | 3300025981 | Ga0207640_11423493 | Ga0207640_114234931 | 143 |
| 179 | 3300025986 | Ga0207658_10142804 | Ga0207658_101428043 | 143 |
| 180 | 3300025986 | Ga0207658_10357821 | Ga0207658_103578212 | 143 |
| 181 | 3300026035 | Ga0207703_10231569 | Ga0207703_102315692 | 143 |
| 182 | 3300026041 | Ga0207639_10086100 | Ga0207639_100861004 | 143 |
| 183 | 3300026067 | Ga0207678_10317164 | Ga0207678_103171642 | 143 |
| 184 | 3300026075 | Ga0207708_10266940 | Ga0207708_102669401 | 143 |
| 185 | 3300026088 | Ga0207641_10661231 | Ga0207641_106612313 | 143 |
| 186 | 3300026089 | Ga0207648_10145909 | Ga0207648_101459092 | 143 |
| 187 | 3300026089 | Ga0207648_10335833 | Ga0207648_103358333 | 143 |
| 188 | 3300026095 | Ga0207676_10384102 | Ga0207676_103841022 | 143 |
| 189 | 3300026121 | Ga0207683_10132085 | Ga0207683_101320853 | 143 |
| 190 | 3300026121 | Ga0207683_10315150 | Ga0207683_103151504 | 143 |
| 191 | 3300027665 | Ga0209983_1056047 | Ga0209983_10560472 | 143 |
| 192 | 3300027682 | Ga0209971_1041172 | Ga0209971_10411722 | 143 |
| 193 | 3300027695 | Ga0209966_1119218 | Ga0209966_11192181 | 143 |
| 194 | 3300027876 | Ga0209974_10076710 | Ga0209974_100767102 | 143 |
| 195 | 3300027907 | Ga0207428_10555945 | Ga0207428_105559452 | 143 |
| 196 | 3300028379 | Ga0268266_11412361 | Ga0268266_114123612 | 143 |
| 197 | 3300031249 | Ga0265339_10251065 | Ga0265339_102510652 | 143 |
| 198 | 3300031548 | Ga0307408_100957929 | Ga0307408_1009579292 | 143 |
| 199 | 3300031595 | Ga0265313_10021866 | Ga0265313_100218662 | 143 |
| 200 | 3300031712 | Ga0265342_10145161 | Ga0265342_101451612 | 143 |
| 201 | 3300031731 | Ga0307405_10339630 | Ga0307405_103396301 | 143 |
| 202 | 3300031824 | Ga0307413_11068577 | Ga0307413_110685772 | 143 |
| 203 | 3300031995 | Ga0307409_100089359 | Ga0307409_1000893593 | 143 |
| 204 | 3300035691 | Ga0373931_0175888 | Ga0373931_0175888_361_792 | 143 |
| 205 | 3300035725 | Ga0373947_0526835 | Ga0373947_0526835_83_514 | 143 |
| 206 | 3300037471 | Ga0395905_0098953 | Ga0395905_0098953_892_1323 | 143 |
| 207 | 3300037853 | Ga0436364_1300406 | Ga0436364_1300406_3255_3686 | 143 |
| 208 | 3300039437 | Ga0436365_1637745 | Ga0436365_1637745_4247_4678 | 143 |
| 209 | 3300039438 | Ga0436360_0929293 | Ga0436360_0929293_10_441 | 143 |
| 210 | 3300039450 | Ga0436363_0497578 | Ga0436363_0497578_210_641 | 143 |
| 211 | 3300045976 | Ga0466967_0107256 | Ga0466967_0107256_966_1406 | 143 |
| 212 | 3300046459 | Ga0495629_0094657 | Ga0495629_0094657_702_1133 | 143 |
| 213 | 3300046472 | Ga0495580_0742025 | Ga0495580_0742025_151_588 | 143 |
| 214 | 3300046476 | Ga0495662_0180028 | Ga0495662_0180028_436_867 | 143 |
| 215 | 3300046476 | Ga0495662_0294206 | Ga0495662_0294206_297_728 | 143 |
| 216 | 3300046533 | Ga0495640_0031593 | Ga0495640_0031593_2275_2706 | 143 |
| 217 | 3300046559 | Ga0495667_0348525 | Ga0495667_0348525_62_499 | 143 |
| 218 | 3300046559 | Ga0495667_0455344 | Ga0495667_0455344_45_476 | 143 |
| 219 | 3300046642 | Ga0495634_0205350 | Ga0495634_0205350_38_469 | 143 |
| 220 | 3300046663 | Ga0495635_0540881 | Ga0495635_0540881_270_701 | 143 |
| 221 | 3300046683 | Ga0495658_0367999 | Ga0495658_0367999_299_730 | 143 |
| 222 | 3300046689 | Ga0495613_0296003 | Ga0495613_0296003_252_683 | 143 |
| 223 | 3300046809 | Ga0495600_0381879 | Ga0495600_0381879_184_615 | 143 |
| 224 | 3300047315 | Ga0495581_0061891 | Ga0495581_0061891_634_1065 | 143 |
| 225 | 3300047319 | Ga0495674_0133850 | Ga0495674_0133850_1350_1781 | 143 |
| 226 | 3300047471 | Ga0495684_0043267 | Ga0495684_0043267_2843_3274 | 143 |
| 227 | 3300047471 | Ga0495684_0872302 | Ga0495684_0872302_116_562 | 143 |
| 228 | 3300048903 | Ga0496100_0486694 | Ga0496100_0486694_502_933 | 143 |
| 229 | 3300048905 | Ga0496102_0224247 | Ga0496102_0224247_548_979 | 143 |
| 230 | 3300048907 | Ga0496104_0209258 | Ga0496104_0209258_206_637 | 143 |
| 231 | 3300048907 | Ga0496104_1294941 | Ga0496104_1294941_124_555 | 143 |
| 232 | 3300048908 | Ga0496105_0261344 | Ga0496105_0261344_403_834 | 143 |
| 233 | 3300048908 | Ga0496105_0289820 | Ga0496105_0289820_94_525 | 143 |
| 234 | 3300048909 | Ga0496106_0010685 | Ga0496106_0010685_1737_2168 | 143 |
| 235 | 3300048910 | Ga0496107_0022136 | Ga0496107_0022136_1856_2287 | 143 |
| 236 | 3300048910 | Ga0496107_0196824 | Ga0496107_0196824_141_704 | 143 |
| 237 | 3300048911 | Ga0496108_0097284 | Ga0496108_0097284_1938_2369 | 143 |
| 238 | 3300048912 | Ga0496109_1662758 | Ga0496109_1662758_126_557 | 143 |
| 239 | 3300048913 | Ga0496110_0245393 | Ga0496110_0245393_1063_1494 | 143 |
| 240 | 3300048914 | Ga0496111_1298531 | Ga0496111_1298531_20_451 | 143 |
| 241 | 3300048918 | Ga0496115_0174904 | Ga0496115_0174904_895_1326 | 143 |
| 242 | 3300049570 | Ga0501033_0027594 | Ga0501033_0027594_1151_1582 | 143 |
| 243 | 3300049572 | Ga0501036_0073606 | Ga0501036_0073606_745_1176 | 143 |
| 244 | 3300049575 | Ga0501039_0299878 | Ga0501039_0299878_142_573 | 143 |
| 245 | 3300049577 | Ga0501041_0014021 | Ga0501041_0014021_3701_4132 | 143 |
| 246 | 3300049578 | Ga0501042_0134497 | Ga0501042_0134497_1089_1520 | 143 |
| 247 | 3300049579 | Ga0501043_0185698 | Ga0501043_0185698_238_675 | 143 |
| 248 | 3300049580 | Ga0501046_0043985 | Ga0501046_0043985_2745_3176 | 143 |
| 249 | 3300049582 | Ga0501048_0016147 | Ga0501048_0016147_1876_2307 | 143 |
| 250 | 3300049582 | Ga0501048_0072574 | Ga0501048_0072574_1816_2262 | 143 |
| 251 | 3300049583 | Ga0501067_0432001 | Ga0501067_0432001_270_701 | 143 |
| 252 | 3300049584 | Ga0501068_0129147 | Ga0501068_0129147_988_1419 | 143 |
| 253 | 3300049584 | Ga0501068_0526451 | Ga0501068_0526451_131_562 | 143 |
| 254 | 3300049584 | Ga0501068_0781700 | Ga0501068_0781700_112_543 | 143 |
| 255 | 3300049586 | Ga0501070_0879707 | Ga0501070_0879707_78_509 | 143 |
| 256 | 3300049588 | Ga0501072_0001691 | Ga0501072_0001691_13772_14203 | 143 |
| 257 | 3300049588 | Ga0501072_0004033 | Ga0501072_0004033_2613_3044 | 143 |
| 258 | 3300049588 | Ga0501072_0282135 | Ga0501072_0282135_257_703 | 143 |
| 259 | 3300049589 | Ga0501073_0263210 | Ga0501073_0263210_94_531 | 143 |
| 260 | 3300049591 | Ga0501075_0000008 | Ga0501075_0000008_40459_40890 | 143 |
| 261 | 3300049591 | Ga0501075_0811532 | Ga0501075_0811532_35_466 | 143 |
| 262 | 3300049592 | Ga0501076_0000004 | Ga0501076_0000004_83055_83486 | 143 |
| 263 | 3300049592 | Ga0501076_0198078 | Ga0501076_0198078_66_497 | 143 |
| 264 | 3300049592 | Ga0501076_0636473 | Ga0501076_0636473_394_840 | 143 |
| 265 | 3300049741 | Ga0501079_1027820 | Ga0501079_1027820_115_546 | 143 |
| 266 | 3300049741 | Ga0501079_1043139 | Ga0501079_1043139_64_495 | 143 |
| 267 | 3300049742 | Ga0501080_0191720 | Ga0501080_0191720_1127_1558 | 143 |
| 268 | 3300049742 | Ga0501080_0384394 | Ga0501080_0384394_97_528 | 143 |
| 269 | 3300049743 | Ga0501081_0000572 | Ga0501081_0000572_12644_13075 | 143 |
| 270 | 3300049743 | Ga0501081_0196172 | Ga0501081_0196172_646_1077 | 143 |
| 271 | 3300049822 | Ga0501035_0140046 | Ga0501035_0140046_365_796 | 143 |
| 272 | 3300049824 | Ga0501045_0017614 | Ga0501045_0017614_204_635 | 143 |
| 273 | 3300049824 | Ga0501045_0246429 | Ga0501045_0246429_132_563 | 143 |
| 274 | 3300050507 | nmdc:mga05p37_75833_c1 | nmdc:mga05p37_75833_c1_836_1267 | 143 |
| 275 | 3300050508 | nmdc:mga09592_23916_c1 | nmdc:mga09592_23916_c1_3256_3687 | 143 |
| 276 | 3300050511 | nmdc:mga08y16_682427_c1 | nmdc:mga08y16_682427_c1_458_895 | 143 |
| 277 | 3300050513 | nmdc:mga0rr50_1126911_c1 | nmdc:mga0rr50_1126911_c1_41_472 | 143 |
| 278 | 3300050514 | nmdc:mga08x19_162677_c1 | nmdc:mga08x19_162677_c1_660_1094 | 143 |
| 279 | 3300050514 | nmdc:mga08x19_974_c2 | nmdc:mga08x19_974_c2_3037_3468 | 143 |
| 280 | 3300053077 | Ga0495601_0011453 | Ga0495601_0011453_3840_4271 | 143 |
| 281 | 3300053083 | Ga0495655_0178317 | Ga0495655_0178317_157_588 | 143 |
| 282 | 3300053085 | Ga0495619_0007276 | Ga0495619_0007276_3411_3842 | 143 |
| 283 | 3300054114 | Ga0501084_0005113 | Ga0501084_0005113_708_1139 | 143 |
| 284 | 3300054114 | Ga0501084_0359458 | Ga0501084_0359458_542_988 | 143 |
| 285 | 3300060353 | Ga0501082_0008013 | Ga0501082_0008013_716_1147 | 143 |
| 286 | 3300060353 | Ga0501082_0274401 | Ga0501082_0274401_825_1271 | 143 |
| 287 | 3300061734 | Ga0530510_0000005 | Ga0530510_0000005_124711_125142 | 143 |
| 288 | 3300061734 | Ga0530510_0259356 | Ga0530510_0259356_454_900 | 143 |
| 289 | 3300061734 | Ga0530510_0396086 | Ga0530510_0396086_316_747 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vwo-assembly3.cif.gz_I | ta complex from mycobacterium tuberculosis | 0.9475 | 1 | 141 |
| 7vwo-assembly3.cif.gz_I | ta complex from mycobacterium tuberculosis | 0.9348 | 1 | 141 |
| 1w8i-assembly1.cif.gz_A-2 | the structure of gene product af1683 from archaeoglobus fulgidus. | 0.8032 | 1 | 130 |
| 5x3t-assembly1.cif.gz_H | vapbc from mycobacterium tuberculosis | 0.784 | 2 | 128 |
| 3zvk-assembly1.cif.gz_D | crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter | 0.7677 | 2 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WF69_2_135_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9682 | 3 | 135 | 3.40.50.1010 |
| af_P9WF55_1_133_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9578 | 1 | 132 | 3.40.50.1010 |
| af_O53501_3_137_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9572 | 4 | 136 | 3.40.50.1010 |
| af_P9WF69_2_135_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9542 | 3 | 135 | 3.40.50.1010 |
| af_P9WF85_2_140_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9531 | 3 | 138 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3PV32-F1-model_v4 | deleted | 0.9894 | 1 | 143 |
|
| AF-A0A7Y2HPM1-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9875 | 1 | 142 |
GO:0000287
GO:0004540 GO:0045926 GO:0090729 |
| AF-A0A418KWG0-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9872 | 1 | 143 |
GO:0000287
GO:0004540 GO:0045926 GO:0090729 |
| AF-A0A1Q3PV32-F1-model_v4 | deleted | 0.9826 | 1 | 143 |
|
| AF-A0A6L5FB73-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9821 | 2 | 143 |
GO:0000287
GO:0004540 GO:0045926 GO:0090729 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar