F389252

General Info

Members Datasets Scaffolds Average Seq Length
289 192 289 144

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10315150|Ga0207683_103151504
Length 157
Sequence MILVDANLLIYAHVSSFEQHAPAVSWLDAQLNGGGRVGLPWPSLLGFLRIVTNPRVFERPEPVARAWRQVQAWLEPDAVWIPQPTERHPDLLGSLVNAAGVQANLVPDAHLAALAIEHGLLLCTTDGDFGRFAGLRWQNPLTETRLGSNESPALSTL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.19
Rhizosphere 93.08
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5781307 2162886012 Bacteria 975
2 rootL2_10184862 3300003322 Bacteria 1499
3 Ga0065715_10152902 3300005293 Bacteria 1708
4 Ga0070683_100616222 3300005329 Unclassified 1039
5 Ga0070666_10273614 3300005335 Bacteria 1199
6 Ga0070682_100723767 3300005337 Bacteria 800
7 Ga0070660_100469123 3300005339 Bacteria 1045
8 Ga0070689_100369646 3300005340 Unclassified 1206
9 Ga0070687_100848892 3300005343 Bacteria 651
10 Ga0070661_100032915 3300005344 Bacteria 3754
11 Ga0070669_100136846 3300005353 Bacteria 1885
12 Ga0070669_100584779 3300005353 Bacteria 934
13 Ga0070675_100038608 3300005354 Bacteria 3893
14 Ga0070675_100791085 3300005354 Bacteria 867
15 Ga0070673_100021649 3300005364 Bacteria 4667
16 Ga0070673_101575369 3300005364 Bacteria 620
17 Ga0070688_100267400 3300005365 Bacteria 1224
18 Ga0070659_100012804 3300005366 Bacteria 6228
19 Ga0070667_100485136 3300005367 Bacteria 1132
20 Ga0070667_100534680 3300005367 Unclassified 1076
21 Ga0070711_100305696 3300005439 Bacteria 1266
22 Ga0070705_100052918 3300005440 Bacteria 2374
23 Ga0070708_100109882 3300005445 Unclassified 2533
24 Ga0070708_100749967 3300005445 Bacteria 918
25 Ga0070708_100894200 3300005445 Unclassified 834
26 Ga0070663_100028161 3300005455 Bacteria 3822
27 Ga0070663_100039064 3300005455 Bacteria 3315
28 Ga0070662_100028743 3300005457 Bacteria 3872
29 Ga0070681_10518510 3300005458 Bacteria 1105
30 Ga0068867_100391495 3300005459 Bacteria 1170
31 Ga0068867_101259079 3300005459 Unclassified 681
32 Ga0070685_10516511 3300005466 Unclassified 847
33 Ga0070706_100031551 3300005467 Unclassified 4885
34 Ga0070706_100143292 3300005467 Bacteria 2231
35 Ga0070706_100386205 3300005467 Bacteria 1303
36 Ga0070707_100009263 3300005468 Bacteria 9138
37 Ga0070699_100085374 3300005518 Bacteria 2755
38 Ga0070699_100578908 3300005518 Bacteria 1023
39 Ga0070699_100584325 3300005518 Bacteria 1018
40 Ga0070679_100194572 3300005530 Bacteria 1996
41 Ga0070679_100579890 3300005530 Bacteria 1065
42 Ga0070697_100024459 3300005536 Unclassified 4807
43 Ga0070697_100094831 3300005536 Bacteria 2473
44 Ga0070697_100348175 3300005536 Unclassified 1279
45 Ga0068853_100313762 3300005539 Unclassified 1452
46 Ga0068853_100934766 3300005539 Unclassified 833
47 Ga0070672_100051737 3300005543 Bacteria 3205
48 Ga0070695_100356793 3300005545 Bacteria 1097
49 Ga0070696_100009186 3300005546 Bacteria 6617
50 Ga0070693_101053830 3300005547 Bacteria 618
51 Ga0070704_100679110 3300005549 Unclassified 912
52 Ga0068855_100405029 3300005563 Unclassified 1494
53 Ga0068855_100548198 3300005563 Bacteria 1252
54 Ga0068855_100928026 3300005563 Unclassified 918
55 Ga0070664_100053525 3300005564 Bacteria 3421
56 Ga0068854_100592936 3300005578 Unclassified 945
57 Ga0068854_101266158 3300005578 Bacteria 663
58 Ga0068856_100150368 3300005614 Bacteria 2337
59 Ga0068856_100531937 3300005614 Unclassified 1197
60 Ga0068852_100027989 3300005616 Bacteria 4605
61 Ga0068852_100336334 3300005616 Bacteria 1470
62 Ga0068859_100290359 3300005617 Unclassified 1728
63 Ga0068859_100635118 3300005617 Bacteria 1160
64 Ga0068859_100655505 3300005617 Bacteria 1142
65 Ga0068864_100218932 3300005618 Bacteria 1756
66 Ga0068863_100543397 3300005841 Bacteria 1147
67 Ga0068858_100206608 3300005842 Bacteria 1858
68 Ga0068860_100671324 3300005843 Bacteria 1045
69 Ga0070712_100114010 3300006175 Unclassified 2023
70 Ga0097621_100119557 3300006237 Bacteria 2233
71 Ga0097621_100479107 3300006237 Bacteria 1125
72 Ga0068871_100336994 3300006358 Bacteria 1331
73 Ga0075428_100807161 3300006844 Bacteria 997
74 Ga0075433_10090782 3300006852 Unclassified 2700
75 Ga0075434_100901538 3300006871 Bacteria 899
76 Ga0068865_100192050 3300006881 Bacteria 1580
77 Ga0068865_100458014 3300006881 Bacteria 1056
78 Ga0075436_100005947 3300006914 Bacteria 8381
79 Ga0097620_100290356 3300006931 Unclassified 1728
80 Ga0097620_100635248 3300006931 Bacteria 1160
81 Ga0097620_100655532 3300006931 Bacteria 1142
82 Ga0105240_10263257 3300009093 Bacteria 1988
83 Ga0105240_10442592 3300009093 Unclassified 1456
84 Ga0111539_11332561 3300009094 Bacteria 833
85 Ga0105247_10113503 3300009101 Unclassified 1746
86 Ga0105243_10483968 3300009148 Bacteria 1169
87 Ga0105241_10083578 3300009174 Bacteria 2505
88 Ga0105238_10456390 3300009551 Unclassified 1275
89 Ga0105249_10214757 3300009553 Bacteria 1890
90 Ga0105249_10565821 3300009553 Bacteria 1189
91 Ga0105239_10934173 3300010375 Unclassified 996
92 Ga0157370_10026850 3300013104 Bacteria 5680
93 Ga0157369_10082072 3300013105 Bacteria 3449
94 Ga0157369_10841372 3300013105 Unclassified 942
95 Ga0157374_10418182 3300013296 Bacteria 1339
96 Ga0157374_11666708 3300013296 Unclassified 662
97 Ga0157378_10418046 3300013297 Bacteria 1325
98 Ga0157378_11263465 3300013297 Bacteria 779
99 Ga0157378_11616042 3300013297 Bacteria 694
100 Ga0157378_13248015 3300013297 Unclassified 505
101 Ga0163162_10381859 3300013306 Bacteria 1542
102 Ga0157375_10711342 3300013308 Bacteria 1158
103 Ga0163163_10044223 3300014325 Bacteria 4368
104 Ga0157376_10300743 3300014969 Bacteria 1519
105 Ga0163161_10151313 3300017792 Bacteria 1764
106 Ga0207692_10546202 3300025898 Unclassified 740
107 Ga0207680_10247294 3300025903 Bacteria 1231
108 Ga0207684_10238168 3300025910 Unclassified 1570
109 Ga0207684_10356222 3300025910 Unclassified 1259
110 Ga0207684_10869514 3300025910 Unclassified 759
111 Ga0207695_10051403 3300025913 Unclassified 4328
112 Ga0207695_10202140 3300025913 Bacteria 1900
113 Ga0207693_10115413 3300025915 Unclassified 2108
114 Ga0207663_10465014 3300025916 Bacteria 978
115 Ga0207657_10001461 3300025919 Bacteria 25304
116 Ga0207657_10239010 3300025919 Unclassified 1451
117 Ga0207649_10480899 3300025920 Unclassified 942
118 Ga0207652_10486517 3300025921 Bacteria 1111
119 Ga0207652_11177588 3300025921 Unclassified 668
120 Ga0207646_10012067 3300025922 Bacteria 8319
121 Ga0207681_10284727 3300025923 Bacteria 1303
122 Ga0207694_10168388 3300025924 Unclassified 1773
123 Ga0207659_10056300 3300025926 Bacteria 2816
124 Ga0207659_10083196 3300025926 Bacteria 2372
125 Ga0207700_10660735 3300025928 Bacteria 932
126 Ga0207644_10254528 3300025931 Bacteria 1402
127 Ga0207706_10000040 3300025933 Bacteria 132285
128 Ga0207691_10061252 3300025940 Bacteria 3418
129 Ga0207689_10182301 3300025942 Bacteria 1731
130 Ga0207679_10241998 3300025945 Bacteria 1529
131 Ga0207679_10503125 3300025945 Bacteria 1081
132 Ga0207667_10019238 3300025949 Bacteria 7633
133 Ga0207667_10027421 3300025949 Bacteria 6200
134 Ga0207667_10625301 3300025949 Unclassified 1084
135 Ga0207651_10044756 3300025960 Bacteria 2965
136 Ga0207712_10359158 3300025961 Bacteria 1213
137 Ga0207640_11423493 3300025981 Bacteria 621
138 Ga0207658_10142804 3300025986 Bacteria 1940
139 Ga0207658_10357821 3300025986 Unclassified 1273
140 Ga0207703_10231569 3300026035 Bacteria 1656
141 Ga0207639_10086100 3300026041 Bacteria 2501
142 Ga0207678_10317164 3300026067 Bacteria 1341
143 Ga0207708_10266940 3300026075 Bacteria 1383
144 Ga0207641_10661231 3300026088 Bacteria 1027
145 Ga0207648_10145909 3300026089 Bacteria 2087
146 Ga0207648_10335833 3300026089 Bacteria 1360
147 Ga0207676_10384102 3300026095 Bacteria 1308
148 Ga0207683_10132085 3300026121 Bacteria 2246
149 Ga0207683_10315150 3300026121 Unclassified 1432
150 Ga0209983_1056047 3300027665 Bacteria 867
151 Ga0209971_1041172 3300027682 Unclassified 1112
152 Ga0209966_1119218 3300027695 Bacteria 604
153 Ga0209974_10076710 3300027876 Bacteria 1145
154 Ga0207428_10555945 3300027907 Bacteria 830
155 Ga0268266_11412361 3300028379 Bacteria 672
156 Ga0265319_1006498 3300028563 Bacteria 5408
157 Ga0265320_10000110 3300031240 Bacteria 71074
158 Ga0265339_10251065 3300031249 Unclassified 856
159 Ga0307408_100957929 3300031548 Unclassified 786
160 Ga0265313_10021866 3300031595 Bacteria 3487
161 Ga0265342_10145161 3300031712 Bacteria 1321
162 Ga0307405_10339630 3300031731 Bacteria 1154
163 Ga0316577_10204619 3300031733 Bacteria 1116
164 Ga0307413_11068577 3300031824 Unclassified 695
165 Ga0307409_100089359 3300031995 Bacteria 2518
166 Ga0373931_0175888 3300035691 Bacteria 1264
167 Ga0373927_0003249 3300035695 Bacteria 11693
168 Ga0373947_0526835 3300035725 Unclassified 804
169 Ga0395905_0098953 3300037471 Bacteria 2739
170 Ga0436364_1300406 3300037853 Bacteria 4192
171 Ga0400483_271477 3300039062 Bacteria 2544
172 Ga0436365_1637745 3300039437 Bacteria 6778
173 Ga0436360_0195559 3300039438 Unclassified 1100
174 Ga0436360_0929293 3300039438 Unclassified 608
175 Ga0436363_0497578 3300039450 Unclassified 950
176 Ga0466963_0975211 3300044694 Unclassified 597
177 Ga0466967_0107256 3300045976 Bacteria 2562
178 Ga0466967_0733193 3300045976 Bacteria 980
179 Ga0495629_0094657 3300046459 Unclassified 2084
180 Ga0495580_0742025 3300046472 Bacteria 640
181 Ga0495662_0180028 3300046476 Bacteria 1042
182 Ga0495662_0294206 3300046476 Unclassified 799
183 Ga0495640_0031593 3300046533 Bacteria 3777
184 Ga0495667_0348525 3300046559 Unclassified 936
185 Ga0495667_0455344 3300046559 Bacteria 804
186 Ga0495634_0205350 3300046642 Unclassified 1222
187 Ga0495635_0540881 3300046663 Unclassified 764
188 Ga0495658_0367999 3300046683 Unclassified 914
189 Ga0495613_0296003 3300046689 Unclassified 1121
190 Ga0495600_0381879 3300046809 Unclassified 879
191 Ga0495581_0061891 3300047315 Unclassified 2163
192 Ga0495674_0133850 3300047319 Unclassified 2087
193 Ga0495684_0043267 3300047471 Bacteria 3448
194 Ga0495684_0872302 3300047471 Unclassified 582
195 Ga0496100_0486694 3300048903 Unclassified 949
196 Ga0496102_0224247 3300048905 Bacteria 1772
197 Ga0496104_0209258 3300048907 Bacteria 1862
198 Ga0496104_1294941 3300048907 Unclassified 632
199 Ga0496105_0261344 3300048908 Bacteria 1400
200 Ga0496105_0289820 3300048908 Bacteria 1318
201 Ga0496106_0010685 3300048909 Bacteria 6785
202 Ga0496107_0022136 3300048910 Bacteria 4491
203 Ga0496107_0196824 3300048910 Unclassified 1498
204 Ga0496108_0097284 3300048911 Bacteria 2508
205 Ga0496109_1662758 3300048912 Unclassified 572
206 Ga0496110_0245393 3300048913 Bacteria 1630
207 Ga0496111_1298531 3300048914 Bacteria 513
208 Ga0496114_0316448 3300048917 Bacteria 1379
209 Ga0496115_0174904 3300048918 Bacteria 1775
210 Ga0501033_0027594 3300049570 Bacteria 4269
211 Ga0501034_1035507 3300049571 Bacteria 704
212 Ga0501036_0073606 3300049572 Bacteria 2888
213 Ga0501036_0640742 3300049572 Unclassified 880
214 Ga0501039_0299878 3300049575 Bacteria 1263
215 Ga0501040_0343731 3300049576 Unclassified 1068
216 Ga0501041_0014021 3300049577 Bacteria 4755
217 Ga0501041_0162554 3300049577 Unclassified 1396
218 Ga0501041_0369515 3300049577 Unclassified 907
219 Ga0501042_0134497 3300049578 Bacteria 1782
220 Ga0501042_0728306 3300049578 Bacteria 721
221 Ga0501043_0185698 3300049579 Bacteria 1619
222 Ga0501043_0537335 3300049579 Unclassified 870
223 Ga0501046_0043985 3300049580 Bacteria 3553
224 Ga0501048_0016147 3300049582 Bacteria 5504
225 Ga0501048_0072574 3300049582 Bacteria 2430
226 Ga0501048_0680621 3300049582 Unclassified 739
227 Ga0501067_0432001 3300049583 Unclassified 735
228 Ga0501068_0129147 3300049584 Bacteria 1580
229 Ga0501068_0526451 3300049584 Unclassified 768
230 Ga0501068_0781700 3300049584 Bacteria 626
231 Ga0501070_0879707 3300049586 Unclassified 700
232 Ga0501071_0037468 3300049587 Bacteria 3463
233 Ga0501072_0001691 3300049588 Bacteria 16435
234 Ga0501072_0004033 3300049588 Bacteria 11114
235 Ga0501072_0106310 3300049588 Bacteria 2232
236 Ga0501072_0265250 3300049588 Bacteria 1367
237 Ga0501072_0282135 3300049588 Bacteria 1321
238 Ga0501073_0263210 3300049589 Bacteria 1190
239 Ga0501074_0187060 3300049590 Unclassified 1477
240 Ga0501074_0399505 3300049590 Bacteria 975
241 Ga0501075_0000008 3300049591 Bacteria 99121
242 Ga0501075_0052953 3300049591 Bacteria 3052
243 Ga0501075_0811532 3300049591 Unclassified 712
244 Ga0501076_0000004 3300049592 Bacteria 149972
245 Ga0501076_0013348 3300049592 Bacteria 6160
246 Ga0501076_0198078 3300049592 Bacteria 1640
247 Ga0501076_0376383 3300049592 Unclassified 1167
248 Ga0501076_0636473 3300049592 Bacteria 880
249 Ga0501077_0385026 3300049593 Bacteria 896
250 Ga0501079_0274248 3300049741 Unclassified 1318
251 Ga0501079_0294033 3300049741 Bacteria 1270
252 Ga0501079_1027820 3300049741 Bacteria 649
253 Ga0501079_1043139 3300049741 Unclassified 644
254 Ga0501080_0171973 3300049742 Bacteria 1998
255 Ga0501080_0191720 3300049742 Bacteria 1878
256 Ga0501080_0384394 3300049742 Bacteria 1264
257 Ga0501080_0682717 3300049742 Unclassified 907
258 Ga0501081_0000572 3300049743 Bacteria 20956
259 Ga0501081_0135607 3300049743 Bacteria 1762
260 Ga0501081_0196172 3300049743 Bacteria 1463
261 Ga0501035_0140046 3300049822 Bacteria 2104
262 Ga0501045_0017614 3300049824 Bacteria 5072
263 Ga0501045_0033211 3300049824 Bacteria 3742
264 Ga0501045_0246429 3300049824 Bacteria 1330
265 nmdc:mga05p37_75833_c1 3300050507 Unclassified 4140
266 nmdc:mga09592_23916_c1 3300050508 Bacteria 5049
267 nmdc:mga08y16_682427_c1 3300050511 Bacteria 1029
268 nmdc:mga0rr50_1126911_c1 3300050513 Unclassified 667
269 nmdc:mga08x19_162677_c1 3300050514 Bacteria 1516
270 nmdc:mga08x19_974_c2 3300050514 Bacteria 6866
271 nmdc:mga0a205_1318969_c1 3300050515 Unclassified 569
272 Ga0495601_0011453 3300053077 Bacteria 5305
273 Ga0495601_0592337 3300053077 Unclassified 712
274 Ga0495655_0178317 3300053083 Unclassified 684
275 Ga0495619_0007276 3300053085 Bacteria 7009
276 Ga0495619_1160682 3300053085 Unclassified 512
277 Ga0501084_0005113 3300054114 Bacteria 10739
278 Ga0501084_0034388 3300054114 Bacteria 4239
279 Ga0501084_0123668 3300054114 Bacteria 2176
280 Ga0501084_0359458 3300054114 Bacteria 1230
281 Ga0501082_0008013 3300060353 Bacteria 9120
282 Ga0501082_0274401 3300060353 Bacteria 1468
283 Ga0501082_0563990 3300060353 Bacteria 996
284 Ga0501082_0636045 3300060353 Bacteria 934
285 Ga0530510_0000005 3300061734 Bacteria 198759
286 Ga0530510_0004398 3300061734 Bacteria 9757
287 Ga0530510_0220324 3300061734 Bacteria 1410
288 Ga0530510_0259356 3300061734 Bacteria 1296
289 Ga0530510_0396086 3300061734 Unclassified 1040

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_271477 Ga0400483_271477_1776_2201 140
2 3300005337 Ga0070682_100723767 Ga0070682_1007237671 141
3 3300005455 Ga0070663_100028161 Ga0070663_1000281613 141
4 3300005563 Ga0068855_100548198 Ga0068855_1005481982 141
5 3300009093 Ga0105240_10263257 Ga0105240_102632573 141
6 3300013296 Ga0157374_10418182 Ga0157374_104181822 141
7 3300025913 Ga0207695_10202140 Ga0207695_102021403 141
8 3300025949 Ga0207667_10027421 Ga0207667_100274213 141
9 3300028563 Ga0265319_1006498 Ga0265319_10064984 141
10 3300031240 Ga0265320_10000110 Ga0265320_1000011016 141
11 3300044694 Ga0466963_0975211 Ga0466963_0975211_52_477 141
12 3300045976 Ga0466967_0733193 Ga0466967_0733193_110_535 141
13 3300048917 Ga0496114_0316448 Ga0496114_0316448_796_1221 141
14 3300050515 nmdc:mga0a205_1318969_c1 nmdc:mga0a205_1318969_c1_65_490 141
15 3300053077 Ga0495601_0592337 Ga0495601_0592337_188_613 141
16 3300005364 Ga0070673_101575369 Ga0070673_1015753691 142
17 3300005439 Ga0070711_100305696 Ga0070711_1003056962 142
18 3300005440 Ga0070705_100052918 Ga0070705_1000529183 142
19 3300005458 Ga0070681_10518510 Ga0070681_105185102 142
20 3300005530 Ga0070679_100579890 Ga0070679_1005798901 142
21 3300005545 Ga0070695_100356793 Ga0070695_1003567932 142
22 3300005546 Ga0070696_100009186 Ga0070696_1000091867 142
23 3300005547 Ga0070693_101053830 Ga0070693_1010538302 142
24 3300005563 Ga0068855_100928026 Ga0068855_1009280262 142
25 3300006871 Ga0075434_100901538 Ga0075434_1009015382 142
26 3300013105 Ga0157369_10841372 Ga0157369_108413722 142
27 3300013297 Ga0157378_11263465 Ga0157378_112634652 142
28 3300025910 Ga0207684_10869514 Ga0207684_108695141 142
29 3300025928 Ga0207700_10660735 Ga0207700_106607352 142
30 3300025931 Ga0207644_10254528 Ga0207644_102545283 142
31 3300031733 Ga0316577_10204619 Ga0316577_102046192 142
32 3300035695 Ga0373927_0003249 Ga0373927_0003249_10755_11183 142
33 3300039438 Ga0436360_0195559 Ga0436360_0195559_81_509 142
34 3300049571 Ga0501034_1035507 Ga0501034_1035507_85_513 142
35 3300049572 Ga0501036_0640742 Ga0501036_0640742_47_475 142
36 3300049576 Ga0501040_0343731 Ga0501040_0343731_135_563 142
37 3300049577 Ga0501041_0162554 Ga0501041_0162554_698_1126 142
38 3300049577 Ga0501041_0369515 Ga0501041_0369515_349_777 142
39 3300049578 Ga0501042_0728306 Ga0501042_0728306_41_469 142
40 3300049579 Ga0501043_0537335 Ga0501043_0537335_73_501 142
41 3300049582 Ga0501048_0680621 Ga0501048_0680621_130_582 142
42 3300049587 Ga0501071_0037468 Ga0501071_0037468_1233_1661 142
43 3300049588 Ga0501072_0106310 Ga0501072_0106310_415_843 142
44 3300049588 Ga0501072_0265250 Ga0501072_0265250_334_786 142
45 3300049590 Ga0501074_0187060 Ga0501074_0187060_622_1050 142
46 3300049590 Ga0501074_0399505 Ga0501074_0399505_422_874 142
47 3300049591 Ga0501075_0052953 Ga0501075_0052953_2214_2642 142
48 3300049592 Ga0501076_0013348 Ga0501076_0013348_5210_5638 142
49 3300049592 Ga0501076_0376383 Ga0501076_0376383_502_930 142
50 3300049593 Ga0501077_0385026 Ga0501077_0385026_34_462 142
51 3300049741 Ga0501079_0274248 Ga0501079_0274248_332_760 142
52 3300049741 Ga0501079_0294033 Ga0501079_0294033_106_558 142
53 3300049742 Ga0501080_0171973 Ga0501080_0171973_1261_1689 142
54 3300049742 Ga0501080_0682717 Ga0501080_0682717_80_532 142
55 3300049743 Ga0501081_0135607 Ga0501081_0135607_724_1176 142
56 3300049824 Ga0501045_0033211 Ga0501045_0033211_1742_2170 142
57 3300053085 Ga0495619_1160682 Ga0495619_1160682_12_440 142
58 3300054114 Ga0501084_0034388 Ga0501084_0034388_1746_2174 142
59 3300054114 Ga0501084_0123668 Ga0501084_0123668_1347_1799 142
60 3300060353 Ga0501082_0563990 Ga0501082_0563990_253_705 142
61 3300060353 Ga0501082_0636045 Ga0501082_0636045_310_738 142
62 3300061734 Ga0530510_0004398 Ga0530510_0004398_1622_2050 142
63 3300061734 Ga0530510_0220324 Ga0530510_0220324_850_1278 142
64 2162886012 MBSR1b_contig_5781307 MBSR1b_0217.00003380 143
65 3300003322 rootL2_10184862 rootL2_101848623 143
66 3300005293 Ga0065715_10152902 Ga0065715_101529022 143
67 3300005329 Ga0070683_100616222 Ga0070683_1006162222 143
68 3300005335 Ga0070666_10273614 Ga0070666_102736143 143
69 3300005339 Ga0070660_100469123 Ga0070660_1004691232 143
70 3300005340 Ga0070689_100369646 Ga0070689_1003696462 143
71 3300005343 Ga0070687_100848892 Ga0070687_1008488922 143
72 3300005344 Ga0070661_100032915 Ga0070661_1000329153 143
73 3300005353 Ga0070669_100136846 Ga0070669_1001368463 143
74 3300005353 Ga0070669_100584779 Ga0070669_1005847793 143
75 3300005354 Ga0070675_100038608 Ga0070675_1000386087 143
76 3300005354 Ga0070675_100791085 Ga0070675_1007910852 143
77 3300005364 Ga0070673_100021649 Ga0070673_1000216493 143
78 3300005365 Ga0070688_100267400 Ga0070688_1002674003 143
79 3300005366 Ga0070659_100012804 Ga0070659_1000128045 143
80 3300005367 Ga0070667_100485136 Ga0070667_1004851361 143
81 3300005367 Ga0070667_100534680 Ga0070667_1005346802 143
82 3300005445 Ga0070708_100109882 Ga0070708_1001098825 143
83 3300005445 Ga0070708_100749967 Ga0070708_1007499672 143
84 3300005445 Ga0070708_100894200 Ga0070708_1008942001 143
85 3300005455 Ga0070663_100039064 Ga0070663_1000390642 143
86 3300005457 Ga0070662_100028743 Ga0070662_1000287432 143
87 3300005459 Ga0068867_100391495 Ga0068867_1003914952 143
88 3300005459 Ga0068867_101259079 Ga0068867_1012590791 143
89 3300005466 Ga0070685_10516511 Ga0070685_105165111 143
90 3300005467 Ga0070706_100031551 Ga0070706_1000315513 143
91 3300005467 Ga0070706_100143292 Ga0070706_1001432923 143
92 3300005467 Ga0070706_100386205 Ga0070706_1003862052 143
93 3300005468 Ga0070707_100009263 Ga0070707_1000092637 143
94 3300005518 Ga0070699_100085374 Ga0070699_1000853743 143
95 3300005518 Ga0070699_100578908 Ga0070699_1005789081 143
96 3300005518 Ga0070699_100584325 Ga0070699_1005843252 143
97 3300005530 Ga0070679_100194572 Ga0070679_1001945722 143
98 3300005536 Ga0070697_100024459 Ga0070697_1000244592 143
99 3300005536 Ga0070697_100094831 Ga0070697_1000948313 143
100 3300005536 Ga0070697_100348175 Ga0070697_1003481753 143
101 3300005539 Ga0068853_100313762 Ga0068853_1003137622 143
102 3300005539 Ga0068853_100934766 Ga0068853_1009347662 143
103 3300005543 Ga0070672_100051737 Ga0070672_1000517374 143
104 3300005549 Ga0070704_100679110 Ga0070704_1006791102 143
105 3300005563 Ga0068855_100405029 Ga0068855_1004050292 143
106 3300005564 Ga0070664_100053525 Ga0070664_1000535256 143
107 3300005578 Ga0068854_100592936 Ga0068854_1005929362 143
108 3300005578 Ga0068854_101266158 Ga0068854_1012661582 143
109 3300005614 Ga0068856_100150368 Ga0068856_1001503683 143
110 3300005614 Ga0068856_100531937 Ga0068856_1005319372 143
111 3300005616 Ga0068852_100027989 Ga0068852_1000279892 143
112 3300005616 Ga0068852_100336334 Ga0068852_1003363342 143
113 3300005617 Ga0068859_100290359 Ga0068859_1002903592 143
114 3300005617 Ga0068859_100635118 Ga0068859_1006351182 143
115 3300005617 Ga0068859_100655505 Ga0068859_1006555052 143
116 3300005618 Ga0068864_100218932 Ga0068864_1002189323 143
117 3300005841 Ga0068863_100543397 Ga0068863_1005433973 143
118 3300005842 Ga0068858_100206608 Ga0068858_1002066083 143
119 3300005843 Ga0068860_100671324 Ga0068860_1006713241 143
120 3300006175 Ga0070712_100114010 Ga0070712_1001140102 143
121 3300006237 Ga0097621_100119557 Ga0097621_1001195572 143
122 3300006237 Ga0097621_100479107 Ga0097621_1004791073 143
123 3300006358 Ga0068871_100336994 Ga0068871_1003369943 143
124 3300006844 Ga0075428_100807161 Ga0075428_1008071611 143
125 3300006852 Ga0075433_10090782 Ga0075433_100907824 143
126 3300006881 Ga0068865_100192050 Ga0068865_1001920502 143
127 3300006881 Ga0068865_100458014 Ga0068865_1004580142 143
128 3300006914 Ga0075436_100005947 Ga0075436_1000059475 143
129 3300006931 Ga0097620_100290356 Ga0097620_1002903562 143
130 3300006931 Ga0097620_100635248 Ga0097620_1006352482 143
131 3300006931 Ga0097620_100655532 Ga0097620_1006555322 143
132 3300009093 Ga0105240_10442592 Ga0105240_104425923 143
133 3300009094 Ga0111539_11332561 Ga0111539_113325612 143
134 3300009101 Ga0105247_10113503 Ga0105247_101135034 143
135 3300009148 Ga0105243_10483968 Ga0105243_104839683 143
136 3300009174 Ga0105241_10083578 Ga0105241_100835785 143
137 3300009551 Ga0105238_10456390 Ga0105238_104563903 143
138 3300009553 Ga0105249_10214757 Ga0105249_102147573 143
139 3300009553 Ga0105249_10565821 Ga0105249_105658212 143
140 3300010375 Ga0105239_10934173 Ga0105239_109341733 143
141 3300013104 Ga0157370_10026850 Ga0157370_100268508 143
142 3300013105 Ga0157369_10082072 Ga0157369_100820723 143
143 3300013296 Ga0157374_11666708 Ga0157374_116667082 143
144 3300013297 Ga0157378_10418046 Ga0157378_104180463 143
145 3300013297 Ga0157378_11616042 Ga0157378_116160422 143
146 3300013297 Ga0157378_13248015 Ga0157378_132480151 143
147 3300013306 Ga0163162_10381859 Ga0163162_103818592 143
148 3300013308 Ga0157375_10711342 Ga0157375_107113422 143
149 3300014325 Ga0163163_10044223 Ga0163163_100442234 143
150 3300014969 Ga0157376_10300743 Ga0157376_103007433 143
151 3300017792 Ga0163161_10151313 Ga0163161_101513132 143
152 3300025898 Ga0207692_10546202 Ga0207692_105462022 143
153 3300025903 Ga0207680_10247294 Ga0207680_102472942 143
154 3300025910 Ga0207684_10238168 Ga0207684_102381683 143
155 3300025910 Ga0207684_10356222 Ga0207684_103562222 143
156 3300025913 Ga0207695_10051403 Ga0207695_100514037 143
157 3300025915 Ga0207693_10115413 Ga0207693_101154134 143
158 3300025916 Ga0207663_10465014 Ga0207663_104650142 143
159 3300025919 Ga0207657_10001461 Ga0207657_100014613 143
160 3300025919 Ga0207657_10239010 Ga0207657_102390103 143
161 3300025920 Ga0207649_10480899 Ga0207649_104808992 143
162 3300025921 Ga0207652_10486517 Ga0207652_104865172 143
163 3300025921 Ga0207652_11177588 Ga0207652_111775881 143
164 3300025922 Ga0207646_10012067 Ga0207646_100120675 143
165 3300025923 Ga0207681_10284727 Ga0207681_102847272 143
166 3300025924 Ga0207694_10168388 Ga0207694_101683884 143
167 3300025926 Ga0207659_10056300 Ga0207659_100563004 143
168 3300025926 Ga0207659_10083196 Ga0207659_100831964 143
169 3300025933 Ga0207706_10000040 Ga0207706_10000040107 143
170 3300025940 Ga0207691_10061252 Ga0207691_100612524 143
171 3300025942 Ga0207689_10182301 Ga0207689_101823013 143
172 3300025945 Ga0207679_10241998 Ga0207679_102419983 143
173 3300025945 Ga0207679_10503125 Ga0207679_105031252 143
174 3300025949 Ga0207667_10019238 Ga0207667_100192383 143
175 3300025949 Ga0207667_10625301 Ga0207667_106253011 143
176 3300025960 Ga0207651_10044756 Ga0207651_100447565 143
177 3300025961 Ga0207712_10359158 Ga0207712_103591582 143
178 3300025981 Ga0207640_11423493 Ga0207640_114234931 143
179 3300025986 Ga0207658_10142804 Ga0207658_101428043 143
180 3300025986 Ga0207658_10357821 Ga0207658_103578212 143
181 3300026035 Ga0207703_10231569 Ga0207703_102315692 143
182 3300026041 Ga0207639_10086100 Ga0207639_100861004 143
183 3300026067 Ga0207678_10317164 Ga0207678_103171642 143
184 3300026075 Ga0207708_10266940 Ga0207708_102669401 143
185 3300026088 Ga0207641_10661231 Ga0207641_106612313 143
186 3300026089 Ga0207648_10145909 Ga0207648_101459092 143
187 3300026089 Ga0207648_10335833 Ga0207648_103358333 143
188 3300026095 Ga0207676_10384102 Ga0207676_103841022 143
189 3300026121 Ga0207683_10132085 Ga0207683_101320853 143
190 3300026121 Ga0207683_10315150 Ga0207683_103151504 143
191 3300027665 Ga0209983_1056047 Ga0209983_10560472 143
192 3300027682 Ga0209971_1041172 Ga0209971_10411722 143
193 3300027695 Ga0209966_1119218 Ga0209966_11192181 143
194 3300027876 Ga0209974_10076710 Ga0209974_100767102 143
195 3300027907 Ga0207428_10555945 Ga0207428_105559452 143
196 3300028379 Ga0268266_11412361 Ga0268266_114123612 143
197 3300031249 Ga0265339_10251065 Ga0265339_102510652 143
198 3300031548 Ga0307408_100957929 Ga0307408_1009579292 143
199 3300031595 Ga0265313_10021866 Ga0265313_100218662 143
200 3300031712 Ga0265342_10145161 Ga0265342_101451612 143
201 3300031731 Ga0307405_10339630 Ga0307405_103396301 143
202 3300031824 Ga0307413_11068577 Ga0307413_110685772 143
203 3300031995 Ga0307409_100089359 Ga0307409_1000893593 143
204 3300035691 Ga0373931_0175888 Ga0373931_0175888_361_792 143
205 3300035725 Ga0373947_0526835 Ga0373947_0526835_83_514 143
206 3300037471 Ga0395905_0098953 Ga0395905_0098953_892_1323 143
207 3300037853 Ga0436364_1300406 Ga0436364_1300406_3255_3686 143
208 3300039437 Ga0436365_1637745 Ga0436365_1637745_4247_4678 143
209 3300039438 Ga0436360_0929293 Ga0436360_0929293_10_441 143
210 3300039450 Ga0436363_0497578 Ga0436363_0497578_210_641 143
211 3300045976 Ga0466967_0107256 Ga0466967_0107256_966_1406 143
212 3300046459 Ga0495629_0094657 Ga0495629_0094657_702_1133 143
213 3300046472 Ga0495580_0742025 Ga0495580_0742025_151_588 143
214 3300046476 Ga0495662_0180028 Ga0495662_0180028_436_867 143
215 3300046476 Ga0495662_0294206 Ga0495662_0294206_297_728 143
216 3300046533 Ga0495640_0031593 Ga0495640_0031593_2275_2706 143
217 3300046559 Ga0495667_0348525 Ga0495667_0348525_62_499 143
218 3300046559 Ga0495667_0455344 Ga0495667_0455344_45_476 143
219 3300046642 Ga0495634_0205350 Ga0495634_0205350_38_469 143
220 3300046663 Ga0495635_0540881 Ga0495635_0540881_270_701 143
221 3300046683 Ga0495658_0367999 Ga0495658_0367999_299_730 143
222 3300046689 Ga0495613_0296003 Ga0495613_0296003_252_683 143
223 3300046809 Ga0495600_0381879 Ga0495600_0381879_184_615 143
224 3300047315 Ga0495581_0061891 Ga0495581_0061891_634_1065 143
225 3300047319 Ga0495674_0133850 Ga0495674_0133850_1350_1781 143
226 3300047471 Ga0495684_0043267 Ga0495684_0043267_2843_3274 143
227 3300047471 Ga0495684_0872302 Ga0495684_0872302_116_562 143
228 3300048903 Ga0496100_0486694 Ga0496100_0486694_502_933 143
229 3300048905 Ga0496102_0224247 Ga0496102_0224247_548_979 143
230 3300048907 Ga0496104_0209258 Ga0496104_0209258_206_637 143
231 3300048907 Ga0496104_1294941 Ga0496104_1294941_124_555 143
232 3300048908 Ga0496105_0261344 Ga0496105_0261344_403_834 143
233 3300048908 Ga0496105_0289820 Ga0496105_0289820_94_525 143
234 3300048909 Ga0496106_0010685 Ga0496106_0010685_1737_2168 143
235 3300048910 Ga0496107_0022136 Ga0496107_0022136_1856_2287 143
236 3300048910 Ga0496107_0196824 Ga0496107_0196824_141_704 143
237 3300048911 Ga0496108_0097284 Ga0496108_0097284_1938_2369 143
238 3300048912 Ga0496109_1662758 Ga0496109_1662758_126_557 143
239 3300048913 Ga0496110_0245393 Ga0496110_0245393_1063_1494 143
240 3300048914 Ga0496111_1298531 Ga0496111_1298531_20_451 143
241 3300048918 Ga0496115_0174904 Ga0496115_0174904_895_1326 143
242 3300049570 Ga0501033_0027594 Ga0501033_0027594_1151_1582 143
243 3300049572 Ga0501036_0073606 Ga0501036_0073606_745_1176 143
244 3300049575 Ga0501039_0299878 Ga0501039_0299878_142_573 143
245 3300049577 Ga0501041_0014021 Ga0501041_0014021_3701_4132 143
246 3300049578 Ga0501042_0134497 Ga0501042_0134497_1089_1520 143
247 3300049579 Ga0501043_0185698 Ga0501043_0185698_238_675 143
248 3300049580 Ga0501046_0043985 Ga0501046_0043985_2745_3176 143
249 3300049582 Ga0501048_0016147 Ga0501048_0016147_1876_2307 143
250 3300049582 Ga0501048_0072574 Ga0501048_0072574_1816_2262 143
251 3300049583 Ga0501067_0432001 Ga0501067_0432001_270_701 143
252 3300049584 Ga0501068_0129147 Ga0501068_0129147_988_1419 143
253 3300049584 Ga0501068_0526451 Ga0501068_0526451_131_562 143
254 3300049584 Ga0501068_0781700 Ga0501068_0781700_112_543 143
255 3300049586 Ga0501070_0879707 Ga0501070_0879707_78_509 143
256 3300049588 Ga0501072_0001691 Ga0501072_0001691_13772_14203 143
257 3300049588 Ga0501072_0004033 Ga0501072_0004033_2613_3044 143
258 3300049588 Ga0501072_0282135 Ga0501072_0282135_257_703 143
259 3300049589 Ga0501073_0263210 Ga0501073_0263210_94_531 143
260 3300049591 Ga0501075_0000008 Ga0501075_0000008_40459_40890 143
261 3300049591 Ga0501075_0811532 Ga0501075_0811532_35_466 143
262 3300049592 Ga0501076_0000004 Ga0501076_0000004_83055_83486 143
263 3300049592 Ga0501076_0198078 Ga0501076_0198078_66_497 143
264 3300049592 Ga0501076_0636473 Ga0501076_0636473_394_840 143
265 3300049741 Ga0501079_1027820 Ga0501079_1027820_115_546 143
266 3300049741 Ga0501079_1043139 Ga0501079_1043139_64_495 143
267 3300049742 Ga0501080_0191720 Ga0501080_0191720_1127_1558 143
268 3300049742 Ga0501080_0384394 Ga0501080_0384394_97_528 143
269 3300049743 Ga0501081_0000572 Ga0501081_0000572_12644_13075 143
270 3300049743 Ga0501081_0196172 Ga0501081_0196172_646_1077 143
271 3300049822 Ga0501035_0140046 Ga0501035_0140046_365_796 143
272 3300049824 Ga0501045_0017614 Ga0501045_0017614_204_635 143
273 3300049824 Ga0501045_0246429 Ga0501045_0246429_132_563 143
274 3300050507 nmdc:mga05p37_75833_c1 nmdc:mga05p37_75833_c1_836_1267 143
275 3300050508 nmdc:mga09592_23916_c1 nmdc:mga09592_23916_c1_3256_3687 143
276 3300050511 nmdc:mga08y16_682427_c1 nmdc:mga08y16_682427_c1_458_895 143
277 3300050513 nmdc:mga0rr50_1126911_c1 nmdc:mga0rr50_1126911_c1_41_472 143
278 3300050514 nmdc:mga08x19_162677_c1 nmdc:mga08x19_162677_c1_660_1094 143
279 3300050514 nmdc:mga08x19_974_c2 nmdc:mga08x19_974_c2_3037_3468 143
280 3300053077 Ga0495601_0011453 Ga0495601_0011453_3840_4271 143
281 3300053083 Ga0495655_0178317 Ga0495655_0178317_157_588 143
282 3300053085 Ga0495619_0007276 Ga0495619_0007276_3411_3842 143
283 3300054114 Ga0501084_0005113 Ga0501084_0005113_708_1139 143
284 3300054114 Ga0501084_0359458 Ga0501084_0359458_542_988 143
285 3300060353 Ga0501082_0008013 Ga0501082_0008013_716_1147 143
286 3300060353 Ga0501082_0274401 Ga0501082_0274401_825_1271 143
287 3300061734 Ga0530510_0000005 Ga0530510_0000005_124711_125142 143
288 3300061734 Ga0530510_0259356 Ga0530510_0259356_454_900 143
289 3300061734 Ga0530510_0396086 Ga0530510_0396086_316_747 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

135

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.9475 1 141
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.9348 1 141
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.8032 1 130
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.784 2 128
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7677 2 139
ID Description Score Start End Superfamily
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9682 3 135 3.40.50.1010
af_P9WF55_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9578 1 132 3.40.50.1010
af_O53501_3_137_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9572 4 136 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9542 3 135 3.40.50.1010
af_P9WF85_2_140_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9531 3 138 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1Q3PV32-F1-model_v4 deleted 0.9894 1 143
AF-A0A7Y2HPM1-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9875 1 142 GO:0000287
GO:0004540
GO:0045926
GO:0090729
AF-A0A418KWG0-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9872 1 143 GO:0000287
GO:0004540
GO:0045926
GO:0090729
AF-A0A1Q3PV32-F1-model_v4 deleted 0.9826 1 143
AF-A0A6L5FB73-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9821 2 143 GO:0000287
GO:0004540
GO:0045926
GO:0090729

Feature Viewer

pLDDT pTM Quality
96.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map