F389053

General Info

Members Datasets Scaffolds Average Seq Length
289 177 578 193

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100007106|Ga0070707_1000071069
Length 228
Sequence MAGGRAGRLAGSSLRSAFAACWSWEGTGDRRVLILAFDTATAVATSALVDGDEVLGERVSRAQTLLEDVDALLRQAGAHPSDLDLLAVGLGPGSFTGVRIGLATARGLALSLDLPGAGVSTLAALAAGAPGALPVVDAKRREVFTLVDGEPRVLTPQELPLDGAPCIGDGAKRYRSLLEERGAVVPADDDERHLPRARFHAALAGEPGSVDELEPLYLRVPDAERNLR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 17.65
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100007106 3300005468 Bacteria 10380
2 Ga0070683_100153166 3300005329 Bacteria 2186
3 Ga0070682_100685162 3300005337 Unclassified 820
4 Ga0070682_100859331 3300005337 Bacteria 742
5 Ga0068868_100421120 3300005338 Bacteria 1156
6 Ga0070687_100655093 3300005343 Unclassified 728
7 Ga0070709_10132303 3300005434 Bacteria 1704
8 Ga0070714_100050816 3300005435 Bacteria 3533
9 Ga0070714_100065098 3300005435 Bacteria 3139
10 Ga0070714_100106907 3300005435 Bacteria 2472
11 Ga0070714_100435403 3300005435 Bacteria 1244
12 Ga0070713_100029034 3300005436 Bacteria 4374
13 Ga0070710_10007726 3300005437 Bacteria 5214
14 Ga0070711_100084466 3300005439 Bacteria 2271
15 Ga0070678_100331947 3300005456 Bacteria 1302
16 Ga0070678_100368240 3300005456 Bacteria 1240
17 Ga0070681_10180144 3300005458 Bacteria 2035
18 Ga0070706_100709188 3300005467 Bacteria 933
19 Ga0070706_100728772 3300005467 Unclassified 919
20 Ga0070698_100152739 3300005471 Bacteria 2255
21 Ga0070684_100124528 3300005535 Bacteria 2320
22 Ga0070684_100617790 3300005535 Unclassified 1008
23 Ga0070697_100983779 3300005536 Unclassified 750
24 Ga0070695_100000393 3300005545 Bacteria 22683
25 Ga0070665_100226719 3300005548 Bacteria 1869
26 Ga0070704_100230424 3300005549 Unclassified 1511
27 Ga0070704_100701002 3300005549 Bacteria 898
28 Ga0068856_100163686 3300005614 Bacteria 2236
29 Ga0068856_100386183 3300005614 Unclassified 1420
30 Ga0070702_100376635 3300005615 Unclassified 1008
31 Ga0070702_100578936 3300005615 Bacteria 838
32 Ga0068858_100796410 3300005842 Bacteria 922
33 Ga0081455_10045387 3300005937 Bacteria 3823
34 Ga0081539_10000030 3300005985 Bacteria 317236
35 Ga0081539_10004145 3300005985 Bacteria 16477
36 Ga0070717_10028548 3300006028 Bacteria 4467
37 Ga0070717_10124547 3300006028 Bacteria 2211
38 Ga0070717_10178937 3300006028 Bacteria 1847
39 Ga0070717_10903071 3300006028 Bacteria 804
40 Ga0070715_10018350 3300006163 Bacteria 2664
41 Ga0070716_100016476 3300006173 Bacteria 3815
42 Ga0070712_100122418 3300006175 Bacteria 1959
43 Ga0070712_100581956 3300006175 Bacteria 946
44 Ga0075367_10158684 3300006178 Bacteria 1406
45 Ga0075428_100000633 3300006844 Bacteria 36066
46 Ga0075430_100500205 3300006846 Bacteria 1003
47 Ga0075431_100012316 3300006847 Bacteria 8629
48 Ga0075433_10004670 3300006852 Bacteria 10682
49 Ga0075434_100001312 3300006871 Bacteria 20750
50 Ga0075434_100003445 3300006871 Bacteria 14140
51 Ga0075436_100055958 3300006914 Bacteria 2725
52 Ga0075435_100521496 3300007076 Bacteria 1028
53 Ga0105240_10200209 3300009093 Bacteria 2341
54 Ga0105240_10575272 3300009093 Unclassified 1243
55 Ga0105245_10189698 3300009098 Unclassified 1968
56 Ga0105245_10329381 3300009098 Bacteria 1507
57 Ga0105245_10453913 3300009098 Bacteria 1291
58 Ga0105245_10995570 3300009098 Bacteria 882
59 Ga0114129_10011894 3300009147 Bacteria 12381
60 Ga0114129_10021487 3300009147 Bacteria 9160
61 Ga0105237_10239618 3300009545 Bacteria 1815
62 Ga0105239_10387604 3300010375 Unclassified 1580
63 Ga0105246_10212950 3300011119 Unclassified 1509
64 Ga0105246_10537090 3300011119 Bacteria 1000
65 Ga0157370_10171872 3300013104 Bacteria 2014
66 Ga0157369_10878025 3300013105 Bacteria 920
67 Ga0157374_10030374 3300013296 Bacteria 4906
68 Ga0157372_10021043 3300013307 Bacteria 7044
69 Ga0157375_10373823 3300013308 Bacteria 1592
70 Ga0182008_10162639 3300014497 Bacteria 1124
71 Ga0157376_10056297 3300014969 Bacteria 3284
72 Ga0157376_10312945 3300014969 Bacteria 1490
73 Ga0207692_10116580 3300025898 Bacteria 1489
74 Ga0207685_10010826 3300025905 Bacteria 2714
75 Ga0207699_10049801 3300025906 Bacteria 2467
76 Ga0207699_10097332 3300025906 Bacteria 1860
77 Ga0207699_10200005 3300025906 Bacteria 1353
78 Ga0207684_10497769 3300025910 Bacteria 1045
79 Ga0207684_10845982 3300025910 Unclassified 771
80 Ga0207707_10148239 3300025912 Bacteria 2051
81 Ga0207707_10154079 3300025912 Bacteria 2009
82 Ga0207695_10208889 3300025913 Bacteria 1864
83 Ga0207671_10164564 3300025914 Bacteria 1719
84 Ga0207693_10000964 3300025915 Bacteria 25831
85 Ga0207693_10470443 3300025915 Bacteria 982
86 Ga0207663_10030999 3300025916 Bacteria 3159
87 Ga0207660_10709776 3300025917 Unclassified 820
88 Ga0207652_10179775 3300025921 Bacteria 1901
89 Ga0207652_10180762 3300025921 Bacteria 1896
90 Ga0207687_10122375 3300025927 Unclassified 1948
91 Ga0207687_10400354 3300025927 Bacteria 1129
92 Ga0207700_10008053 3300025928 Bacteria 6499
93 Ga0207700_10190416 3300025928 Bacteria 1723
94 Ga0207700_10345847 3300025928 Bacteria 1294
95 Ga0207664_10005790 3300025929 Bacteria 8451
96 Ga0207664_10077497 3300025929 Bacteria 2693
97 Ga0207664_10274336 3300025929 Bacteria 1478
98 Ga0207664_10314647 3300025929 Bacteria 1380
99 Ga0207669_10732718 3300025937 Bacteria 815
100 Ga0207665_10013449 3300025939 Bacteria 5381
101 Ga0207665_10113517 3300025939 Bacteria 1906
102 Ga0207665_10740028 3300025939 Bacteria 775
103 Ga0207661_10033983 3300025944 Bacteria 3961
104 Ga0207640_10421203 3300025981 Bacteria 1093
105 Ga0207677_10279429 3300026023 Bacteria 1370
106 Ga0207677_10308305 3300026023 Unclassified 1310
107 Ga0207702_10066214 3300026078 Bacteria 3096
108 Ga0207683_10094899 3300026121 Bacteria 2659
109 Ga0207683_10294754 3300026121 Bacteria 1484
110 Ga0207683_10550397 3300026121 Bacteria 1067
111 Ga0268266_10320453 3300028379 Bacteria 1451
112 Ga0268266_10777178 3300028379 Bacteria 925
113 Ga0265326_10022511 3300028558 Bacteria 1805
114 Ga0265319_1002945 3300028563 Bacteria 9062
115 Ga0265334_10009809 3300028573 Bacteria 4048
116 Ga0265318_10002950 3300028577 Bacteria 8818
117 Ga0265338_10021638 3300028800 Bacteria 6695
118 Ga0265338_10223108 3300028800 Bacteria 1406
119 Ga0265332_10018345 3300031238 Bacteria 3087
120 Ga0265320_10026485 3300031240 Bacteria 3033
121 Ga0265325_10000453 3300031241 Bacteria 29634
122 Ga0265329_10004254 3300031242 Bacteria 6011
123 Ga0265329_10088513 3300031242 Bacteria 982
124 Ga0265340_10003413 3300031247 Bacteria 8974
125 Ga0265339_10031744 3300031249 Bacteria 2983
126 Ga0265339_10044507 3300031249 Bacteria 2448
127 Ga0265331_10012453 3300031250 Bacteria 4607
128 Ga0265327_10010269 3300031251 Bacteria 6602
129 Ga0265327_10012478 3300031251 Bacteria 5726
130 Ga0265316_10033792 3300031344 Bacteria 4160
131 Ga0307408_100038495 3300031548 Bacteria 3375
132 Ga0265313_10025257 3300031595 Bacteria 3153
133 Ga0265313_10134040 3300031595 Bacteria 1070
134 Ga0265314_10002833 3300031711 Bacteria 17262
135 Ga0265314_10229258 3300031711 Bacteria 1078
136 Ga0265342_10002319 3300031712 Bacteria 16552
137 Ga0307405_10033868 3300031731 Bacteria 3035
138 Ga0307407_10142515 3300031903 Bacteria 1548
139 Ga0307407_10736841 3300031903 Unclassified 745
140 Ga0307416_100031278 3300032002 Bacteria 4004
141 Ga0307415_100008820 3300032126 Bacteria 5613
142 Ga0373940_0062736 3300035088 Bacteria 1067
143 Ga0373941_0093468 3300035115 Bacteria 1036
144 Ga0373957_0074724 3300035120 Unclassified 1331
145 Ga0373947_0323959 3300035725 Unclassified 1031
146 Ga0395899_0150809 3300037312 Bacteria 1648
147 Ga0395900_0080499 3300037418 Bacteria 3347
148 Ga0395898_0080416 3300037466 Bacteria 3143
149 Ga0395905_0199075 3300037471 Bacteria 1878
150 Ga0395901_0055982 3300038443 Bacteria 4102
151 Ga0450906_012588 3300042145 Bacteria 1567
152 Ga0450908_046175 3300042184 Bacteria 756
153 Ga0466966_0011932 3300044684 Bacteria 5759
154 Ga0466961_0240301 3300044693 Bacteria 1113
155 Ga0466963_0008918 3300044694 Bacteria 6020
156 Ga0466963_0018403 3300044694 Bacteria 4367
157 Ga0466963_0088523 3300044694 Bacteria 2106
158 Ga0466963_0498830 3300044694 Unclassified 859
159 Ga0466964_0001680 3300044706 Bacteria 7642
160 Ga0466964_0013423 3300044706 Bacteria 3108
161 Ga0466964_0051344 3300044706 Unclassified 1693
162 Ga0466964_0319274 3300044706 Bacteria 789
163 Ga0466971_0259034 3300044719 Bacteria 830
164 Ga0466968_0094151 3300044735 Bacteria 1331
165 Ga0466970_0055263 3300044765 Bacteria 2120
166 Ga0466957_0005089 3300044842 Bacteria 7355
167 Ga0466957_0010143 3300044842 Bacteria 5391
168 Ga0466960_0084253 3300044901 Bacteria 1608
169 Ga0466959_0004905 3300045049 Bacteria 9061
170 Ga0466967_0005346 3300045976 Bacteria 8876
171 Ga0466967_0110006 3300045976 Bacteria 2530
172 Ga0466967_0163747 3300045976 Bacteria 2089
173 Ga0466967_0190024 3300045976 Bacteria 1940
174 Ga0466967_0196063 3300045976 Bacteria 1910
175 Ga0466967_0196397 3300045976 Bacteria 1909
176 Ga0466967_0275485 3300045976 Bacteria 1613
177 Ga0466967_0328917 3300045976 Bacteria 1475
178 Ga0495592_0137657 3300046454 Bacteria 1701
179 Ga0495603_0123637 3300046455 Bacteria 1508
180 Ga0495603_0342097 3300046455 Unclassified 858
181 Ga0495629_0066526 3300046459 Bacteria 2515
182 Ga0495629_0591443 3300046459 Bacteria 743
183 Ga0495628_0253844 3300046516 Bacteria 1312
184 Ga0495652_0191875 3300046529 Bacteria 1558
185 Ga0495667_0105355 3300046559 Bacteria 1823
186 Ga0495635_0188680 3300046663 Bacteria 1400
187 Ga0495684_0018621 3300047471 Bacteria 5350
188 Ga0495602_0507515 3300048088 Bacteria 842
189 Ga0496100_0012368 3300048903 Bacteria 4890
190 Ga0496100_0611060 3300048903 Unclassified 847
191 Ga0496101_0043572 3300048904 Bacteria 3207
192 Ga0496101_0217460 3300048904 Bacteria 1482
193 Ga0496101_0878987 3300048904 Bacteria 706
194 Ga0496102_0435637 3300048905 Unclassified 1230
195 Ga0496102_0610519 3300048905 Bacteria 1014
196 Ga0496103_0019776 3300048906 Bacteria 4042
197 Ga0496103_0033037 3300048906 Bacteria 3160
198 Ga0496103_0077535 3300048906 Bacteria 2086
199 Ga0496103_0409610 3300048906 Bacteria 871
200 Ga0496104_0029020 3300048907 Bacteria 5129
201 Ga0496104_0338805 3300048907 Unclassified 1417
202 Ga0496105_0017975 3300048908 Bacteria 5674
203 Ga0496105_0115648 3300048908 Bacteria 2212
204 Ga0496106_0030374 3300048909 Bacteria 4030
205 Ga0496106_0443272 3300048909 Unclassified 1043
206 Ga0496107_0059855 3300048910 Bacteria 2756
207 Ga0496107_0190646 3300048910 Bacteria 1523
208 Ga0496107_0315811 3300048910 Bacteria 1163
209 Ga0496108_0008091 3300048911 Bacteria 8529
210 Ga0496108_0023961 3300048911 Bacteria 5024
211 Ga0496108_0031623 3300048911 Bacteria 4392
212 Ga0496108_0043075 3300048911 Bacteria 3770
213 Ga0496108_0048585 3300048911 Bacteria 3547
214 Ga0496108_0300323 3300048911 Bacteria 1399
215 Ga0496109_0006728 3300048912 Bacteria 9680
216 Ga0496109_0053696 3300048912 Bacteria 3675
217 Ga0496109_0145780 3300048912 Bacteria 2215
218 Ga0496109_0188001 3300048912 Bacteria 1940
219 Ga0496109_0377569 3300048912 Unclassified 1339
220 Ga0496110_0038024 3300048913 Bacteria 4185
221 Ga0496110_0153580 3300048913 Bacteria 2085
222 Ga0496110_0552673 3300048913 Unclassified 1046
223 Ga0496111_0021414 3300048914 Bacteria 4514
224 Ga0496111_0175512 3300048914 Bacteria 1593
225 Ga0496112_0022782 3300048915 Bacteria 5976
226 Ga0496112_0031731 3300048915 Bacteria 5125
227 Ga0496112_0059534 3300048915 Bacteria 3764
228 Ga0496112_0068960 3300048915 Bacteria 3493
229 Ga0496112_0100482 3300048915 Bacteria 2862
230 Ga0496112_0102958 3300048915 Bacteria 2824
231 Ga0496112_0188594 3300048915 Bacteria 2024
232 Ga0496112_0774122 3300048915 Bacteria 885
233 Ga0496114_0038035 3300048917 Bacteria 3981
234 Ga0496114_0091189 3300048917 Bacteria 2588
235 Ga0496114_0177566 3300048917 Bacteria 1858
236 Ga0496115_0096138 3300048918 Bacteria 2425
237 Ga0496115_0174521 3300048918 Unclassified 1777
238 Ga0496115_0244208 3300048918 Unclassified 1479
239 Ga0496115_0697624 3300048918 Bacteria 798
240 Ga0501031_0008058 3300049568 Bacteria 6861
241 Ga0501033_0077986 3300049570 Bacteria 2431
242 Ga0501036_0317270 3300049572 Bacteria 1302
243 Ga0501037_0062261 3300049573 Bacteria 2720
244 Ga0501038_0018170 3300049574 Bacteria 6349
245 Ga0501039_0077581 3300049575 Bacteria 2583
246 Ga0501040_0041617 3300049576 Bacteria 3129
247 Ga0501041_0053586 3300049577 Bacteria 2460
248 Ga0501042_0024793 3300049578 Bacteria 4209
249 Ga0501043_0101460 3300049579 Bacteria 2262
250 Ga0501046_0025830 3300049580 Bacteria 4802
251 Ga0501048_0007276 3300049582 Bacteria 8393
252 Ga0501048_0081999 3300049582 Bacteria 2275
253 Ga0501069_0047246 3300049585 Bacteria 2389
254 Ga0501070_0462291 3300049586 Unclassified 1022
255 Ga0501071_0005798 3300049587 Bacteria 7975
256 Ga0501071_0108234 3300049587 Bacteria 2053
257 Ga0501071_0304236 3300049587 Bacteria 1209
258 Ga0501072_0067865 3300049588 Bacteria 2814
259 Ga0501074_0007879 3300049590 Bacteria 7716
260 Ga0501075_0001972 3300049591 Bacteria 13549
261 Ga0501076_0017767 3300049592 Bacteria 5407
262 Ga0501077_0006465 3300049593 Bacteria 7193
263 Ga0501079_0061791 3300049741 Bacteria 2889
264 Ga0501080_0138202 3300049742 Bacteria 2254
265 Ga0501081_0066317 3300049743 Bacteria 2510
266 Ga0501083_0095980 3300049744 Bacteria 1956
267 Ga0501035_0134177 3300049822 Bacteria 2156
268 Ga0501045_0000934 3300049824 Bacteria 19088
269 Ga0501045_0279822 3300049824 Bacteria 1242
270 nmdc:mga05p37_129574_c1 3300050507 Bacteria 3096
271 nmdc:mga05p37_5262_c1 3300050507 Bacteria 15187
272 nmdc:mga05p37_543816_c1 3300050507 Unclassified 1324
273 nmdc:mga06r32_32083_c1 3300050510 Bacteria 4938
274 nmdc:mga06r32_348661_c1 3300050510 Bacteria 1465
275 nmdc:mga08y16_291931_c1 3300050511 Bacteria 1681
276 nmdc:mga0n895_5602_c1 3300050512 Bacteria 10514
277 nmdc:mga0n895_713545_c1 3300050512 Unclassified 998
278 nmdc:mga0rr50_52507_c1 3300050513 Bacteria 3030
279 nmdc:mga0rr50_786098_c1 3300050513 Unclassified 812
280 nmdc:mga08x19_176452_c1 3300050514 Bacteria 1457
281 nmdc:mga08x19_224772_c1 3300050514 Unclassified 1291
282 nmdc:mga0a205_264996_c1 3300050515 Unclassified 1596
283 Ga0495601_0248994 3300053077 Bacteria 1160
284 Ga0501084_0011614 3300054114 Bacteria 7288
285 Ga0501084_0410224 3300054114 Bacteria 1145
286 Ga0501084_0444546 3300054114 Bacteria 1096
287 Ga0590075_074662 3300059424 Bacteria 877
288 Ga0501082_0010748 3300060353 Bacteria 7879
289 Ga0530510_0005451 3300061734 Bacteria 8805
290 Ga0070707_100007106
291 Ga0070683_100153166
292 Ga0070682_100685162
293 Ga0070682_100859331
294 Ga0068868_100421120
295 Ga0070687_100655093
296 Ga0070709_10132303
297 Ga0070714_100050816
298 Ga0070714_100065098
299 Ga0070714_100106907
300 Ga0070714_100435403
301 Ga0070713_100029034
302 Ga0070710_10007726
303 Ga0070711_100084466
304 Ga0070678_100331947
305 Ga0070678_100368240
306 Ga0070681_10180144
307 Ga0070706_100709188
308 Ga0070706_100728772
309 Ga0070698_100152739
310 Ga0070684_100124528
311 Ga0070684_100617790
312 Ga0070697_100983779
313 Ga0070695_100000393
314 Ga0070665_100226719
315 Ga0070704_100230424
316 Ga0070704_100701002
317 Ga0068856_100163686
318 Ga0068856_100386183
319 Ga0070702_100376635
320 Ga0070702_100578936
321 Ga0068858_100796410
322 Ga0081455_10045387
323 Ga0081539_10000030
324 Ga0081539_10004145
325 Ga0070717_10028548
326 Ga0070717_10124547
327 Ga0070717_10178937
328 Ga0070717_10903071
329 Ga0070715_10018350
330 Ga0070716_100016476
331 Ga0070712_100122418
332 Ga0070712_100581956
333 Ga0075367_10158684
334 Ga0075428_100000633
335 Ga0075430_100500205
336 Ga0075431_100012316
337 Ga0075433_10004670
338 Ga0075434_100001312
339 Ga0075434_100003445
340 Ga0075436_100055958
341 Ga0075435_100521496
342 Ga0105240_10200209
343 Ga0105240_10575272
344 Ga0105245_10189698
345 Ga0105245_10329381
346 Ga0105245_10453913
347 Ga0105245_10995570
348 Ga0114129_10011894
349 Ga0114129_10021487
350 Ga0105237_10239618
351 Ga0105239_10387604
352 Ga0105246_10212950
353 Ga0105246_10537090
354 Ga0157370_10171872
355 Ga0157369_10878025
356 Ga0157374_10030374
357 Ga0157372_10021043
358 Ga0157375_10373823
359 Ga0182008_10162639
360 Ga0157376_10056297
361 Ga0157376_10312945
362 Ga0207692_10116580
363 Ga0207685_10010826
364 Ga0207699_10049801
365 Ga0207699_10097332
366 Ga0207699_10200005
367 Ga0207684_10497769
368 Ga0207684_10845982
369 Ga0207707_10148239
370 Ga0207707_10154079
371 Ga0207695_10208889
372 Ga0207671_10164564
373 Ga0207693_10000964
374 Ga0207693_10470443
375 Ga0207663_10030999
376 Ga0207660_10709776
377 Ga0207652_10179775
378 Ga0207652_10180762
379 Ga0207687_10122375
380 Ga0207687_10400354
381 Ga0207700_10008053
382 Ga0207700_10190416
383 Ga0207700_10345847
384 Ga0207664_10005790
385 Ga0207664_10077497
386 Ga0207664_10274336
387 Ga0207664_10314647
388 Ga0207669_10732718
389 Ga0207665_10013449
390 Ga0207665_10113517
391 Ga0207665_10740028
392 Ga0207661_10033983
393 Ga0207640_10421203
394 Ga0207677_10279429
395 Ga0207677_10308305
396 Ga0207702_10066214
397 Ga0207683_10094899
398 Ga0207683_10294754
399 Ga0207683_10550397
400 Ga0268266_10320453
401 Ga0268266_10777178
402 Ga0265326_10022511
403 Ga0265319_1002945
404 Ga0265334_10009809
405 Ga0265318_10002950
406 Ga0265338_10021638
407 Ga0265338_10223108
408 Ga0265332_10018345
409 Ga0265320_10026485
410 Ga0265325_10000453
411 Ga0265329_10004254
412 Ga0265329_10088513
413 Ga0265340_10003413
414 Ga0265339_10031744
415 Ga0265339_10044507
416 Ga0265331_10012453
417 Ga0265327_10010269
418 Ga0265327_10012478
419 Ga0265316_10033792
420 Ga0307408_100038495
421 Ga0265313_10025257
422 Ga0265313_10134040
423 Ga0265314_10002833
424 Ga0265314_10229258
425 Ga0265342_10002319
426 Ga0307405_10033868
427 Ga0307407_10142515
428 Ga0307407_10736841
429 Ga0307416_100031278
430 Ga0307415_100008820
431 Ga0373940_0062736
432 Ga0373941_0093468
433 Ga0373957_0074724
434 Ga0373947_0323959
435 Ga0395899_0150809
436 Ga0395900_0080499
437 Ga0395898_0080416
438 Ga0395905_0199075
439 Ga0395901_0055982
440 Ga0450906_012588
441 Ga0450908_046175
442 Ga0466966_0011932
443 Ga0466961_0240301
444 Ga0466963_0008918
445 Ga0466963_0018403
446 Ga0466963_0088523
447 Ga0466963_0498830
448 Ga0466964_0001680
449 Ga0466964_0013423
450 Ga0466964_0051344
451 Ga0466964_0319274
452 Ga0466971_0259034
453 Ga0466968_0094151
454 Ga0466970_0055263
455 Ga0466957_0005089
456 Ga0466957_0010143
457 Ga0466960_0084253
458 Ga0466959_0004905
459 Ga0466967_0005346
460 Ga0466967_0110006
461 Ga0466967_0163747
462 Ga0466967_0190024
463 Ga0466967_0196063
464 Ga0466967_0196397
465 Ga0466967_0275485
466 Ga0466967_0328917
467 Ga0495592_0137657
468 Ga0495603_0123637
469 Ga0495603_0342097
470 Ga0495629_0066526
471 Ga0495629_0591443
472 Ga0495628_0253844
473 Ga0495652_0191875
474 Ga0495667_0105355
475 Ga0495635_0188680
476 Ga0495684_0018621
477 Ga0495602_0507515
478 Ga0496100_0012368
479 Ga0496100_0611060
480 Ga0496101_0043572
481 Ga0496101_0217460
482 Ga0496101_0878987
483 Ga0496102_0435637
484 Ga0496102_0610519
485 Ga0496103_0019776
486 Ga0496103_0033037
487 Ga0496103_0077535
488 Ga0496103_0409610
489 Ga0496104_0029020
490 Ga0496104_0338805
491 Ga0496105_0017975
492 Ga0496105_0115648
493 Ga0496106_0030374
494 Ga0496106_0443272
495 Ga0496107_0059855
496 Ga0496107_0190646
497 Ga0496107_0315811
498 Ga0496108_0008091
499 Ga0496108_0023961
500 Ga0496108_0031623
501 Ga0496108_0043075
502 Ga0496108_0048585
503 Ga0496108_0300323
504 Ga0496109_0006728
505 Ga0496109_0053696
506 Ga0496109_0145780
507 Ga0496109_0188001
508 Ga0496109_0377569
509 Ga0496110_0038024
510 Ga0496110_0153580
511 Ga0496110_0552673
512 Ga0496111_0021414
513 Ga0496111_0175512
514 Ga0496112_0022782
515 Ga0496112_0031731
516 Ga0496112_0059534
517 Ga0496112_0068960
518 Ga0496112_0100482
519 Ga0496112_0102958
520 Ga0496112_0188594
521 Ga0496112_0774122
522 Ga0496114_0038035
523 Ga0496114_0091189
524 Ga0496114_0177566
525 Ga0496115_0096138
526 Ga0496115_0174521
527 Ga0496115_0244208
528 Ga0496115_0697624
529 Ga0501031_0008058
530 Ga0501033_0077986
531 Ga0501036_0317270
532 Ga0501037_0062261
533 Ga0501038_0018170
534 Ga0501039_0077581
535 Ga0501040_0041617
536 Ga0501041_0053586
537 Ga0501042_0024793
538 Ga0501043_0101460
539 Ga0501046_0025830
540 Ga0501048_0007276
541 Ga0501048_0081999
542 Ga0501069_0047246
543 Ga0501070_0462291
544 Ga0501071_0005798
545 Ga0501071_0108234
546 Ga0501071_0304236
547 Ga0501072_0067865
548 Ga0501074_0007879
549 Ga0501075_0001972
550 Ga0501076_0017767
551 Ga0501077_0006465
552 Ga0501079_0061791
553 Ga0501080_0138202
554 Ga0501081_0066317
555 Ga0501083_0095980
556 Ga0501035_0134177
557 Ga0501045_0000934
558 Ga0501045_0279822
559 nmdc:mga05p37_129574_c1
560 nmdc:mga05p37_5262_c1
561 nmdc:mga05p37_543816_c1
562 nmdc:mga06r32_32083_c1
563 nmdc:mga06r32_348661_c1
564 nmdc:mga08y16_291931_c1
565 nmdc:mga0n895_5602_c1
566 nmdc:mga0n895_713545_c1
567 nmdc:mga0rr50_52507_c1
568 nmdc:mga0rr50_786098_c1
569 nmdc:mga08x19_176452_c1
570 nmdc:mga08x19_224772_c1
571 nmdc:mga0a205_264996_c1
572 Ga0495601_0248994
573 Ga0501084_0011614
574 Ga0501084_0410224
575 Ga0501084_0444546
576 Ga0590075_074662
577 Ga0501082_0010748
578 Ga0530510_0005451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

55

158

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zyy-assembly1.cif.gz_X reductive activator for corrinoid,iron-sulfur protein 0.8423 8 71
6k78-assembly1.cif.gz_A glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.8388 9 66
4c1n-assembly4.cif.gz_X corrinoid protein reactivation complex with activator 0.8365 6 65
2d4w-assembly1.cif.gz_B crystal structure of glycerol kinase from cellulomonas sp. nt3060 0.826 9 69
1bo5-assembly1.cif.gz_O crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. 0.8178 7 69
ID Description Score Start End Superfamily
3zyyY03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Domain of unknown function (DUF4445) 0.8784 8 65 3.30.420.480
af_Q93170_24_150_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.877 11 70 3.30.420.40
af_Q9VV41_3_120_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8634 11 71 3.30.420.40
af_Q2FWL2_8_131_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8552 12 71 3.30.420.40
af_Q9NPF4_5_132_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8487 14 71 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A538GBA2-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9275 9 187 GO:0002949
GO:0016740
AF-A0A2V2S8N4-F1-model_v4 deleted 0.925 6 166
AF-A0A7V9SU76-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9157 9 188 GO:0002949
GO:0005829
GO:0016740
AF-A0A538FM41-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9075 2 187 GO:0002949
GO:0016740
AF-A0A1Q6XGV2-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.8896 9 143 GO:0002949
GO:0016740

Map