F388961
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 289 | 183 | 289 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10006847|rootH2_1000684721 |
| Length | 128 |
| Sequence | MLAIRLQRLGRKGYPVYRLAVQESQRHPSSGRVVAYVGSYNPHTKEANVQVEAAQKYLDNGAQPTPRVVKLLKDAGVKLPKWVKEPETGKQKSIKNVEKLRKNQPKEKISEVTEETPAXXXPAQENAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 39 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 57 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 58 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 62 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 102 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 103 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 104 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 105 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 106 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 107 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 108 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 119 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 120 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 121 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 125 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 126 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 127 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 128 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 129 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 130 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 131 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 132 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 133 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 134 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 135 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 138 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 139 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 158 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 159 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 160 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 161 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 162 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 163 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 164 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 165 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 166 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 167 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 168 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 169 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 170 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 171 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 172 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 173 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 174 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 175 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 176 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 177 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 178 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 182 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 183 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.53 |
| Nodule | 0 |
| Rhizoplane | 3.81 |
| Rhizosphere | 69.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_542959 | 2162886011 | Bacteria | 806 |
| 2 | MBSR1b_contig_1699160 | 2162886012 | Bacteria | 1807 |
| 3 | JGI24741J21665_1029691 | 3300001915 | Bacteria | 822 |
| 4 | JGI24740J21852_10004913 | 3300001979 | Bacteria | 5690 |
| 5 | JGI24740J21852_10019351 | 3300001979 | Bacteria | 2399 |
| 6 | JGI24739J22299_10005141 | 3300001989 | Bacteria | 4982 |
| 7 | JGI24737J22298_10002203 | 3300001990 | Bacteria | 6943 |
| 8 | JGI24743J22301_10000630 | 3300001991 | Bacteria | 4295 |
| 9 | JGI24735J21928_10000149 | 3300002067 | Bacteria | 24660 |
| 10 | JGI24738J21930_10001791 | 3300002075 | Bacteria | 5840 |
| 11 | JGI24033J26618_1001309 | 3300002155 | Bacteria | 2454 |
| 12 | rootH1_10002936 | 3300003316 | Bacteria | 45055 |
| 13 | rootH1_10154833 | 3300003316 | Bacteria | 1065 |
| 14 | rootH2_10006847 | 3300003320 | Bacteria | 155484 |
| 15 | rootL2_10183129 | 3300003322 | Bacteria | 2611 |
| 16 | rootH1_10030295 | 3300003323 | Bacteria | 20195 |
| 17 | rootH1_10196557 | 3300003323 | Bacteria | 1659 |
| 18 | Ga0065712_10284678 | 3300005290 | Bacteria | 889 |
| 19 | Ga0065715_10099813 | 3300005293 | Bacteria | 3366 |
| 20 | Ga0070658_10000024 | 3300005327 | Bacteria | 175873 |
| 21 | Ga0070683_100010750 | 3300005329 | Bacteria | 7874 |
| 22 | Ga0070683_100724814 | 3300005329 | Bacteria | 952 |
| 23 | Ga0068869_100155766 | 3300005334 | Bacteria | 1775 |
| 24 | Ga0070660_100000316 | 3300005339 | Bacteria | 31842 |
| 25 | Ga0070660_100045343 | 3300005339 | Bacteria | 3365 |
| 26 | Ga0070660_101454377 | 3300005339 | Bacteria | 582 |
| 27 | Ga0070661_100056640 | 3300005344 | Bacteria | 2872 |
| 28 | Ga0070692_10438243 | 3300005345 | Bacteria | 833 |
| 29 | Ga0070675_100093937 | 3300005354 | Bacteria | 2516 |
| 30 | Ga0070659_100089113 | 3300005366 | Bacteria | 2471 |
| 31 | Ga0070663_100455377 | 3300005455 | Bacteria | 1055 |
| 32 | Ga0070662_100009029 | 3300005457 | Bacteria | 6502 |
| 33 | Ga0070707_101579984 | 3300005468 | Bacteria | 623 |
| 34 | Ga0070684_100046576 | 3300005535 | Bacteria | 3757 |
| 35 | Ga0068855_100000663 | 3300005563 | Bacteria | 41994 |
| 36 | Ga0070664_100000123 | 3300005564 | Bacteria | 51444 |
| 37 | Ga0070664_100003334 | 3300005564 | Bacteria | 12978 |
| 38 | Ga0070664_100093442 | 3300005564 | Bacteria | 2606 |
| 39 | Ga0068857_100000441 | 3300005577 | Bacteria | 29474 |
| 40 | Ga0068857_100021011 | 3300005577 | Bacteria | 5744 |
| 41 | Ga0068857_100158594 | 3300005577 | Bacteria | 2052 |
| 42 | Ga0068857_100590162 | 3300005577 | Bacteria | 1049 |
| 43 | Ga0068854_100026707 | 3300005578 | Bacteria | 3971 |
| 44 | Ga0068856_100000027 | 3300005614 | Bacteria | 133290 |
| 45 | Ga0068856_100000200 | 3300005614 | Bacteria | 63772 |
| 46 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 47 | Ga0068852_100000155 | 3300005616 | Bacteria | 45515 |
| 48 | Ga0068852_100064518 | 3300005616 | Bacteria | 3193 |
| 49 | Ga0068852_100269563 | 3300005616 | Bacteria | 1638 |
| 50 | Ga0068864_101873381 | 3300005618 | Bacteria | 605 |
| 51 | Ga0068860_100111002 | 3300005843 | Unclassified | 2621 |
| 52 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 53 | Ga0075365_10000014 | 3300006038 | Bacteria | 79945 |
| 54 | Ga0075365_10000232 | 3300006038 | Bacteria | 19058 |
| 55 | Ga0075365_10007875 | 3300006038 | Bacteria | 6002 |
| 56 | Ga0075365_10069344 | 3300006038 | Bacteria | 2370 |
| 57 | Ga0075365_10185564 | 3300006038 | Bacteria | 1455 |
| 58 | Ga0075365_10371109 | 3300006038 | Bacteria | 1009 |
| 59 | Ga0075368_10002082 | 3300006042 | Bacteria | 6462 |
| 60 | Ga0075363_100018117 | 3300006048 | Bacteria | 3503 |
| 61 | Ga0075363_101015787 | 3300006048 | Unclassified | 511 |
| 62 | Ga0075364_10002663 | 3300006051 | Bacteria | 10027 |
| 63 | Ga0075364_10002700 | 3300006051 | Bacteria | 9968 |
| 64 | Ga0075364_10133714 | 3300006051 | Bacteria | 1666 |
| 65 | Ga0075364_10198129 | 3300006051 | Bacteria | 1361 |
| 66 | Ga0075362_10032747 | 3300006177 | Bacteria | 2257 |
| 67 | Ga0075362_10392282 | 3300006177 | Bacteria | 699 |
| 68 | Ga0075367_10008164 | 3300006178 | Bacteria | 5409 |
| 69 | Ga0075367_10245941 | 3300006178 | Bacteria | 1121 |
| 70 | Ga0075369_10000181 | 3300006186 | Bacteria | 18065 |
| 71 | Ga0075366_10010874 | 3300006195 | Bacteria | 5120 |
| 72 | Ga0097621_100000001 | 3300006237 | Bacteria | 632268 |
| 73 | Ga0075370_10111592 | 3300006353 | Bacteria | 1588 |
| 74 | Ga0075370_10254951 | 3300006353 | Bacteria | 1040 |
| 75 | Ga0068871_100000002 | 3300006358 | Bacteria | 152322 |
| 76 | Ga0075428_100001999 | 3300006844 | Bacteria | 21962 |
| 77 | Ga0068865_100000307 | 3300006881 | Bacteria | 27001 |
| 78 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 79 | Ga0105240_10000050 | 3300009093 | Bacteria | 236144 |
| 80 | Ga0105240_10001357 | 3300009093 | Bacteria | 42000 |
| 81 | Ga0105245_10287831 | 3300009098 | Bacteria | 1608 |
| 82 | Ga0105241_10058310 | 3300009174 | Bacteria | 2965 |
| 83 | Ga0105241_10082024 | 3300009174 | Bacteria | 2527 |
| 84 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 85 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 86 | Ga0105237_10061315 | 3300009545 | Bacteria | 3761 |
| 87 | Ga0105238_10062208 | 3300009551 | Bacteria | 3733 |
| 88 | Ga0105238_10140584 | 3300009551 | Bacteria | 2391 |
| 89 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 90 | Ga0105032_100020 | 3300009979 | Bacteria | 43175 |
| 91 | Ga0105032_100148 | 3300009979 | Bacteria | 7474 |
| 92 | Ga0105029_100086 | 3300009984 | Bacteria | 4492 |
| 93 | Ga0105028_100830 | 3300009993 | Bacteria | 3285 |
| 94 | Ga0105239_10001223 | 3300010375 | Bacteria | 35012 |
| 95 | Ga0105246_10052123 | 3300011119 | Bacteria | 2811 |
| 96 | Ga0105246_10538441 | 3300011119 | Bacteria | 998 |
| 97 | Ga0157317_1024739 | 3300012475 | Bacteria | 555 |
| 98 | Ga0157313_1046517 | 3300012503 | Bacteria | 551 |
| 99 | Ga0157373_10043985 | 3300013100 | Bacteria | 3188 |
| 100 | Ga0157371_10007527 | 3300013102 | Bacteria | 8809 |
| 101 | Ga0157371_10050953 | 3300013102 | Bacteria | 2942 |
| 102 | Ga0157371_10523502 | 3300013102 | Bacteria | 877 |
| 103 | Ga0157370_10002357 | 3300013104 | Bacteria | 22781 |
| 104 | Ga0157370_10012318 | 3300013104 | Bacteria | 8877 |
| 105 | Ga0157370_10290543 | 3300013104 | Bacteria | 1510 |
| 106 | Ga0157369_10000029 | 3300013105 | Bacteria | 206955 |
| 107 | Ga0157369_10000151 | 3300013105 | Bacteria | 98331 |
| 108 | Ga0157369_10000413 | 3300013105 | Bacteria | 56589 |
| 109 | Ga0157369_10000567 | 3300013105 | Bacteria | 48628 |
| 110 | Ga0157369_10013289 | 3300013105 | Bacteria | 9316 |
| 111 | Ga0157374_10004073 | 3300013296 | Bacteria | 12275 |
| 112 | Ga0157374_11622594 | 3300013296 | Bacteria | 671 |
| 113 | Ga0157378_10461045 | 3300013297 | Bacteria | 1263 |
| 114 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 115 | Ga0157372_10000086 | 3300013307 | Bacteria | 96247 |
| 116 | Ga0157372_10278510 | 3300013307 | Bacteria | 1944 |
| 117 | Ga0157372_10403635 | 3300013307 | Bacteria | 1592 |
| 118 | Ga0157372_10579105 | 3300013307 | Bacteria | 1308 |
| 119 | Ga0157372_11176099 | 3300013307 | Bacteria | 886 |
| 120 | Ga0157375_10074210 | 3300013308 | Bacteria | 3422 |
| 121 | Ga0163163_10211208 | 3300014325 | Bacteria | 1990 |
| 122 | Ga0157380_13032532 | 3300014326 | Bacteria | 535 |
| 123 | Ga0157377_10000920 | 3300014745 | Bacteria | 12288 |
| 124 | Ga0157377_10001053 | 3300014745 | Bacteria | 11677 |
| 125 | Ga0157379_10006609 | 3300014968 | Bacteria | 10004 |
| 126 | Ga0157376_10000027 | 3300014969 | Bacteria | 204157 |
| 127 | Ga0157376_10276006 | 3300014969 | Bacteria | 1581 |
| 128 | Ga0207697_10044198 | 3300025315 | Bacteria | 1832 |
| 129 | Ga0207688_10501377 | 3300025901 | Bacteria | 760 |
| 130 | Ga0207647_10001245 | 3300025904 | Bacteria | 19575 |
| 131 | Ga0207705_10000047 | 3300025909 | Bacteria | 175887 |
| 132 | Ga0207654_10068504 | 3300025911 | Bacteria | 2099 |
| 133 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 134 | Ga0207695_10000158 | 3300025913 | Bacteria | 201891 |
| 135 | Ga0207695_10012231 | 3300025913 | Bacteria | 10306 |
| 136 | Ga0207695_10740774 | 3300025913 | Unclassified | 863 |
| 137 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 138 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 139 | Ga0207671_10033531 | 3300025914 | Bacteria | 3818 |
| 140 | Ga0207657_10002562 | 3300025919 | Bacteria | 19664 |
| 141 | Ga0207657_10011048 | 3300025919 | Bacteria | 8976 |
| 142 | Ga0207649_10240105 | 3300025920 | Bacteria | 1300 |
| 143 | Ga0207694_10056409 | 3300025924 | Bacteria | 3051 |
| 144 | Ga0207694_10088559 | 3300025924 | Bacteria | 2440 |
| 145 | Ga0207694_10707111 | 3300025924 | Bacteria | 850 |
| 146 | Ga0207687_10270848 | 3300025927 | Bacteria | 1357 |
| 147 | Ga0207690_10002652 | 3300025932 | Bacteria | 10785 |
| 148 | Ga0207706_10000073 | 3300025933 | Bacteria | 103803 |
| 149 | Ga0207704_10001468 | 3300025938 | Bacteria | 10545 |
| 150 | Ga0207661_10002445 | 3300025944 | Bacteria | 12778 |
| 151 | Ga0207679_10000124 | 3300025945 | Bacteria | 63038 |
| 152 | Ga0207679_10670768 | 3300025945 | Unclassified | 939 |
| 153 | Ga0207667_10000756 | 3300025949 | Bacteria | 42002 |
| 154 | Ga0207640_10019721 | 3300025981 | Bacteria | 3989 |
| 155 | Ga0207702_10000015 | 3300026078 | Bacteria | 250830 |
| 156 | Ga0207702_10000034 | 3300026078 | Bacteria | 164965 |
| 157 | Ga0207702_10000057 | 3300026078 | Bacteria | 131118 |
| 158 | Ga0207641_10826213 | 3300026088 | Unclassified | 917 |
| 159 | Ga0207676_11742972 | 3300026095 | Bacteria | 621 |
| 160 | Ga0207674_10000878 | 3300026116 | Bacteria | 39325 |
| 161 | Ga0207674_10020195 | 3300026116 | Bacteria | 7203 |
| 162 | Ga0207674_10310606 | 3300026116 | Bacteria | 1526 |
| 163 | Ga0207674_10341793 | 3300026116 | Bacteria | 1447 |
| 164 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 165 | Ga0207698_10000048 | 3300026142 | Bacteria | 90201 |
| 166 | Ga0207698_10014507 | 3300026142 | Bacteria | 5241 |
| 167 | Ga0207698_10447660 | 3300026142 | Bacteria | 1246 |
| 168 | Ga0207698_10974393 | 3300026142 | Bacteria | 858 |
| 169 | Ga0209813_10000335 | 3300027866 | Bacteria | 12250 |
| 170 | Ga0268264_10090306 | 3300028381 | Unclassified | 2640 |
| 171 | Ga0316177_1089352 | 3300030731 | Bacteria | 1273 |
| 172 | Ga0314311_1166584 | 3300030733 | Bacteria | 1017 |
| 173 | Ga0316179_1064424 | 3300030734 | Bacteria | 12008 |
| 174 | Ga0316180_1178386 | 3300030736 | Bacteria | 3765 |
| 175 | Ga0316183_1028961 | 3300030742 | Bacteria | 1502 |
| 176 | Ga0316183_1086663 | 3300030742 | Bacteria | 554 |
| 177 | Ga0316183_1192095 | 3300030742 | Bacteria | 16108 |
| 178 | Ga0316183_1206173 | 3300030742 | Bacteria | 2643 |
| 179 | Ga0316181_1019399 | 3300030744 | Bacteria | 3114 |
| 180 | Ga0316181_1182127 | 3300030744 | Bacteria | 1642 |
| 181 | Ga0316182_1017501 | 3300030745 | Bacteria | 11122 |
| 182 | Ga0316182_1175280 | 3300030745 | Bacteria | 2574 |
| 183 | Ga0316182_1396058 | 3300030745 | Bacteria | 6284 |
| 184 | Ga0307516_10000078 | 3300031730 | Bacteria | 106523 |
| 185 | Ga0307516_10008182 | 3300031730 | Bacteria | 11877 |
| 186 | Ga0307405_10349015 | 3300031731 | Bacteria | 1141 |
| 187 | Ga0307405_11892504 | 3300031731 | Bacteria | 532 |
| 188 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 189 | Ga0307406_10000901 | 3300031901 | Bacteria | 16682 |
| 190 | Ga0307411_11162481 | 3300032005 | Bacteria | 698 |
| 191 | Ga0373959_0000052 | 3300034820 | Bacteria | 26566 |
| 192 | Ga0373925_0514898 | 3300037068 | Bacteria | 983 |
| 193 | Ga0395899_0039022 | 3300037312 | Bacteria | 3556 |
| 194 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 195 | Ga0395900_0825092 | 3300037418 | Bacteria | 854 |
| 196 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 197 | Ga0395901_0000006 | 3300038443 | Bacteria | 514112 |
| 198 | Ga0395901_0036009 | 3300038443 | Bacteria | 5114 |
| 199 | Ga0439447_043550 | 3300041407 | Bacteria | 1087 |
| 200 | Ga0439461_0004322 | 3300041410 | Bacteria | 2370 |
| 201 | Ga0439466_0037829 | 3300041411 | Bacteria | 1623 |
| 202 | Ga0451793_0563460 | 3300041452 | Unclassified | 524 |
| 203 | Ga0451802_0044704 | 3300041460 | Bacteria | 841 |
| 204 | Ga0451807_2408538 | 3300041486 | Bacteria | 551 |
| 205 | Ga0451833_1049327 | 3300041491 | Bacteria | 504 |
| 206 | Ga0451851_1338469 | 3300041507 | Bacteria | 535 |
| 207 | Ga0439431_0250334 | 3300041997 | Bacteria | 525 |
| 208 | Ga0439437_040033 | 3300042000 | Bacteria | 606 |
| 209 | Ga0439442_012396 | 3300042002 | Bacteria | 1743 |
| 210 | Ga0439442_045479 | 3300042002 | Bacteria | 925 |
| 211 | Ga0439445_0001581 | 3300042004 | Bacteria | 4962 |
| 212 | Ga0439432_007573 | 3300042006 | Bacteria | 3842 |
| 213 | Ga0439452_046383 | 3300042010 | Bacteria | 1009 |
| 214 | Ga0439462_0067725 | 3300042015 | Bacteria | 968 |
| 215 | Ga0450919_012280 | 3300042121 | Bacteria | 972 |
| 216 | Ga0450906_035846 | 3300042145 | Bacteria | 875 |
| 217 | Ga0439446_0000001 | 3300042156 | Bacteria | 275840 |
| 218 | Ga0439446_0000974 | 3300042156 | Bacteria | 6228 |
| 219 | Ga0439434_0002878 | 3300042435 | Bacteria | 5024 |
| 220 | Ga0439434_0013541 | 3300042435 | Bacteria | 2422 |
| 221 | Ga0439459_0210636 | 3300042438 | Bacteria | 534 |
| 222 | Ga0439464_0000130 | 3300042439 | Bacteria | 11960 |
| 223 | Ga0450918_000617 | 3300042531 | Bacteria | 7630 |
| 224 | Ga0450918_027776 | 3300042531 | Bacteria | 995 |
| 225 | Ga0466972_0031376 | 3300044658 | Bacteria | 2614 |
| 226 | Ga0466965_0000206 | 3300044683 | Bacteria | 18416 |
| 227 | Ga0466970_0097656 | 3300044765 | Bacteria | 1598 |
| 228 | Ga0495638_0000551 | 3300046460 | Bacteria | 42775 |
| 229 | Ga0495660_0000005 | 3300046810 | Bacteria | 574567 |
| 230 | Ga0495672_0021461 | 3300047320 | Bacteria | 4212 |
| 231 | Ga0495686_0005549 | 3300047472 | Bacteria | 9924 |
| 232 | Ga0496100_0058590 | 3300048903 | Unclassified | 2528 |
| 233 | Ga0496100_0564003 | 3300048903 | Bacteria | 882 |
| 234 | Ga0496101_0488997 | 3300048904 | Bacteria | 972 |
| 235 | Ga0496109_0631883 | 3300048912 | Bacteria | 1007 |
| 236 | Ga0496110_0486132 | 3300048913 | Bacteria | 1125 |
| 237 | Ga0496111_1082373 | 3300048914 | Bacteria | 572 |
| 238 | Ga0496113_0025550 | 3300048916 | Bacteria | 4212 |
| 239 | Ga0496115_0000405 | 3300048918 | Bacteria | 35545 |
| 240 | Ga0501034_0009503 | 3300049571 | Bacteria | 10178 |
| 241 | Ga0501034_0037263 | 3300049571 | Bacteria | 4923 |
| 242 | Ga0501040_0297325 | 3300049576 | Unclassified | 1154 |
| 243 | Ga0501043_0896718 | 3300049579 | Bacteria | 636 |
| 244 | nmdc:mga03n38_936195_c1 | 3300050490 | Unclassified | 511 |
| 245 | nmdc:mga00v17_120_c1 | 3300050491 | Bacteria | 46472 |
| 246 | nmdc:mga00v17_137512_c1 | 3300050491 | Bacteria | 1565 |
| 247 | nmdc:mga00v17_2126_c1 | 3300050491 | Bacteria | 10185 |
| 248 | nmdc:mga00v17_724240_c1 | 3300050491 | Bacteria | 637 |
| 249 | nmdc:mga00v17_929085_c1 | 3300050491 | Bacteria | 550 |
| 250 | nmdc:mga0yw44_1173527_c1 | 3300050492 | Bacteria | 518 |
| 251 | nmdc:mga0yw44_157232_c1 | 3300050492 | Bacteria | 1486 |
| 252 | nmdc:mga0yw44_16_c1 | 3300050492 | Bacteria | 80085 |
| 253 | nmdc:mga0yw44_185349_c1 | 3300050492 | Bacteria | 1371 |
| 254 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 255 | nmdc:mga0yw44_319236_c1 | 3300050492 | Bacteria | 1043 |
| 256 | nmdc:mga0yw44_3_c1 | 3300050492 | Bacteria | 561857 |
| 257 | nmdc:mga0yw44_4_c1 | 3300050492 | Bacteria | 450247 |
| 258 | nmdc:mga0k408_3696_c1 | 3300050493 | Bacteria | 7332 |
| 259 | nmdc:mga0k408_545276_c1 | 3300050493 | Bacteria | 686 |
| 260 | nmdc:mga06z11_198_c1 | 3300050494 | Bacteria | 24266 |
| 261 | nmdc:mga06z11_215659_c1 | 3300050494 | Bacteria | 1120 |
| 262 | nmdc:mga04h51_251_c1 | 3300050495 | Bacteria | 14040 |
| 263 | nmdc:mga07m45_10022_c1 | 3300050496 | Bacteria | 4932 |
| 264 | nmdc:mga07m45_450985_c1 | 3300050496 | Bacteria | 746 |
| 265 | nmdc:mga07m45_65156_c1 | 3300050496 | Bacteria | 2069 |
| 266 | nmdc:mga0sz30_13016_c1 | 3300050516 | Bacteria | 3248 |
| 267 | nmdc:mga0sz30_1978_c1 | 3300050516 | Bacteria | 1587 |
| 268 | Ga0500643_003979 | 3300053087 | Bacteria | 6836 |
| 269 | Ga0500583_0011114 | 3300053092 | Bacteria | 3378 |
| 270 | Ga0500651_0000001 | 3300053093 | Bacteria | 529808 |
| 271 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 272 | Ga0500650_0190289 | 3300053098 | Bacteria | 937 |
| 273 | Ga0500555_000009 | 3300053103 | Bacteria | 263998 |
| 274 | Ga0500556_0172673 | 3300053104 | Bacteria | 854 |
| 275 | Ga0500569_000018 | 3300053109 | Bacteria | 42775 |
| 276 | Ga0500593_017808 | 3300053117 | Bacteria | 3089 |
| 277 | Ga0500594_0000018 | 3300053118 | Bacteria | 61549 |
| 278 | Ga0500628_192827 | 3300053129 | Unclassified | 585 |
| 279 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 280 | Ga0500655_004905 | 3300053133 | Bacteria | 2404 |
| 281 | Ga0500588_0000557 | 3300053146 | Bacteria | 6064 |
| 282 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 283 | Ga0500616_0015635 | 3300053153 | Bacteria | 4334 |
| 284 | Ga0500616_0025837 | 3300053153 | Bacteria | 3256 |
| 285 | Ga0500649_179282 | 3300053722 | Bacteria | 718 |
| 286 | Ga0500570_008150 | 3300053724 | Bacteria | 5773 |
| 287 | Ga0500570_114608 | 3300053724 | Bacteria | 1081 |
| 288 | Ga0500656_008295 | 3300053732 | Bacteria | 1099 |
| 289 | Ga0500613_001285 | 3300053738 | Bacteria | 1712 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048914 | Ga0496111_1082373 | Ga0496111_1082373_154_534 | 99 |
| 2 | 3300041452 | Ga0451793_0563460 | Ga0451793_0563460_108_461 | 101 |
| 3 | 3300053732 | Ga0500656_008295 | Ga0500656_008295_16_333 | 101 |
| 4 | 3300013102 | Ga0157371_10050953 | Ga0157371_100509534 | 103 |
| 5 | 3300013307 | Ga0157372_10278510 | Ga0157372_102785103 | 103 |
| 6 | 3300006038 | Ga0075365_10000232 | Ga0075365_1000023217 | 104 |
| 7 | 3300006048 | Ga0075363_101015787 | Ga0075363_1010157871 | 104 |
| 8 | 3300006051 | Ga0075364_10002663 | Ga0075364_100026637 | 104 |
| 9 | 3300050490 | nmdc:mga03n38_936195_c1 | nmdc:mga03n38_936195_c1_79_450 | 104 |
| 10 | 3300050491 | nmdc:mga00v17_2126_c1 | nmdc:mga00v17_2126_c1_6826_7197 | 104 |
| 11 | 3300050492 | nmdc:mga0yw44_3_c1 | nmdc:mga0yw44_3_c1_6826_7197 | 104 |
| 12 | 3300006237 | Ga0097621_100000001 | Ga0097621_100000001676 | 105 |
| 13 | 3300006358 | Ga0068871_100000002 | Ga0068871_100000002152 | 105 |
| 14 | 3300048918 | Ga0496115_0000405 | Ga0496115_0000405_23772_24203 | 105 |
| 15 | 3300049571 | Ga0501034_0037263 | Ga0501034_0037263_1170_1532 | 105 |
| 16 | 3300053133 | Ga0500655_004905 | Ga0500655_004905_516_929 | 105 |
| 17 | 3300005577 | Ga0068857_100590162 | Ga0068857_1005901621 | 106 |
| 18 | 3300026116 | Ga0207674_10341793 | Ga0207674_103417932 | 106 |
| 19 | 3300031731 | Ga0307405_10349015 | Ga0307405_103490152 | 106 |
| 20 | 3300006177 | Ga0075362_10392282 | Ga0075362_103922822 | 107 |
| 21 | 3300009093 | Ga0105240_10000050 | Ga0105240_10000050124 | 107 |
| 22 | 3300009545 | Ga0105237_10061315 | Ga0105237_100613153 | 107 |
| 23 | 3300014745 | Ga0157377_10001053 | Ga0157377_1000105312 | 107 |
| 24 | 3300014968 | Ga0157379_10006609 | Ga0157379_100066098 | 107 |
| 25 | 3300025913 | Ga0207695_10000158 | Ga0207695_10000158107 | 107 |
| 26 | 3300025914 | Ga0207671_10033531 | Ga0207671_100335313 | 107 |
| 27 | 3300026088 | Ga0207641_10826213 | Ga0207641_108262132 | 107 |
| 28 | 3300034820 | Ga0373959_0000052 | Ga0373959_0000052_12263_12667 | 107 |
| 29 | 3300038443 | Ga0395901_0036009 | Ga0395901_0036009_847_1236 | 107 |
| 30 | 3300047320 | Ga0495672_0021461 | Ga0495672_0021461_1616_1999 | 107 |
| 31 | 3300005564 | Ga0070664_100093442 | Ga0070664_1000934422 | 108 |
| 32 | 3300005616 | Ga0068852_100064518 | Ga0068852_1000645183 | 108 |
| 33 | 3300005843 | Ga0068860_100111002 | Ga0068860_1001110023 | 108 |
| 34 | 3300006038 | Ga0075365_10069344 | Ga0075365_100693444 | 108 |
| 35 | 3300006051 | Ga0075364_10198129 | Ga0075364_101981292 | 108 |
| 36 | 3300006353 | Ga0075370_10254951 | Ga0075370_102549512 | 108 |
| 37 | 3300009979 | Ga0105032_100148 | Ga0105032_10014810 | 108 |
| 38 | 3300009993 | Ga0105028_100830 | Ga0105028_1008302 | 108 |
| 39 | 3300013307 | Ga0157372_10579105 | Ga0157372_105791052 | 108 |
| 40 | 3300013307 | Ga0157372_11176099 | Ga0157372_111760992 | 108 |
| 41 | 3300025945 | Ga0207679_10670768 | Ga0207679_106707681 | 108 |
| 42 | 3300026142 | Ga0207698_10014507 | Ga0207698_100145074 | 108 |
| 43 | 3300028381 | Ga0268264_10090306 | Ga0268264_100903063 | 108 |
| 44 | 3300031730 | Ga0307516_10008182 | Ga0307516_100081826 | 108 |
| 45 | 3300044765 | Ga0466970_0097656 | Ga0466970_0097656_1172_1573 | 108 |
| 46 | 3300047472 | Ga0495686_0005549 | Ga0495686_0005549_4629_5045 | 108 |
| 47 | 3300049576 | Ga0501040_0297325 | Ga0501040_0297325_686_1138 | 108 |
| 48 | 3300053104 | Ga0500556_0172673 | Ga0500556_0172673_182_622 | 108 |
| 49 | 3300050491 | nmdc:mga00v17_929085_c1 | nmdc:mga00v17_929085_c1_97_462 | 109 |
| 50 | 3300013296 | Ga0157374_11622594 | Ga0157374_116225941 | 110 |
| 51 | 3300013307 | Ga0157372_10000086 | Ga0157372_1000008621 | 110 |
| 52 | 3300053092 | Ga0500583_0011114 | Ga0500583_0011114_1256_1597 | 110 |
| 53 | 3300053096 | Ga0500641_0000001 | Ga0500641_0000001_72774_73115 | 110 |
| 54 | 3300053098 | Ga0500650_0190289 | Ga0500650_0190289_428_769 | 110 |
| 55 | 3300053131 | Ga0500652_000001 | Ga0500652_000001_289358_289699 | 110 |
| 56 | 3300013102 | Ga0157371_10523502 | Ga0157371_105235021 | 111 |
| 57 | 3300013105 | Ga0157369_10000413 | Ga0157369_100004131 | 111 |
| 58 | 3300013105 | Ga0157369_10013289 | Ga0157369_1001328917 | 111 |
| 59 | 3300030731 | Ga0316177_1089352 | Ga0316177_10893522 | 111 |
| 60 | 3300041407 | Ga0439447_043550 | Ga0439447_043550_501_845 | 111 |
| 61 | 3300041410 | Ga0439461_0004322 | Ga0439461_0004322_1818_2162 | 111 |
| 62 | 3300041411 | Ga0439466_0037829 | Ga0439466_0037829_520_864 | 111 |
| 63 | 3300041997 | Ga0439431_0250334 | Ga0439431_0250334_114_458 | 111 |
| 64 | 3300042002 | Ga0439442_012396 | Ga0439442_012396_421_765 | 111 |
| 65 | 3300042010 | Ga0439452_046383 | Ga0439452_046383_157_501 | 111 |
| 66 | 3300042015 | Ga0439462_0067725 | Ga0439462_0067725_368_712 | 111 |
| 67 | 3300042121 | Ga0450919_012280 | Ga0450919_012280_313_657 | 111 |
| 68 | 3300042156 | Ga0439446_0000001 | Ga0439446_0000001_16977_17321 | 111 |
| 69 | 3300042156 | Ga0439446_0000974 | Ga0439446_0000974_1407_1751 | 111 |
| 70 | 3300042435 | Ga0439434_0002878 | Ga0439434_0002878_1230_1574 | 111 |
| 71 | 3300042435 | Ga0439434_0013541 | Ga0439434_0013541_1561_1905 | 111 |
| 72 | 3300046810 | Ga0495660_0000005 | Ga0495660_0000005_125551_125895 | 111 |
| 73 | 3300005293 | Ga0065715_10099813 | Ga0065715_100998136 | 112 |
| 74 | 3300006038 | Ga0075365_10371109 | Ga0075365_103711092 | 112 |
| 75 | 3300031901 | Ga0307406_10000001 | Ga0307406_10000001207 | 112 |
| 76 | 3300032005 | Ga0307411_11162481 | Ga0307411_111624811 | 112 |
| 77 | 3300050492 | nmdc:mga0yw44_1173527_c1 | nmdc:mga0yw44_1173527_c1_135_482 | 112 |
| 78 | 3300050492 | nmdc:mga0yw44_319236_c1 | nmdc:mga0yw44_319236_c1_79_426 | 112 |
| 79 | 2162886012 | MBSR1b_contig_1699160 | MBSR1b_0967.00001270 | 113 |
| 80 | 3300025913 | Ga0207695_10740774 | Ga0207695_107407742 | 113 |
| 81 | 3300046460 | Ga0495638_0000551 | Ga0495638_0000551_37180_37524 | 113 |
| 82 | 3300048903 | Ga0496100_0564003 | Ga0496100_0564003_341_778 | 113 |
| 83 | 3300048904 | Ga0496101_0488997 | Ga0496101_0488997_130_567 | 113 |
| 84 | 3300053109 | Ga0500569_000018 | Ga0500569_000018_37180_37524 | 113 |
| 85 | 3300053146 | Ga0500588_0000557 | Ga0500588_0000557_480_824 | 113 |
| 86 | 3300005339 | Ga0070660_100000316 | Ga0070660_10000031614 | 114 |
| 87 | 3300005577 | Ga0068857_100021011 | Ga0068857_1000210111 | 114 |
| 88 | 3300005578 | Ga0068854_100026707 | Ga0068854_1000267076 | 114 |
| 89 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001461 | 114 |
| 90 | 3300006038 | Ga0075365_10000014 | Ga0075365_1000001417 | 114 |
| 91 | 3300009093 | Ga0105240_10000004 | Ga0105240_10000004168 | 114 |
| 92 | 3300009545 | Ga0105237_10000001 | Ga0105237_10000001601 | 114 |
| 93 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002355 | 114 |
| 94 | 3300009551 | Ga0105238_10062208 | Ga0105238_100622086 | 114 |
| 95 | 3300013104 | Ga0157370_10002357 | Ga0157370_1000235714 | 114 |
| 96 | 3300013105 | Ga0157369_10000151 | Ga0157369_1000015177 | 114 |
| 97 | 3300013307 | Ga0157372_10000002 | Ga0157372_10000002146 | 114 |
| 98 | 3300014326 | Ga0157380_13032532 | Ga0157380_130325322 | 114 |
| 99 | 3300025913 | Ga0207695_10000009 | Ga0207695_10000009548 | 114 |
| 100 | 3300025914 | Ga0207671_10000003 | Ga0207671_10000003604 | 114 |
| 101 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008459 | 114 |
| 102 | 3300025919 | Ga0207657_10002562 | Ga0207657_1000256214 | 114 |
| 103 | 3300025924 | Ga0207694_10056409 | Ga0207694_100564094 | 114 |
| 104 | 3300025924 | Ga0207694_10707111 | Ga0207694_107071111 | 114 |
| 105 | 3300025981 | Ga0207640_10019721 | Ga0207640_100197212 | 114 |
| 106 | 3300026116 | Ga0207674_10020195 | Ga0207674_1002019511 | 114 |
| 107 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001412 | 114 |
| 108 | 3300030745 | Ga0316182_1175280 | Ga0316182_11752804 | 114 |
| 109 | 3300041491 | Ga0451833_1049327 | Ga0451833_1049327_99_446 | 114 |
| 110 | 3300042145 | Ga0450906_035846 | Ga0450906_035846_417_776 | 114 |
| 111 | 3300042531 | Ga0450918_027776 | Ga0450918_027776_573_932 | 114 |
| 112 | 3300048903 | Ga0496100_0058590 | Ga0496100_0058590_1335_1727 | 114 |
| 113 | 3300048912 | Ga0496109_0631883 | Ga0496109_0631883_199_624 | 114 |
| 114 | 3300048913 | Ga0496110_0486132 | Ga0496110_0486132_225_650 | 114 |
| 115 | 3300049571 | Ga0501034_0009503 | Ga0501034_0009503_1526_1885 | 114 |
| 116 | 3300050492 | nmdc:mga0yw44_16_c1 | nmdc:mga0yw44_16_c1_65983_66330 | 114 |
| 117 | 3300003323 | rootH1_10030295 | rootH1_100302957 | 115 |
| 118 | 3300014969 | Ga0157376_10000027 | Ga0157376_100000275 | 115 |
| 119 | 3300031730 | Ga0307516_10000078 | Ga0307516_1000007890 | 115 |
| 120 | 3300037418 | Ga0395900_0825092 | Ga0395900_0825092_434_808 | 115 |
| 121 | 3300041460 | Ga0451802_0044704 | Ga0451802_0044704_239_610 | 115 |
| 122 | 3300041486 | Ga0451807_2408538 | Ga0451807_2408538_156_527 | 115 |
| 123 | 2162886011 | MRS1b_contig_542959 | MRS1b_0860.00002650 | 116 |
| 124 | 3300001915 | JGI24741J21665_1029691 | JGI24741J21665_10296912 | 116 |
| 125 | 3300001979 | JGI24740J21852_10004913 | JGI24740J21852_100049137 | 116 |
| 126 | 3300001979 | JGI24740J21852_10019351 | JGI24740J21852_100193515 | 116 |
| 127 | 3300001989 | JGI24739J22299_10005141 | JGI24739J22299_100051417 | 116 |
| 128 | 3300001990 | JGI24737J22298_10002203 | JGI24737J22298_100022037 | 116 |
| 129 | 3300001991 | JGI24743J22301_10000630 | JGI24743J22301_100006304 | 116 |
| 130 | 3300002067 | JGI24735J21928_10000149 | JGI24735J21928_100001498 | 116 |
| 131 | 3300002075 | JGI24738J21930_10001791 | JGI24738J21930_100017917 | 116 |
| 132 | 3300002155 | JGI24033J26618_1001309 | JGI24033J26618_10013094 | 116 |
| 133 | 3300003316 | rootH1_10002936 | rootH1_1000293634 | 116 |
| 134 | 3300003316 | rootH1_10154833 | rootH1_101548331 | 116 |
| 135 | 3300003320 | rootH2_10006847 | rootH2_1000684721 | 116 |
| 136 | 3300003322 | rootL2_10183129 | rootL2_101831293 | 116 |
| 137 | 3300003323 | rootH1_10196557 | rootH1_101965572 | 116 |
| 138 | 3300005290 | Ga0065712_10284678 | Ga0065712_102846781 | 116 |
| 139 | 3300005327 | Ga0070658_10000024 | Ga0070658_10000024146 | 116 |
| 140 | 3300005329 | Ga0070683_100010750 | Ga0070683_1000107505 | 116 |
| 141 | 3300005329 | Ga0070683_100724814 | Ga0070683_1007248142 | 116 |
| 142 | 3300005334 | Ga0068869_100155766 | Ga0068869_1001557662 | 116 |
| 143 | 3300005339 | Ga0070660_100045343 | Ga0070660_1000453437 | 116 |
| 144 | 3300005339 | Ga0070660_101454377 | Ga0070660_1014543771 | 116 |
| 145 | 3300005344 | Ga0070661_100056640 | Ga0070661_1000566401 | 116 |
| 146 | 3300005345 | Ga0070692_10438243 | Ga0070692_104382432 | 116 |
| 147 | 3300005354 | Ga0070675_100093937 | Ga0070675_1000939373 | 116 |
| 148 | 3300005366 | Ga0070659_100089113 | Ga0070659_1000891131 | 116 |
| 149 | 3300005455 | Ga0070663_100455377 | Ga0070663_1004553772 | 116 |
| 150 | 3300005457 | Ga0070662_100009029 | Ga0070662_1000090297 | 116 |
| 151 | 3300005468 | Ga0070707_101579984 | Ga0070707_1015799841 | 116 |
| 152 | 3300005535 | Ga0070684_100046576 | Ga0070684_1000465765 | 116 |
| 153 | 3300005563 | Ga0068855_100000663 | Ga0068855_10000066344 | 116 |
| 154 | 3300005564 | Ga0070664_100000123 | Ga0070664_1000001231 | 116 |
| 155 | 3300005564 | Ga0070664_100003334 | Ga0070664_1000033342 | 116 |
| 156 | 3300005577 | Ga0068857_100000441 | Ga0068857_10000044116 | 116 |
| 157 | 3300005577 | Ga0068857_100158594 | Ga0068857_1001585941 | 116 |
| 158 | 3300005614 | Ga0068856_100000027 | Ga0068856_10000002713 | 116 |
| 159 | 3300005614 | Ga0068856_100000200 | Ga0068856_1000002005 | 116 |
| 160 | 3300005616 | Ga0068852_100000155 | Ga0068852_10000015555 | 116 |
| 161 | 3300005616 | Ga0068852_100269563 | Ga0068852_1002695632 | 116 |
| 162 | 3300005618 | Ga0068864_101873381 | Ga0068864_1018733811 | 116 |
| 163 | 3300005937 | Ga0081455_10000001 | Ga0081455_10000001318 | 116 |
| 164 | 3300006038 | Ga0075365_10007875 | Ga0075365_100078756 | 116 |
| 165 | 3300006038 | Ga0075365_10185564 | Ga0075365_101855642 | 116 |
| 166 | 3300006042 | Ga0075368_10002082 | Ga0075368_100020824 | 116 |
| 167 | 3300006048 | Ga0075363_100018117 | Ga0075363_1000181176 | 116 |
| 168 | 3300006051 | Ga0075364_10002700 | Ga0075364_1000270014 | 116 |
| 169 | 3300006051 | Ga0075364_10133714 | Ga0075364_101337141 | 116 |
| 170 | 3300006177 | Ga0075362_10032747 | Ga0075362_100327473 | 116 |
| 171 | 3300006178 | Ga0075367_10008164 | Ga0075367_100081644 | 116 |
| 172 | 3300006178 | Ga0075367_10245941 | Ga0075367_102459412 | 116 |
| 173 | 3300006186 | Ga0075369_10000181 | Ga0075369_1000018130 | 116 |
| 174 | 3300006195 | Ga0075366_10010874 | Ga0075366_100108747 | 116 |
| 175 | 3300006353 | Ga0075370_10111592 | Ga0075370_101115921 | 116 |
| 176 | 3300006844 | Ga0075428_100001999 | Ga0075428_10000199918 | 116 |
| 177 | 3300006881 | Ga0068865_100000307 | Ga0068865_10000030721 | 116 |
| 178 | 3300009093 | Ga0105240_10001357 | Ga0105240_1000135743 | 116 |
| 179 | 3300009098 | Ga0105245_10287831 | Ga0105245_102878312 | 116 |
| 180 | 3300009174 | Ga0105241_10058310 | Ga0105241_100583104 | 116 |
| 181 | 3300009174 | Ga0105241_10082024 | Ga0105241_100820245 | 116 |
| 182 | 3300009551 | Ga0105238_10140584 | Ga0105238_101405844 | 116 |
| 183 | 3300009979 | Ga0105032_100001 | Ga0105032_100001315 | 116 |
| 184 | 3300009979 | Ga0105032_100020 | Ga0105032_1000205 | 116 |
| 185 | 3300009984 | Ga0105029_100086 | Ga0105029_1000862 | 116 |
| 186 | 3300010375 | Ga0105239_10001223 | Ga0105239_1000122331 | 116 |
| 187 | 3300011119 | Ga0105246_10052123 | Ga0105246_100521232 | 116 |
| 188 | 3300011119 | Ga0105246_10538441 | Ga0105246_105384412 | 116 |
| 189 | 3300012475 | Ga0157317_1024739 | Ga0157317_10247392 | 116 |
| 190 | 3300012503 | Ga0157313_1046517 | Ga0157313_10465172 | 116 |
| 191 | 3300013100 | Ga0157373_10043985 | Ga0157373_100439855 | 116 |
| 192 | 3300013102 | Ga0157371_10007527 | Ga0157371_1000752711 | 116 |
| 193 | 3300013104 | Ga0157370_10012318 | Ga0157370_100123184 | 116 |
| 194 | 3300013104 | Ga0157370_10290543 | Ga0157370_102905432 | 116 |
| 195 | 3300013105 | Ga0157369_10000029 | Ga0157369_10000029222 | 116 |
| 196 | 3300013105 | Ga0157369_10000567 | Ga0157369_1000056751 | 116 |
| 197 | 3300013296 | Ga0157374_10004073 | Ga0157374_100040738 | 116 |
| 198 | 3300013297 | Ga0157378_10461045 | Ga0157378_104610452 | 116 |
| 199 | 3300013307 | Ga0157372_10403635 | Ga0157372_104036353 | 116 |
| 200 | 3300013308 | Ga0157375_10074210 | Ga0157375_100742102 | 116 |
| 201 | 3300014325 | Ga0163163_10211208 | Ga0163163_102112084 | 116 |
| 202 | 3300014745 | Ga0157377_10000920 | Ga0157377_1000092015 | 116 |
| 203 | 3300014969 | Ga0157376_10276006 | Ga0157376_102760063 | 116 |
| 204 | 3300025315 | Ga0207697_10044198 | Ga0207697_100441981 | 116 |
| 205 | 3300025901 | Ga0207688_10501377 | Ga0207688_105013772 | 116 |
| 206 | 3300025904 | Ga0207647_10001245 | Ga0207647_1000124519 | 116 |
| 207 | 3300025909 | Ga0207705_10000047 | Ga0207705_1000004761 | 116 |
| 208 | 3300025911 | Ga0207654_10068504 | Ga0207654_100685042 | 116 |
| 209 | 3300025913 | Ga0207695_10012231 | Ga0207695_100122312 | 116 |
| 210 | 3300025919 | Ga0207657_10011048 | Ga0207657_1001104810 | 116 |
| 211 | 3300025920 | Ga0207649_10240105 | Ga0207649_102401052 | 116 |
| 212 | 3300025924 | Ga0207694_10088559 | Ga0207694_100885594 | 116 |
| 213 | 3300025927 | Ga0207687_10270848 | Ga0207687_102708482 | 116 |
| 214 | 3300025932 | Ga0207690_10002652 | Ga0207690_100026527 | 116 |
| 215 | 3300025933 | Ga0207706_10000073 | Ga0207706_1000007353 | 116 |
| 216 | 3300025938 | Ga0207704_10001468 | Ga0207704_100014688 | 116 |
| 217 | 3300025944 | Ga0207661_10002445 | Ga0207661_1000244516 | 116 |
| 218 | 3300025945 | Ga0207679_10000124 | Ga0207679_1000012462 | 116 |
| 219 | 3300025949 | Ga0207667_10000756 | Ga0207667_1000075643 | 116 |
| 220 | 3300026078 | Ga0207702_10000015 | Ga0207702_10000015106 | 116 |
| 221 | 3300026078 | Ga0207702_10000034 | Ga0207702_10000034106 | 116 |
| 222 | 3300026078 | Ga0207702_10000057 | Ga0207702_1000005798 | 116 |
| 223 | 3300026095 | Ga0207676_11742972 | Ga0207676_117429721 | 116 |
| 224 | 3300026116 | Ga0207674_10000878 | Ga0207674_1000087816 | 116 |
| 225 | 3300026116 | Ga0207674_10310606 | Ga0207674_103106063 | 116 |
| 226 | 3300026142 | Ga0207698_10000048 | Ga0207698_1000004813 | 116 |
| 227 | 3300026142 | Ga0207698_10447660 | Ga0207698_104476601 | 116 |
| 228 | 3300026142 | Ga0207698_10974393 | Ga0207698_109743932 | 116 |
| 229 | 3300027866 | Ga0209813_10000335 | Ga0209813_1000033517 | 116 |
| 230 | 3300030733 | Ga0314311_1166584 | Ga0314311_11665842 | 116 |
| 231 | 3300030734 | Ga0316179_1064424 | Ga0316179_10644249 | 116 |
| 232 | 3300030736 | Ga0316180_1178386 | Ga0316180_11783862 | 116 |
| 233 | 3300030742 | Ga0316183_1028961 | Ga0316183_10289611 | 116 |
| 234 | 3300030742 | Ga0316183_1086663 | Ga0316183_10866631 | 116 |
| 235 | 3300030742 | Ga0316183_1192095 | Ga0316183_11920959 | 116 |
| 236 | 3300030742 | Ga0316183_1206173 | Ga0316183_12061732 | 116 |
| 237 | 3300030744 | Ga0316181_1019399 | Ga0316181_10193993 | 116 |
| 238 | 3300030744 | Ga0316181_1182127 | Ga0316181_11821272 | 116 |
| 239 | 3300030745 | Ga0316182_1017501 | Ga0316182_10175016 | 116 |
| 240 | 3300030745 | Ga0316182_1396058 | Ga0316182_13960589 | 116 |
| 241 | 3300031731 | Ga0307405_11892504 | Ga0307405_118925041 | 116 |
| 242 | 3300031901 | Ga0307406_10000901 | Ga0307406_1000090116 | 116 |
| 243 | 3300037068 | Ga0373925_0514898 | Ga0373925_0514898_528_893 | 116 |
| 244 | 3300037312 | Ga0395899_0039022 | Ga0395899_0039022_472_822 | 116 |
| 245 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_260137_260487 | 116 |
| 246 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_845519_845869 | 116 |
| 247 | 3300038443 | Ga0395901_0000006 | Ga0395901_0000006_491195_491545 | 116 |
| 248 | 3300041507 | Ga0451851_1338469 | Ga0451851_1338469_21_380 | 116 |
| 249 | 3300042000 | Ga0439437_040033 | Ga0439437_040033_10_360 | 116 |
| 250 | 3300042002 | Ga0439442_045479 | Ga0439442_045479_356_706 | 116 |
| 251 | 3300042004 | Ga0439445_0001581 | Ga0439445_0001581_570_920 | 116 |
| 252 | 3300042006 | Ga0439432_007573 | Ga0439432_007573_1622_1972 | 116 |
| 253 | 3300042438 | Ga0439459_0210636 | Ga0439459_0210636_141_491 | 116 |
| 254 | 3300042439 | Ga0439464_0000130 | Ga0439464_0000130_10612_10962 | 116 |
| 255 | 3300042531 | Ga0450918_000617 | Ga0450918_000617_893_1279 | 116 |
| 256 | 3300044658 | Ga0466972_0031376 | Ga0466972_0031376_1083_1433 | 116 |
| 257 | 3300044683 | Ga0466965_0000206 | Ga0466965_0000206_5006_5356 | 116 |
| 258 | 3300048916 | Ga0496113_0025550 | Ga0496113_0025550_478_828 | 116 |
| 259 | 3300049579 | Ga0501043_0896718 | Ga0501043_0896718_217_579 | 116 |
| 260 | 3300050491 | nmdc:mga00v17_120_c1 | nmdc:mga00v17_120_c1_25696_26061 | 116 |
| 261 | 3300050491 | nmdc:mga00v17_137512_c1 | nmdc:mga00v17_137512_c1_171_521 | 116 |
| 262 | 3300050491 | nmdc:mga00v17_724240_c1 | nmdc:mga00v17_724240_c1_24_389 | 116 |
| 263 | 3300050492 | nmdc:mga0yw44_157232_c1 | nmdc:mga0yw44_157232_c1_720_1082 | 116 |
| 264 | 3300050492 | nmdc:mga0yw44_185349_c1 | nmdc:mga0yw44_185349_c1_493_843 | 116 |
| 265 | 3300050492 | nmdc:mga0yw44_1_c1 | nmdc:mga0yw44_1_c1_181842_182213 | 116 |
| 266 | 3300050492 | nmdc:mga0yw44_4_c1 | nmdc:mga0yw44_4_c1_321440_321805 | 116 |
| 267 | 3300050493 | nmdc:mga0k408_3696_c1 | nmdc:mga0k408_3696_c1_5621_5971 | 116 |
| 268 | 3300050493 | nmdc:mga0k408_545276_c1 | nmdc:mga0k408_545276_c1_211_576 | 116 |
| 269 | 3300050494 | nmdc:mga06z11_198_c1 | nmdc:mga06z11_198_c1_14183_14548 | 116 |
| 270 | 3300050494 | nmdc:mga06z11_215659_c1 | nmdc:mga06z11_215659_c1_177_527 | 116 |
| 271 | 3300050495 | nmdc:mga04h51_251_c1 | nmdc:mga04h51_251_c1_12209_12574 | 116 |
| 272 | 3300050496 | nmdc:mga07m45_10022_c1 | nmdc:mga07m45_10022_c1_2695_3045 | 116 |
| 273 | 3300050496 | nmdc:mga07m45_450985_c1 | nmdc:mga07m45_450985_c1_225_584 | 116 |
| 274 | 3300050496 | nmdc:mga07m45_65156_c1 | nmdc:mga07m45_65156_c1_1183_1548 | 116 |
| 275 | 3300050516 | nmdc:mga0sz30_13016_c1 | nmdc:mga0sz30_13016_c1_59_409 | 116 |
| 276 | 3300050516 | nmdc:mga0sz30_1978_c1 | nmdc:mga0sz30_1978_c1_654_1019 | 116 |
| 277 | 3300053087 | Ga0500643_003979 | Ga0500643_003979_4673_5023 | 116 |
| 278 | 3300053093 | Ga0500651_0000001 | Ga0500651_0000001_340148_340498 | 116 |
| 279 | 3300053103 | Ga0500555_000009 | Ga0500555_000009_257617_257979 | 116 |
| 280 | 3300053117 | Ga0500593_017808 | Ga0500593_017808_184_546 | 116 |
| 281 | 3300053118 | Ga0500594_0000018 | Ga0500594_0000018_7066_7416 | 116 |
| 282 | 3300053129 | Ga0500628_192827 | Ga0500628_192827_169_531 | 116 |
| 283 | 3300053153 | Ga0500616_0000012 | Ga0500616_0000012_397157_397516 | 116 |
| 284 | 3300053153 | Ga0500616_0015635 | Ga0500616_0015635_1626_1988 | 116 |
| 285 | 3300053153 | Ga0500616_0025837 | Ga0500616_0025837_1769_2134 | 116 |
| 286 | 3300053722 | Ga0500649_179282 | Ga0500649_179282_258_617 | 116 |
| 287 | 3300053724 | Ga0500570_008150 | Ga0500570_008150_3569_3937 | 116 |
| 288 | 3300053724 | Ga0500570_114608 | Ga0500570_114608_642_1001 | 116 |
| 289 | 3300053738 | Ga0500613_001285 | Ga0500613_001285_818_1180 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mmm-assembly1.cif.gz_p | structure of the 70s chloroplast ribosome | 0.9443 | 1 | 77 |
| 5zeb-assembly1.cif.gz_p | m. smegmatis p/p state 70s ribosome structure | 0.9343 | 1 | 76 |
| 6eri-assembly1.cif.gz_BP | structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor | 0.9335 | 1 | 77 |
| 8ced-assembly1.cif.gz_P | rnase r bound to a 30s degradation intermediate (state i - head-turning) | 0.9324 | 1 | 77 |
| 7p7u-assembly1.cif.gz_q | e. faecalis 70s ribosome with p-trna, state iv | 0.9277 | 1 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P56806_1_79_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.959 | 1 | 77 | 3.30.1320.10 |
| af_Q2FZ45_1_91_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.923 | 2 | 77 | 3.30.1320.10 |
| af_P56806_1_79_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9128 | 1 | 77 | 3.30.1320.10 |
| af_A0A0R0FN90_1_75_3.30.1320.10 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.9031 | 16 | 77 | 3.30.1320.10 |
| 4kdgP00 | Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 | 0.8983 | 1 | 77 | 3.30.1320.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4CBZ1-F1-model_v4 | Small ribosomal subunit protein bS16 | 0.9639 | 1 | 75 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |
| AF-G0WVK4-F1-model_v4 | Small ribosomal subunit protein bS16c | 0.9626 | 1 | 77 |
GO:0003735
GO:0005739 GO:0009507 GO:0015935 GO:0032543 |
| AF-A0A3Q8UGP8-F1-model_v4 | Small ribosomal subunit protein bS16c | 0.9625 | 1 | 77 |
GO:0003735
GO:0005739 GO:0009507 GO:0015935 GO:0032543 |
| AF-A0A7G8JS17-F1-model_v4 | Small ribosomal subunit protein bS16c | 0.9612 | 1 | 77 |
GO:0003735
GO:0005739 GO:0009507 GO:0015935 GO:0032543 |
| AF-Q0ZJ38-F1-model_v4 | Small ribosomal subunit protein bS16c (30S ribosomal protein S16, chloroplastic) | 0.9609 | 1 | 77 |
GO:0003735
GO:0006412 GO:0009507 GO:0015935 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar