F388994

General Info

Members Datasets Scaffolds Average Seq Length
289 170 578 197

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100303992|Ga0070683_1003039922
Length 212
Sequence MTSLRHIAPAQALETAVADAGPQAAYLDAARACILDVGWRRTTLTEVARRAGVSRMTIYRTWKDMSAVLGDLMTREWGEVVARAVEGADGALATDATAADRIVAEVVATTRALRDNELFVRIVELDPELLLPYLLIRRGRSQQAIADLTAGRLRAGQADGSVRDGSPVAMARALLLACHGFVLSRHTMVDDEVDADALDTELEHLVRSVVSR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 2643221561 Nocardioides sp. Root151 Isolate Unclassified
165 2643221641 Nocardioides sp. Root122 Isolate Unclassified
166 2643221696 Nocardioides sp. Root140 Isolate Unclassified
167 2739367898 Nocardioides sp. CF479 Isolate Unclassified
168 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
169 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
170 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 0.35
Rhizoplane 15.22
Rhizosphere 76.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100303992 3300005329 Bacteria 1518
2 JGI24737J22298_10069812 3300001990 Bacteria 1049
3 Ga0070658_10005824 3300005327 Bacteria 9985
4 Ga0070658_10386141 3300005327 Bacteria 1202
5 Ga0070658_10638033 3300005327 Bacteria 924
6 Ga0070683_100004062 3300005329 Bacteria 11988
7 Ga0070683_100004459 3300005329 Bacteria 11548
8 Ga0070683_100044848 3300005329 Bacteria 4079
9 Ga0070670_100080987 3300005331 Bacteria 2790
10 Ga0068869_100199470 3300005334 Bacteria 1577
11 Ga0070682_100035811 3300005337 Bacteria 3032
12 Ga0068868_100026831 3300005338 Bacteria 4392
13 Ga0070691_10176357 3300005341 Bacteria 1110
14 Ga0070687_100653780 3300005343 Bacteria 729
15 Ga0070692_10064717 3300005345 Bacteria 1934
16 Ga0070668_100192520 3300005347 Bacteria 1671
17 Ga0070675_100316491 3300005354 Bacteria 1378
18 Ga0070671_100666902 3300005355 Bacteria 901
19 Ga0070659_100007088 3300005366 Bacteria 8128
20 Ga0070667_100916886 3300005367 Bacteria 816
21 Ga0070662_100342730 3300005457 Bacteria 1223
22 Ga0070681_10376599 3300005458 Bacteria 1330
23 Ga0070685_10485359 3300005466 Bacteria 872
24 Ga0070679_100015915 3300005530 Bacteria 7240
25 Ga0070684_100004495 3300005535 Bacteria 10614
26 Ga0070684_100238547 3300005535 Bacteria 1661
27 Ga0070684_100345586 3300005535 Bacteria 1368
28 Ga0070684_100479866 3300005535 Bacteria 1151
29 Ga0070686_100068895 3300005544 Bacteria 2309
30 Ga0070693_100239741 3300005547 Bacteria 1197
31 Ga0070665_100001173 3300005548 Bacteria 32094
32 Ga0070665_100056821 3300005548 Bacteria 3924
33 Ga0070665_100737720 3300005548 Bacteria 998
34 Ga0068855_100082897 3300005563 Bacteria 3716
35 Ga0068857_100031807 3300005577 Bacteria 4663
36 Ga0068857_100644039 3300005577 Bacteria 1004
37 Ga0068856_100065638 3300005614 Bacteria 3587
38 Ga0068856_101369803 3300005614 Bacteria 722
39 Ga0070702_100161805 3300005615 Bacteria 1448
40 Ga0068852_100091968 3300005616 Bacteria 2716
41 Ga0068864_100103236 3300005618 Bacteria 2531
42 Ga0068866_10664598 3300005718 Bacteria 711
43 Ga0068861_100242354 3300005719 Bacteria 1534
44 Ga0068861_100248001 3300005719 Bacteria 1518
45 Ga0068861_100883879 3300005719 Bacteria 845
46 Ga0068863_101177828 3300005841 Bacteria 772
47 Ga0068858_100029115 3300005842 Bacteria 5128
48 Ga0068860_100025265 3300005843 Bacteria 5733
49 Ga0068860_100553124 3300005843 Bacteria 1153
50 Ga0068862_100156744 3300005844 Bacteria 2030
51 Ga0081539_10021063 3300005985 Bacteria 4373
52 Ga0075365_10035789 3300006038 Bacteria 3214
53 Ga0075365_10277117 3300006038 Bacteria 1180
54 Ga0075365_10339310 3300006038 Bacteria 1059
55 Ga0075365_10499169 3300006038 Bacteria 860
56 Ga0075365_10510562 3300006038 Bacteria 850
57 Ga0075363_100175674 3300006048 Bacteria 1217
58 Ga0075367_10051916 3300006178 Bacteria 2425
59 Ga0075370_10116130 3300006353 Bacteria 1556
60 Ga0075370_10290686 3300006353 Bacteria 971
61 Ga0068865_100190155 3300006881 Bacteria 1587
62 Ga0105245_10011652 3300009098 Bacteria 7653
63 Ga0105245_10343360 3300009098 Bacteria 1477
64 Ga0105245_11155422 3300009098 Bacteria 821
65 Ga0105243_10095095 3300009148 Bacteria 2462
66 Ga0105243_10135270 3300009148 Bacteria 2096
67 Ga0105243_10179137 3300009148 Bacteria 1842
68 Ga0105248_11222252 3300009177 Bacteria 850
69 Ga0105237_10166471 3300009545 Bacteria 2204
70 Ga0105238_10197859 3300009551 Bacteria 1985
71 Ga0105249_10205816 3300009553 Bacteria 1928
72 Ga0105249_10785763 3300009553 Bacteria 1015
73 Ga0105249_11862946 3300009553 Bacteria 674
74 Ga0105246_10000992 3300011119 Bacteria 16307
75 Ga0157369_10255890 3300013105 Bacteria 1827
76 Ga0163162_10841186 3300013306 Bacteria 1033
77 Ga0157372_10051995 3300013307 Bacteria 4561
78 Ga0157372_10085700 3300013307 Bacteria 3573
79 Ga0157372_10817298 3300013307 Bacteria 1082
80 Ga0157375_10006155 3300013308 Bacteria 10455
81 Ga0157375_10113751 3300013308 Bacteria 2807
82 Ga0157375_10196840 3300013308 Bacteria 2170
83 Ga0157375_10341907 3300013308 Bacteria 1662
84 Ga0157375_10393586 3300013308 Bacteria 1552
85 Ga0157375_10529590 3300013308 Bacteria 1341
86 Ga0157375_12175335 3300013308 Bacteria 661
87 Ga0163163_10057063 3300014325 Bacteria 3861
88 Ga0163163_10401039 3300014325 Bacteria 1430
89 Ga0157380_10292107 3300014326 Bacteria 1497
90 Ga0157380_10547139 3300014326 Bacteria 1135
91 Ga0157377_10029752 3300014745 Bacteria 2953
92 Ga0157377_10177724 3300014745 Bacteria 1336
93 Ga0157379_10010700 3300014968 Bacteria 7995
94 Ga0157379_10673403 3300014968 Bacteria 970
95 Ga0157376_10701906 3300014969 Bacteria 1017
96 Ga0207688_10063090 3300025901 Bacteria 2090
97 Ga0207688_10302368 3300025901 Bacteria 978
98 Ga0207647_10008934 3300025904 Bacteria 7145
99 Ga0207647_10072590 3300025904 Bacteria 2075
100 Ga0207705_10024061 3300025909 Bacteria 4345
101 Ga0207705_10362031 3300025909 Bacteria 1119
102 Ga0207671_10121538 3300025914 Bacteria 1996
103 Ga0207657_10168192 3300025919 Bacteria 1777
104 Ga0207694_10541982 3300025924 Bacteria 976
105 Ga0207650_10112986 3300025925 Bacteria 2105
106 Ga0207659_10134689 3300025926 Bacteria 1911
107 Ga0207687_10038073 3300025927 Bacteria 3285
108 Ga0207687_11272059 3300025927 Bacteria 632
109 Ga0207644_10140950 3300025931 Bacteria 1857
110 Ga0207690_10081732 3300025932 Bacteria 2258
111 Ga0207690_10482259 3300025932 Bacteria 1001
112 Ga0207686_10116422 3300025934 Bacteria 1812
113 Ga0207709_10199864 3300025935 Bacteria 1427
114 Ga0207670_10871045 3300025936 Bacteria 753
115 Ga0207704_10151956 3300025938 Bacteria 1635
116 Ga0207661_10003538 3300025944 Bacteria 10849
117 Ga0207661_10016495 3300025944 Bacteria 5450
118 Ga0207661_10029107 3300025944 Bacteria 4239
119 Ga0207667_10180305 3300025949 Bacteria 2169
120 Ga0207712_10445380 3300025961 Bacteria 1097
121 Ga0207658_10922521 3300025986 Bacteria 795
122 Ga0207677_10132003 3300026023 Bacteria 1898
123 Ga0207678_10161102 3300026067 Bacteria 1916
124 Ga0207702_10039198 3300026078 Bacteria 3969
125 Ga0207702_10313367 3300026078 Bacteria 1492
126 Ga0207702_10769213 3300026078 Bacteria 951
127 Ga0207641_10728049 3300026088 Bacteria 978
128 Ga0207676_10014724 3300026095 Bacteria 5634
129 Ga0207674_10010792 3300026116 Bacteria 10302
130 Ga0207674_10276657 3300026116 Bacteria 1626
131 Ga0207674_10468679 3300026116 Bacteria 1217
132 Ga0207675_100318571 3300026118 Bacteria 1518
133 Ga0207683_10074304 3300026121 Bacteria 3007
134 Ga0207683_10591640 3300026121 Bacteria 1027
135 Ga0207698_10123590 3300026142 Bacteria 2196
136 Ga0268266_10005226 3300028379 Bacteria 12205
137 Ga0268264_11479560 3300028381 Bacteria 690
138 Ga0307413_10359446 3300031824 Bacteria 1127
139 Ga0307410_10572721 3300031852 Bacteria 939
140 Ga0307407_10440836 3300031903 Bacteria 943
141 Ga0307407_10947541 3300031903 Bacteria 663
142 Ga0307409_100281488 3300031995 Bacteria 1537
143 Ga0307409_100477945 3300031995 Bacteria 1208
144 Ga0307409_100483472 3300031995 Bacteria 1202
145 Ga0307409_101155791 3300031995 Bacteria 796
146 Ga0307416_100126554 3300032002 Bacteria 2290
147 Ga0307416_100146936 3300032002 Bacteria 2154
148 Ga0307416_101079760 3300032002 Bacteria 907
149 Ga0307414_10369189 3300032004 Bacteria 1237
150 Ga0307415_100106457 3300032126 Bacteria 2070
151 Ga0307415_100402184 3300032126 Bacteria 1169
152 Ga0307415_100508206 3300032126 Bacteria 1055
153 Ga0395898_0517312 3300037466 Bacteria 1135
154 Ga0436365_0771747 3300039437 Bacteria 3265
155 Ga0451797_1359975 3300041453 Bacteria 1158
156 Ga0451837_0766097 3300041494 Bacteria 978
157 Ga0439431_0164802 3300041997 Bacteria 635
158 Ga0466965_0004367 3300044683 Bacteria 6285
159 Ga0466966_0028760 3300044684 Bacteria 3618
160 Ga0466961_0074243 3300044693 Bacteria 2156
161 Ga0466961_0083361 3300044693 Bacteria 2022
162 Ga0466961_0366730 3300044693 Bacteria 876
163 Ga0466963_0085518 3300044694 Bacteria 2141
164 Ga0466963_0397160 3300044694 Bacteria 972
165 Ga0466964_0008516 3300044706 Bacteria 3856
166 Ga0466968_0322836 3300044735 Bacteria 746
167 Ga0466970_0214035 3300044765 Bacteria 1074
168 Ga0466970_0259089 3300044765 Bacteria 975
169 Ga0466970_0344617 3300044765 Bacteria 845
170 Ga0466957_0006502 3300044842 Bacteria 6600
171 Ga0466957_0061835 3300044842 Bacteria 2299
172 Ga0466957_0120686 3300044842 Bacteria 1671
173 Ga0466959_0331729 3300045049 Bacteria 1039
174 Ga0466959_0769652 3300045049 Bacteria 644
175 Ga0451576_0090867 3300045051 Bacteria 3176
176 Ga0466967_0025192 3300045976 Bacteria 4902
177 Ga0466967_0080940 3300045976 Bacteria 2932
178 Ga0495582_0440505 3300046473 Bacteria 752
179 Ga0495608_0089865 3300046511 Bacteria 1988
180 Ga0495657_0241179 3300046675 Bacteria 1091
181 Ga0495676_0667633 3300047321 Bacteria 674
182 Ga0496100_0024239 3300048903 Bacteria 3698
183 Ga0496100_0190151 3300048903 Bacteria 1490
184 Ga0496100_0390584 3300048903 Bacteria 1058
185 Ga0496101_0034158 3300048904 Bacteria 3590
186 Ga0496101_0078701 3300048904 Bacteria 2433
187 Ga0496101_0475445 3300048904 Bacteria 987
188 Ga0496101_0807474 3300048904 Bacteria 740
189 Ga0496102_0007164 3300048905 Bacteria 9520
190 Ga0496102_0014581 3300048905 Bacteria 6831
191 Ga0496102_0036381 3300048905 Bacteria 4435
192 Ga0496102_0348586 3300048905 Bacteria 1394
193 Ga0496102_0639830 3300048905 Bacteria 987
194 Ga0496103_0097787 3300048906 Bacteria 1856
195 Ga0496103_0135243 3300048906 Bacteria 1575
196 Ga0496104_0000742 3300048907 Bacteria 27980
197 Ga0496105_0008225 3300048908 Bacteria 8110
198 Ga0496106_0066745 3300048909 Bacteria 2741
199 Ga0496106_0119791 3300048909 Bacteria 2056
200 Ga0496106_0547139 3300048909 Bacteria 929
201 Ga0496107_0022058 3300048910 Bacteria 4499
202 Ga0496107_0088960 3300048910 Bacteria 2254
203 Ga0496107_0132764 3300048910 Bacteria 1839
204 Ga0496108_0011436 3300048911 Bacteria 7214
205 Ga0496108_0096514 3300048911 Bacteria 2518
206 Ga0496108_0276041 3300048911 Bacteria 1463
207 Ga0496109_0028971 3300048912 Bacteria 4957
208 Ga0496109_0187909 3300048912 Bacteria 1941
209 Ga0496109_0248065 3300048912 Bacteria 1676
210 Ga0496109_0605779 3300048912 Bacteria 1032
211 Ga0496110_0003622 3300048913 Bacteria 11882
212 Ga0496110_0690358 3300048913 Bacteria 922
213 Ga0496111_0007772 3300048914 Bacteria 7060
214 Ga0496111_0223053 3300048914 Bacteria 1400
215 Ga0496111_0624902 3300048914 Bacteria 787
216 Ga0496112_0880021 3300048915 Bacteria 818
217 Ga0496113_0160845 3300048916 Bacteria 1775
218 Ga0496114_0009469 3300048917 Bacteria 7733
219 Ga0496114_0034254 3300048917 Bacteria 4188
220 Ga0496114_0090354 3300048917 Bacteria 2599
221 Ga0496114_0134706 3300048917 Bacteria 2136
222 Ga0496114_1000047 3300048917 Bacteria 719
223 Ga0496115_0010689 3300048918 Bacteria 6865
224 Ga0496115_0033325 3300048918 Bacteria 4066
225 Ga0501031_0114830 3300049568 Bacteria 1759
226 Ga0501032_0034093 3300049569 Bacteria 3486
227 Ga0501033_0058396 3300049570 Bacteria 2850
228 Ga0501034_0011983 3300049571 Bacteria 8960
229 Ga0501034_0027939 3300049571 Bacteria 5737
230 Ga0501036_0115890 3300049572 Bacteria 2263
231 Ga0501036_0158350 3300049572 Bacteria 1910
232 Ga0501036_0284508 3300049572 Bacteria 1384
233 Ga0501036_0761863 3300049572 Bacteria 798
234 Ga0501037_0171165 3300049573 Bacteria 1544
235 Ga0501037_0216782 3300049573 Bacteria 1348
236 Ga0501037_0360163 3300049573 Bacteria 1002
237 Ga0501037_0402772 3300049573 Bacteria 938
238 Ga0501039_0048776 3300049575 Bacteria 3273
239 Ga0501041_0063568 3300049577 Bacteria 2260
240 Ga0501042_0147098 3300049578 Bacteria 1699
241 Ga0501042_0228803 3300049578 Bacteria 1341
242 Ga0501048_0756126 3300049582 Bacteria 698
243 Ga0501067_0001720 3300049583 Bacteria 12023
244 Ga0501067_0087706 3300049583 Bacteria 1726
245 Ga0501068_0005205 3300049584 Bacteria 7093
246 Ga0501068_0007546 3300049584 Bacteria 6018
247 Ga0501068_0087453 3300049584 Bacteria 1919
248 Ga0501069_0017809 3300049585 Bacteria 3830
249 Ga0501069_0192285 3300049585 Bacteria 1181
250 Ga0501069_0218496 3300049585 Bacteria 1107
251 Ga0501069_0234969 3300049585 Bacteria 1068
252 Ga0501070_0098878 3300049586 Bacteria 2413
253 Ga0501070_0105510 3300049586 Bacteria 2329
254 Ga0501070_0167882 3300049586 Bacteria 1808
255 Ga0501071_0015585 3300049587 Bacteria 5219
256 Ga0501071_0474275 3300049587 Bacteria 959
257 Ga0501072_0006623 3300049588 Bacteria 8817
258 Ga0501073_0009878 3300049589 Bacteria 7022
259 Ga0501074_0018882 3300049590 Bacteria 5007
260 Ga0501075_0150082 3300049591 Bacteria 1777
261 Ga0501076_0293964 3300049592 Bacteria 1331
262 Ga0501077_0007474 3300049593 Bacteria 6743
263 Ga0501079_0027377 3300049741 Bacteria 4370
264 Ga0501080_0020204 3300049742 Bacteria 6165
265 Ga0501080_0024028 3300049742 Bacteria 5650
266 Ga0501080_0319791 3300049742 Bacteria 1405
267 Ga0501083_0030558 3300049744 Bacteria 3700
268 Ga0501035_0395698 3300049822 Bacteria 1150
269 Ga0501045_0110814 3300049824 Bacteria 2035
270 Ga0501045_0176148 3300049824 Bacteria 1593
271 nmdc:mga03n38_132553_c1 3300050490 Bacteria 1236
272 nmdc:mga00v17_324354_c1 3300050491 Bacteria 1000
273 nmdc:mga0yw44_264204_c1 3300050492 Bacteria 1147
274 nmdc:mga0yw44_369968_c1 3300050492 Bacteria 967
275 nmdc:mga0yw44_3849_c1 3300050492 Bacteria 6748
276 nmdc:mga0yw44_98212_c1 3300050492 Bacteria 1861
277 nmdc:mga07m45_238838_c1 3300050496 Bacteria 1057
278 Ga0495619_0004429 3300053085 Bacteria 8959
279 Ga0501084_0019326 3300054114 Bacteria 5676
280 Ga0501084_0038619 3300054114 Bacteria 3991
281 Ga0501084_0228338 3300054114 Bacteria 1571
282 Ga0501082_0133558 3300060353 Bacteria 2153
283 2643825016 2643221561 Bacteria 4984412
284 2644228063 2643221641 Bacteria 4490190
285 2644534677 2643221696 Bacteria 5431823
286 2740165565 2739367898 Bacteria 4367674
287 2855388595 2855386786 Bacteria 4752232
288 2857485483 2857481737 Bacteria 4761446
289 8054611997 8054609563 Bacteria 5170090
290 Ga0070683_100303992
291 JGI24737J22298_10069812
292 Ga0070658_10005824
293 Ga0070658_10386141
294 Ga0070658_10638033
295 Ga0070683_100004062
296 Ga0070683_100004459
297 Ga0070683_100044848
298 Ga0070670_100080987
299 Ga0068869_100199470
300 Ga0070682_100035811
301 Ga0068868_100026831
302 Ga0070691_10176357
303 Ga0070687_100653780
304 Ga0070692_10064717
305 Ga0070668_100192520
306 Ga0070675_100316491
307 Ga0070671_100666902
308 Ga0070659_100007088
309 Ga0070667_100916886
310 Ga0070662_100342730
311 Ga0070681_10376599
312 Ga0070685_10485359
313 Ga0070679_100015915
314 Ga0070684_100004495
315 Ga0070684_100238547
316 Ga0070684_100345586
317 Ga0070684_100479866
318 Ga0070686_100068895
319 Ga0070693_100239741
320 Ga0070665_100001173
321 Ga0070665_100056821
322 Ga0070665_100737720
323 Ga0068855_100082897
324 Ga0068857_100031807
325 Ga0068857_100644039
326 Ga0068856_100065638
327 Ga0068856_101369803
328 Ga0070702_100161805
329 Ga0068852_100091968
330 Ga0068864_100103236
331 Ga0068866_10664598
332 Ga0068861_100242354
333 Ga0068861_100248001
334 Ga0068861_100883879
335 Ga0068863_101177828
336 Ga0068858_100029115
337 Ga0068860_100025265
338 Ga0068860_100553124
339 Ga0068862_100156744
340 Ga0081539_10021063
341 Ga0075365_10035789
342 Ga0075365_10277117
343 Ga0075365_10339310
344 Ga0075365_10499169
345 Ga0075365_10510562
346 Ga0075363_100175674
347 Ga0075367_10051916
348 Ga0075370_10116130
349 Ga0075370_10290686
350 Ga0068865_100190155
351 Ga0105245_10011652
352 Ga0105245_10343360
353 Ga0105245_11155422
354 Ga0105243_10095095
355 Ga0105243_10135270
356 Ga0105243_10179137
357 Ga0105248_11222252
358 Ga0105237_10166471
359 Ga0105238_10197859
360 Ga0105249_10205816
361 Ga0105249_10785763
362 Ga0105249_11862946
363 Ga0105246_10000992
364 Ga0157369_10255890
365 Ga0163162_10841186
366 Ga0157372_10051995
367 Ga0157372_10085700
368 Ga0157372_10817298
369 Ga0157375_10006155
370 Ga0157375_10113751
371 Ga0157375_10196840
372 Ga0157375_10341907
373 Ga0157375_10393586
374 Ga0157375_10529590
375 Ga0157375_12175335
376 Ga0163163_10057063
377 Ga0163163_10401039
378 Ga0157380_10292107
379 Ga0157380_10547139
380 Ga0157377_10029752
381 Ga0157377_10177724
382 Ga0157379_10010700
383 Ga0157379_10673403
384 Ga0157376_10701906
385 Ga0207688_10063090
386 Ga0207688_10302368
387 Ga0207647_10008934
388 Ga0207647_10072590
389 Ga0207705_10024061
390 Ga0207705_10362031
391 Ga0207671_10121538
392 Ga0207657_10168192
393 Ga0207694_10541982
394 Ga0207650_10112986
395 Ga0207659_10134689
396 Ga0207687_10038073
397 Ga0207687_11272059
398 Ga0207644_10140950
399 Ga0207690_10081732
400 Ga0207690_10482259
401 Ga0207686_10116422
402 Ga0207709_10199864
403 Ga0207670_10871045
404 Ga0207704_10151956
405 Ga0207661_10003538
406 Ga0207661_10016495
407 Ga0207661_10029107
408 Ga0207667_10180305
409 Ga0207712_10445380
410 Ga0207658_10922521
411 Ga0207677_10132003
412 Ga0207678_10161102
413 Ga0207702_10039198
414 Ga0207702_10313367
415 Ga0207702_10769213
416 Ga0207641_10728049
417 Ga0207676_10014724
418 Ga0207674_10010792
419 Ga0207674_10276657
420 Ga0207674_10468679
421 Ga0207675_100318571
422 Ga0207683_10074304
423 Ga0207683_10591640
424 Ga0207698_10123590
425 Ga0268266_10005226
426 Ga0268264_11479560
427 Ga0307413_10359446
428 Ga0307410_10572721
429 Ga0307407_10440836
430 Ga0307407_10947541
431 Ga0307409_100281488
432 Ga0307409_100477945
433 Ga0307409_100483472
434 Ga0307409_101155791
435 Ga0307416_100126554
436 Ga0307416_100146936
437 Ga0307416_101079760
438 Ga0307414_10369189
439 Ga0307415_100106457
440 Ga0307415_100402184
441 Ga0307415_100508206
442 Ga0395898_0517312
443 Ga0436365_0771747
444 Ga0451797_1359975
445 Ga0451837_0766097
446 Ga0439431_0164802
447 Ga0466965_0004367
448 Ga0466966_0028760
449 Ga0466961_0074243
450 Ga0466961_0083361
451 Ga0466961_0366730
452 Ga0466963_0085518
453 Ga0466963_0397160
454 Ga0466964_0008516
455 Ga0466968_0322836
456 Ga0466970_0214035
457 Ga0466970_0259089
458 Ga0466970_0344617
459 Ga0466957_0006502
460 Ga0466957_0061835
461 Ga0466957_0120686
462 Ga0466959_0331729
463 Ga0466959_0769652
464 Ga0451576_0090867
465 Ga0466967_0025192
466 Ga0466967_0080940
467 Ga0495582_0440505
468 Ga0495608_0089865
469 Ga0495657_0241179
470 Ga0495676_0667633
471 Ga0496100_0024239
472 Ga0496100_0190151
473 Ga0496100_0390584
474 Ga0496101_0034158
475 Ga0496101_0078701
476 Ga0496101_0475445
477 Ga0496101_0807474
478 Ga0496102_0007164
479 Ga0496102_0014581
480 Ga0496102_0036381
481 Ga0496102_0348586
482 Ga0496102_0639830
483 Ga0496103_0097787
484 Ga0496103_0135243
485 Ga0496104_0000742
486 Ga0496105_0008225
487 Ga0496106_0066745
488 Ga0496106_0119791
489 Ga0496106_0547139
490 Ga0496107_0022058
491 Ga0496107_0088960
492 Ga0496107_0132764
493 Ga0496108_0011436
494 Ga0496108_0096514
495 Ga0496108_0276041
496 Ga0496109_0028971
497 Ga0496109_0187909
498 Ga0496109_0248065
499 Ga0496109_0605779
500 Ga0496110_0003622
501 Ga0496110_0690358
502 Ga0496111_0007772
503 Ga0496111_0223053
504 Ga0496111_0624902
505 Ga0496112_0880021
506 Ga0496113_0160845
507 Ga0496114_0009469
508 Ga0496114_0034254
509 Ga0496114_0090354
510 Ga0496114_0134706
511 Ga0496114_1000047
512 Ga0496115_0010689
513 Ga0496115_0033325
514 Ga0501031_0114830
515 Ga0501032_0034093
516 Ga0501033_0058396
517 Ga0501034_0011983
518 Ga0501034_0027939
519 Ga0501036_0115890
520 Ga0501036_0158350
521 Ga0501036_0284508
522 Ga0501036_0761863
523 Ga0501037_0171165
524 Ga0501037_0216782
525 Ga0501037_0360163
526 Ga0501037_0402772
527 Ga0501039_0048776
528 Ga0501041_0063568
529 Ga0501042_0147098
530 Ga0501042_0228803
531 Ga0501048_0756126
532 Ga0501067_0001720
533 Ga0501067_0087706
534 Ga0501068_0005205
535 Ga0501068_0007546
536 Ga0501068_0087453
537 Ga0501069_0017809
538 Ga0501069_0192285
539 Ga0501069_0218496
540 Ga0501069_0234969
541 Ga0501070_0098878
542 Ga0501070_0105510
543 Ga0501070_0167882
544 Ga0501071_0015585
545 Ga0501071_0474275
546 Ga0501072_0006623
547 Ga0501073_0009878
548 Ga0501074_0018882
549 Ga0501075_0150082
550 Ga0501076_0293964
551 Ga0501077_0007474
552 Ga0501079_0027377
553 Ga0501080_0020204
554 Ga0501080_0024028
555 Ga0501080_0319791
556 Ga0501083_0030558
557 Ga0501035_0395698
558 Ga0501045_0110814
559 Ga0501045_0176148
560 nmdc:mga03n38_132553_c1
561 nmdc:mga00v17_324354_c1
562 nmdc:mga0yw44_264204_c1
563 nmdc:mga0yw44_369968_c1
564 nmdc:mga0yw44_3849_c1
565 nmdc:mga0yw44_98212_c1
566 nmdc:mga07m45_238838_c1
567 Ga0495619_0004429
568 Ga0501084_0019326
569 Ga0501084_0038619
570 Ga0501084_0228338
571 Ga0501082_0133558
572 2643825016
573 2644228063
574 2644534677
575 2740165565
576 2855388595
577 2857485483
578 8054611997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

27

72

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3btj-assembly1.cif.gz_A crystal structure of qacr(e58q) bound to dequalinium 0.8515 9 197
3bti-assembly1.cif.gz_A crystal structure of qacr(e58q) bound to berberine 0.8514 9 197
3br5-assembly1.cif.gz_A crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor 0.8481 9 197
5n1i-assembly1.cif.gz_B unliganded form of the mycobacterium tuberculosis repressor ethr2 0.8365 10 200
3br6-assembly1.cif.gz_A crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor 0.8362 9 197
ID Description Score Start End Superfamily
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9799 10 51 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9773 10 47 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9734 13 47 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9629 10 51 1.10.10.60
5gpaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9622 9 50 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I5QGU8-F1-model_v4 Regulatory protein, tetR family 0.9554 11 199 GO:0000976
GO:0003700
AF-A0A1Q8CTT6-F1-model_v4 TetR family transcriptional regulator 0.9514 14 200 GO:0000976
GO:0003700
AF-A0A4R4V347-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9513 11 199 GO:0000976
GO:0003700
AF-A0A346XTZ0-F1-model_v4 Transcriptional regulator, TetR family 0.9482 15 199 GO:0000976
GO:0003700
AF-A0A0Q8ED42-F1-model_v4 HTH tetR-type domain-containing protein 0.9475 8 200 GO:0000976
GO:0003700

Map