F388961

General Info

Members Datasets Scaffolds Average Seq Length
289 183 289 116

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10006847|rootH2_1000684721
Length 128
Sequence MLAIRLQRLGRKGYPVYRLAVQESQRHPSSGRVVAYVGSYNPHTKEANVQVEAAQKYLDNGAQPTPRVVKLLKDAGVKLPKWVKEPETGKQKSIKNVEKLRKNQPKEKISEVTEETPAXXXPAQENAE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
57 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
58 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
62 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
102 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
103 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
104 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
120 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
134 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
170 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
173 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
174 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
175 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
176 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
181 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
182 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
183 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.53
Nodule 0
Rhizoplane 3.81
Rhizosphere 69.2
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_542959 2162886011 Bacteria 806
2 MBSR1b_contig_1699160 2162886012 Bacteria 1807
3 JGI24741J21665_1029691 3300001915 Bacteria 822
4 JGI24740J21852_10004913 3300001979 Bacteria 5690
5 JGI24740J21852_10019351 3300001979 Bacteria 2399
6 JGI24739J22299_10005141 3300001989 Bacteria 4982
7 JGI24737J22298_10002203 3300001990 Bacteria 6943
8 JGI24743J22301_10000630 3300001991 Bacteria 4295
9 JGI24735J21928_10000149 3300002067 Bacteria 24660
10 JGI24738J21930_10001791 3300002075 Bacteria 5840
11 JGI24033J26618_1001309 3300002155 Bacteria 2454
12 rootH1_10002936 3300003316 Bacteria 45055
13 rootH1_10154833 3300003316 Bacteria 1065
14 rootH2_10006847 3300003320 Bacteria 155484
15 rootL2_10183129 3300003322 Bacteria 2611
16 rootH1_10030295 3300003323 Bacteria 20195
17 rootH1_10196557 3300003323 Bacteria 1659
18 Ga0065712_10284678 3300005290 Bacteria 889
19 Ga0065715_10099813 3300005293 Bacteria 3366
20 Ga0070658_10000024 3300005327 Bacteria 175873
21 Ga0070683_100010750 3300005329 Bacteria 7874
22 Ga0070683_100724814 3300005329 Bacteria 952
23 Ga0068869_100155766 3300005334 Bacteria 1775
24 Ga0070660_100000316 3300005339 Bacteria 31842
25 Ga0070660_100045343 3300005339 Bacteria 3365
26 Ga0070660_101454377 3300005339 Bacteria 582
27 Ga0070661_100056640 3300005344 Bacteria 2872
28 Ga0070692_10438243 3300005345 Bacteria 833
29 Ga0070675_100093937 3300005354 Bacteria 2516
30 Ga0070659_100089113 3300005366 Bacteria 2471
31 Ga0070663_100455377 3300005455 Bacteria 1055
32 Ga0070662_100009029 3300005457 Bacteria 6502
33 Ga0070707_101579984 3300005468 Bacteria 623
34 Ga0070684_100046576 3300005535 Bacteria 3757
35 Ga0068855_100000663 3300005563 Bacteria 41994
36 Ga0070664_100000123 3300005564 Bacteria 51444
37 Ga0070664_100003334 3300005564 Bacteria 12978
38 Ga0070664_100093442 3300005564 Bacteria 2606
39 Ga0068857_100000441 3300005577 Bacteria 29474
40 Ga0068857_100021011 3300005577 Bacteria 5744
41 Ga0068857_100158594 3300005577 Bacteria 2052
42 Ga0068857_100590162 3300005577 Bacteria 1049
43 Ga0068854_100026707 3300005578 Bacteria 3971
44 Ga0068856_100000027 3300005614 Bacteria 133290
45 Ga0068856_100000200 3300005614 Bacteria 63772
46 Ga0068852_100000001 3300005616 Bacteria 716526
47 Ga0068852_100000155 3300005616 Bacteria 45515
48 Ga0068852_100064518 3300005616 Bacteria 3193
49 Ga0068852_100269563 3300005616 Bacteria 1638
50 Ga0068864_101873381 3300005618 Bacteria 605
51 Ga0068860_100111002 3300005843 Unclassified 2621
52 Ga0081455_10000001 3300005937 Bacteria 603871
53 Ga0075365_10000014 3300006038 Bacteria 79945
54 Ga0075365_10000232 3300006038 Bacteria 19058
55 Ga0075365_10007875 3300006038 Bacteria 6002
56 Ga0075365_10069344 3300006038 Bacteria 2370
57 Ga0075365_10185564 3300006038 Bacteria 1455
58 Ga0075365_10371109 3300006038 Bacteria 1009
59 Ga0075368_10002082 3300006042 Bacteria 6462
60 Ga0075363_100018117 3300006048 Bacteria 3503
61 Ga0075363_101015787 3300006048 Unclassified 511
62 Ga0075364_10002663 3300006051 Bacteria 10027
63 Ga0075364_10002700 3300006051 Bacteria 9968
64 Ga0075364_10133714 3300006051 Bacteria 1666
65 Ga0075364_10198129 3300006051 Bacteria 1361
66 Ga0075362_10032747 3300006177 Bacteria 2257
67 Ga0075362_10392282 3300006177 Bacteria 699
68 Ga0075367_10008164 3300006178 Bacteria 5409
69 Ga0075367_10245941 3300006178 Bacteria 1121
70 Ga0075369_10000181 3300006186 Bacteria 18065
71 Ga0075366_10010874 3300006195 Bacteria 5120
72 Ga0097621_100000001 3300006237 Bacteria 632268
73 Ga0075370_10111592 3300006353 Bacteria 1588
74 Ga0075370_10254951 3300006353 Bacteria 1040
75 Ga0068871_100000002 3300006358 Bacteria 152322
76 Ga0075428_100001999 3300006844 Bacteria 21962
77 Ga0068865_100000307 3300006881 Bacteria 27001
78 Ga0105240_10000004 3300009093 Bacteria 708156
79 Ga0105240_10000050 3300009093 Bacteria 236144
80 Ga0105240_10001357 3300009093 Bacteria 42000
81 Ga0105245_10287831 3300009098 Bacteria 1608
82 Ga0105241_10058310 3300009174 Bacteria 2965
83 Ga0105241_10082024 3300009174 Bacteria 2527
84 Ga0105237_10000001 3300009545 Bacteria 1009213
85 Ga0105237_10000002 3300009545 Bacteria 702357
86 Ga0105237_10061315 3300009545 Bacteria 3761
87 Ga0105238_10062208 3300009551 Bacteria 3733
88 Ga0105238_10140584 3300009551 Bacteria 2391
89 Ga0105032_100001 3300009979 Bacteria 472394
90 Ga0105032_100020 3300009979 Bacteria 43175
91 Ga0105032_100148 3300009979 Bacteria 7474
92 Ga0105029_100086 3300009984 Bacteria 4492
93 Ga0105028_100830 3300009993 Bacteria 3285
94 Ga0105239_10001223 3300010375 Bacteria 35012
95 Ga0105246_10052123 3300011119 Bacteria 2811
96 Ga0105246_10538441 3300011119 Bacteria 998
97 Ga0157317_1024739 3300012475 Bacteria 555
98 Ga0157313_1046517 3300012503 Bacteria 551
99 Ga0157373_10043985 3300013100 Bacteria 3188
100 Ga0157371_10007527 3300013102 Bacteria 8809
101 Ga0157371_10050953 3300013102 Bacteria 2942
102 Ga0157371_10523502 3300013102 Bacteria 877
103 Ga0157370_10002357 3300013104 Bacteria 22781
104 Ga0157370_10012318 3300013104 Bacteria 8877
105 Ga0157370_10290543 3300013104 Bacteria 1510
106 Ga0157369_10000029 3300013105 Bacteria 206955
107 Ga0157369_10000151 3300013105 Bacteria 98331
108 Ga0157369_10000413 3300013105 Bacteria 56589
109 Ga0157369_10000567 3300013105 Bacteria 48628
110 Ga0157369_10013289 3300013105 Bacteria 9316
111 Ga0157374_10004073 3300013296 Bacteria 12275
112 Ga0157374_11622594 3300013296 Bacteria 671
113 Ga0157378_10461045 3300013297 Bacteria 1263
114 Ga0157372_10000002 3300013307 Bacteria 687862
115 Ga0157372_10000086 3300013307 Bacteria 96247
116 Ga0157372_10278510 3300013307 Bacteria 1944
117 Ga0157372_10403635 3300013307 Bacteria 1592
118 Ga0157372_10579105 3300013307 Bacteria 1308
119 Ga0157372_11176099 3300013307 Bacteria 886
120 Ga0157375_10074210 3300013308 Bacteria 3422
121 Ga0163163_10211208 3300014325 Bacteria 1990
122 Ga0157380_13032532 3300014326 Bacteria 535
123 Ga0157377_10000920 3300014745 Bacteria 12288
124 Ga0157377_10001053 3300014745 Bacteria 11677
125 Ga0157379_10006609 3300014968 Bacteria 10004
126 Ga0157376_10000027 3300014969 Bacteria 204157
127 Ga0157376_10276006 3300014969 Bacteria 1581
128 Ga0207697_10044198 3300025315 Bacteria 1832
129 Ga0207688_10501377 3300025901 Bacteria 760
130 Ga0207647_10001245 3300025904 Bacteria 19575
131 Ga0207705_10000047 3300025909 Bacteria 175887
132 Ga0207654_10068504 3300025911 Bacteria 2099
133 Ga0207695_10000009 3300025913 Bacteria 1034276
134 Ga0207695_10000158 3300025913 Bacteria 201891
135 Ga0207695_10012231 3300025913 Bacteria 10306
136 Ga0207695_10740774 3300025913 Unclassified 863
137 Ga0207671_10000003 3300025914 Bacteria 1065461
138 Ga0207671_10000008 3300025914 Bacteria 798229
139 Ga0207671_10033531 3300025914 Bacteria 3818
140 Ga0207657_10002562 3300025919 Bacteria 19664
141 Ga0207657_10011048 3300025919 Bacteria 8976
142 Ga0207649_10240105 3300025920 Bacteria 1300
143 Ga0207694_10056409 3300025924 Bacteria 3051
144 Ga0207694_10088559 3300025924 Bacteria 2440
145 Ga0207694_10707111 3300025924 Bacteria 850
146 Ga0207687_10270848 3300025927 Bacteria 1357
147 Ga0207690_10002652 3300025932 Bacteria 10785
148 Ga0207706_10000073 3300025933 Bacteria 103803
149 Ga0207704_10001468 3300025938 Bacteria 10545
150 Ga0207661_10002445 3300025944 Bacteria 12778
151 Ga0207679_10000124 3300025945 Bacteria 63038
152 Ga0207679_10670768 3300025945 Unclassified 939
153 Ga0207667_10000756 3300025949 Bacteria 42002
154 Ga0207640_10019721 3300025981 Bacteria 3989
155 Ga0207702_10000015 3300026078 Bacteria 250830
156 Ga0207702_10000034 3300026078 Bacteria 164965
157 Ga0207702_10000057 3300026078 Bacteria 131118
158 Ga0207641_10826213 3300026088 Unclassified 917
159 Ga0207676_11742972 3300026095 Bacteria 621
160 Ga0207674_10000878 3300026116 Bacteria 39325
161 Ga0207674_10020195 3300026116 Bacteria 7203
162 Ga0207674_10310606 3300026116 Bacteria 1526
163 Ga0207674_10341793 3300026116 Bacteria 1447
164 Ga0207698_10000001 3300026142 Bacteria 625389
165 Ga0207698_10000048 3300026142 Bacteria 90201
166 Ga0207698_10014507 3300026142 Bacteria 5241
167 Ga0207698_10447660 3300026142 Bacteria 1246
168 Ga0207698_10974393 3300026142 Bacteria 858
169 Ga0209813_10000335 3300027866 Bacteria 12250
170 Ga0268264_10090306 3300028381 Unclassified 2640
171 Ga0316177_1089352 3300030731 Bacteria 1273
172 Ga0314311_1166584 3300030733 Bacteria 1017
173 Ga0316179_1064424 3300030734 Bacteria 12008
174 Ga0316180_1178386 3300030736 Bacteria 3765
175 Ga0316183_1028961 3300030742 Bacteria 1502
176 Ga0316183_1086663 3300030742 Bacteria 554
177 Ga0316183_1192095 3300030742 Bacteria 16108
178 Ga0316183_1206173 3300030742 Bacteria 2643
179 Ga0316181_1019399 3300030744 Bacteria 3114
180 Ga0316181_1182127 3300030744 Bacteria 1642
181 Ga0316182_1017501 3300030745 Bacteria 11122
182 Ga0316182_1175280 3300030745 Bacteria 2574
183 Ga0316182_1396058 3300030745 Bacteria 6284
184 Ga0307516_10000078 3300031730 Bacteria 106523
185 Ga0307516_10008182 3300031730 Bacteria 11877
186 Ga0307405_10349015 3300031731 Bacteria 1141
187 Ga0307405_11892504 3300031731 Bacteria 532
188 Ga0307406_10000001 3300031901 Bacteria 638191
189 Ga0307406_10000901 3300031901 Bacteria 16682
190 Ga0307411_11162481 3300032005 Bacteria 698
191 Ga0373959_0000052 3300034820 Bacteria 26566
192 Ga0373925_0514898 3300037068 Bacteria 983
193 Ga0395899_0039022 3300037312 Bacteria 3556
194 Ga0395900_0000001 3300037418 Bacteria 931146
195 Ga0395900_0825092 3300037418 Bacteria 854
196 Ga0395898_0000002 3300037466 Bacteria 931013
197 Ga0395901_0000006 3300038443 Bacteria 514112
198 Ga0395901_0036009 3300038443 Bacteria 5114
199 Ga0439447_043550 3300041407 Bacteria 1087
200 Ga0439461_0004322 3300041410 Bacteria 2370
201 Ga0439466_0037829 3300041411 Bacteria 1623
202 Ga0451793_0563460 3300041452 Unclassified 524
203 Ga0451802_0044704 3300041460 Bacteria 841
204 Ga0451807_2408538 3300041486 Bacteria 551
205 Ga0451833_1049327 3300041491 Bacteria 504
206 Ga0451851_1338469 3300041507 Bacteria 535
207 Ga0439431_0250334 3300041997 Bacteria 525
208 Ga0439437_040033 3300042000 Bacteria 606
209 Ga0439442_012396 3300042002 Bacteria 1743
210 Ga0439442_045479 3300042002 Bacteria 925
211 Ga0439445_0001581 3300042004 Bacteria 4962
212 Ga0439432_007573 3300042006 Bacteria 3842
213 Ga0439452_046383 3300042010 Bacteria 1009
214 Ga0439462_0067725 3300042015 Bacteria 968
215 Ga0450919_012280 3300042121 Bacteria 972
216 Ga0450906_035846 3300042145 Bacteria 875
217 Ga0439446_0000001 3300042156 Bacteria 275840
218 Ga0439446_0000974 3300042156 Bacteria 6228
219 Ga0439434_0002878 3300042435 Bacteria 5024
220 Ga0439434_0013541 3300042435 Bacteria 2422
221 Ga0439459_0210636 3300042438 Bacteria 534
222 Ga0439464_0000130 3300042439 Bacteria 11960
223 Ga0450918_000617 3300042531 Bacteria 7630
224 Ga0450918_027776 3300042531 Bacteria 995
225 Ga0466972_0031376 3300044658 Bacteria 2614
226 Ga0466965_0000206 3300044683 Bacteria 18416
227 Ga0466970_0097656 3300044765 Bacteria 1598
228 Ga0495638_0000551 3300046460 Bacteria 42775
229 Ga0495660_0000005 3300046810 Bacteria 574567
230 Ga0495672_0021461 3300047320 Bacteria 4212
231 Ga0495686_0005549 3300047472 Bacteria 9924
232 Ga0496100_0058590 3300048903 Unclassified 2528
233 Ga0496100_0564003 3300048903 Bacteria 882
234 Ga0496101_0488997 3300048904 Bacteria 972
235 Ga0496109_0631883 3300048912 Bacteria 1007
236 Ga0496110_0486132 3300048913 Bacteria 1125
237 Ga0496111_1082373 3300048914 Bacteria 572
238 Ga0496113_0025550 3300048916 Bacteria 4212
239 Ga0496115_0000405 3300048918 Bacteria 35545
240 Ga0501034_0009503 3300049571 Bacteria 10178
241 Ga0501034_0037263 3300049571 Bacteria 4923
242 Ga0501040_0297325 3300049576 Unclassified 1154
243 Ga0501043_0896718 3300049579 Bacteria 636
244 nmdc:mga03n38_936195_c1 3300050490 Unclassified 511
245 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
246 nmdc:mga00v17_137512_c1 3300050491 Bacteria 1565
247 nmdc:mga00v17_2126_c1 3300050491 Bacteria 10185
248 nmdc:mga00v17_724240_c1 3300050491 Bacteria 637
249 nmdc:mga00v17_929085_c1 3300050491 Bacteria 550
250 nmdc:mga0yw44_1173527_c1 3300050492 Bacteria 518
251 nmdc:mga0yw44_157232_c1 3300050492 Bacteria 1486
252 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
253 nmdc:mga0yw44_185349_c1 3300050492 Bacteria 1371
254 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
255 nmdc:mga0yw44_319236_c1 3300050492 Bacteria 1043
256 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
257 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
258 nmdc:mga0k408_3696_c1 3300050493 Bacteria 7332
259 nmdc:mga0k408_545276_c1 3300050493 Bacteria 686
260 nmdc:mga06z11_198_c1 3300050494 Bacteria 24266
261 nmdc:mga06z11_215659_c1 3300050494 Bacteria 1120
262 nmdc:mga04h51_251_c1 3300050495 Bacteria 14040
263 nmdc:mga07m45_10022_c1 3300050496 Bacteria 4932
264 nmdc:mga07m45_450985_c1 3300050496 Bacteria 746
265 nmdc:mga07m45_65156_c1 3300050496 Bacteria 2069
266 nmdc:mga0sz30_13016_c1 3300050516 Bacteria 3248
267 nmdc:mga0sz30_1978_c1 3300050516 Bacteria 1587
268 Ga0500643_003979 3300053087 Bacteria 6836
269 Ga0500583_0011114 3300053092 Bacteria 3378
270 Ga0500651_0000001 3300053093 Bacteria 529808
271 Ga0500641_0000001 3300053096 Bacteria 1115973
272 Ga0500650_0190289 3300053098 Bacteria 937
273 Ga0500555_000009 3300053103 Bacteria 263998
274 Ga0500556_0172673 3300053104 Bacteria 854
275 Ga0500569_000018 3300053109 Bacteria 42775
276 Ga0500593_017808 3300053117 Bacteria 3089
277 Ga0500594_0000018 3300053118 Bacteria 61549
278 Ga0500628_192827 3300053129 Unclassified 585
279 Ga0500652_000001 3300053131 Bacteria 946868
280 Ga0500655_004905 3300053133 Bacteria 2404
281 Ga0500588_0000557 3300053146 Bacteria 6064
282 Ga0500616_0000012 3300053153 Bacteria 681798
283 Ga0500616_0015635 3300053153 Bacteria 4334
284 Ga0500616_0025837 3300053153 Bacteria 3256
285 Ga0500649_179282 3300053722 Bacteria 718
286 Ga0500570_008150 3300053724 Bacteria 5773
287 Ga0500570_114608 3300053724 Bacteria 1081
288 Ga0500656_008295 3300053732 Bacteria 1099
289 Ga0500613_001285 3300053738 Bacteria 1712

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_1082373 Ga0496111_1082373_154_534 99
2 3300041452 Ga0451793_0563460 Ga0451793_0563460_108_461 101
3 3300053732 Ga0500656_008295 Ga0500656_008295_16_333 101
4 3300013102 Ga0157371_10050953 Ga0157371_100509534 103
5 3300013307 Ga0157372_10278510 Ga0157372_102785103 103
6 3300006038 Ga0075365_10000232 Ga0075365_1000023217 104
7 3300006048 Ga0075363_101015787 Ga0075363_1010157871 104
8 3300006051 Ga0075364_10002663 Ga0075364_100026637 104
9 3300050490 nmdc:mga03n38_936195_c1 nmdc:mga03n38_936195_c1_79_450 104
10 3300050491 nmdc:mga00v17_2126_c1 nmdc:mga00v17_2126_c1_6826_7197 104
11 3300050492 nmdc:mga0yw44_3_c1 nmdc:mga0yw44_3_c1_6826_7197 104
12 3300006237 Ga0097621_100000001 Ga0097621_100000001676 105
13 3300006358 Ga0068871_100000002 Ga0068871_100000002152 105
14 3300048918 Ga0496115_0000405 Ga0496115_0000405_23772_24203 105
15 3300049571 Ga0501034_0037263 Ga0501034_0037263_1170_1532 105
16 3300053133 Ga0500655_004905 Ga0500655_004905_516_929 105
17 3300005577 Ga0068857_100590162 Ga0068857_1005901621 106
18 3300026116 Ga0207674_10341793 Ga0207674_103417932 106
19 3300031731 Ga0307405_10349015 Ga0307405_103490152 106
20 3300006177 Ga0075362_10392282 Ga0075362_103922822 107
21 3300009093 Ga0105240_10000050 Ga0105240_10000050124 107
22 3300009545 Ga0105237_10061315 Ga0105237_100613153 107
23 3300014745 Ga0157377_10001053 Ga0157377_1000105312 107
24 3300014968 Ga0157379_10006609 Ga0157379_100066098 107
25 3300025913 Ga0207695_10000158 Ga0207695_10000158107 107
26 3300025914 Ga0207671_10033531 Ga0207671_100335313 107
27 3300026088 Ga0207641_10826213 Ga0207641_108262132 107
28 3300034820 Ga0373959_0000052 Ga0373959_0000052_12263_12667 107
29 3300038443 Ga0395901_0036009 Ga0395901_0036009_847_1236 107
30 3300047320 Ga0495672_0021461 Ga0495672_0021461_1616_1999 107
31 3300005564 Ga0070664_100093442 Ga0070664_1000934422 108
32 3300005616 Ga0068852_100064518 Ga0068852_1000645183 108
33 3300005843 Ga0068860_100111002 Ga0068860_1001110023 108
34 3300006038 Ga0075365_10069344 Ga0075365_100693444 108
35 3300006051 Ga0075364_10198129 Ga0075364_101981292 108
36 3300006353 Ga0075370_10254951 Ga0075370_102549512 108
37 3300009979 Ga0105032_100148 Ga0105032_10014810 108
38 3300009993 Ga0105028_100830 Ga0105028_1008302 108
39 3300013307 Ga0157372_10579105 Ga0157372_105791052 108
40 3300013307 Ga0157372_11176099 Ga0157372_111760992 108
41 3300025945 Ga0207679_10670768 Ga0207679_106707681 108
42 3300026142 Ga0207698_10014507 Ga0207698_100145074 108
43 3300028381 Ga0268264_10090306 Ga0268264_100903063 108
44 3300031730 Ga0307516_10008182 Ga0307516_100081826 108
45 3300044765 Ga0466970_0097656 Ga0466970_0097656_1172_1573 108
46 3300047472 Ga0495686_0005549 Ga0495686_0005549_4629_5045 108
47 3300049576 Ga0501040_0297325 Ga0501040_0297325_686_1138 108
48 3300053104 Ga0500556_0172673 Ga0500556_0172673_182_622 108
49 3300050491 nmdc:mga00v17_929085_c1 nmdc:mga00v17_929085_c1_97_462 109
50 3300013296 Ga0157374_11622594 Ga0157374_116225941 110
51 3300013307 Ga0157372_10000086 Ga0157372_1000008621 110
52 3300053092 Ga0500583_0011114 Ga0500583_0011114_1256_1597 110
53 3300053096 Ga0500641_0000001 Ga0500641_0000001_72774_73115 110
54 3300053098 Ga0500650_0190289 Ga0500650_0190289_428_769 110
55 3300053131 Ga0500652_000001 Ga0500652_000001_289358_289699 110
56 3300013102 Ga0157371_10523502 Ga0157371_105235021 111
57 3300013105 Ga0157369_10000413 Ga0157369_100004131 111
58 3300013105 Ga0157369_10013289 Ga0157369_1001328917 111
59 3300030731 Ga0316177_1089352 Ga0316177_10893522 111
60 3300041407 Ga0439447_043550 Ga0439447_043550_501_845 111
61 3300041410 Ga0439461_0004322 Ga0439461_0004322_1818_2162 111
62 3300041411 Ga0439466_0037829 Ga0439466_0037829_520_864 111
63 3300041997 Ga0439431_0250334 Ga0439431_0250334_114_458 111
64 3300042002 Ga0439442_012396 Ga0439442_012396_421_765 111
65 3300042010 Ga0439452_046383 Ga0439452_046383_157_501 111
66 3300042015 Ga0439462_0067725 Ga0439462_0067725_368_712 111
67 3300042121 Ga0450919_012280 Ga0450919_012280_313_657 111
68 3300042156 Ga0439446_0000001 Ga0439446_0000001_16977_17321 111
69 3300042156 Ga0439446_0000974 Ga0439446_0000974_1407_1751 111
70 3300042435 Ga0439434_0002878 Ga0439434_0002878_1230_1574 111
71 3300042435 Ga0439434_0013541 Ga0439434_0013541_1561_1905 111
72 3300046810 Ga0495660_0000005 Ga0495660_0000005_125551_125895 111
73 3300005293 Ga0065715_10099813 Ga0065715_100998136 112
74 3300006038 Ga0075365_10371109 Ga0075365_103711092 112
75 3300031901 Ga0307406_10000001 Ga0307406_10000001207 112
76 3300032005 Ga0307411_11162481 Ga0307411_111624811 112
77 3300050492 nmdc:mga0yw44_1173527_c1 nmdc:mga0yw44_1173527_c1_135_482 112
78 3300050492 nmdc:mga0yw44_319236_c1 nmdc:mga0yw44_319236_c1_79_426 112
79 2162886012 MBSR1b_contig_1699160 MBSR1b_0967.00001270 113
80 3300025913 Ga0207695_10740774 Ga0207695_107407742 113
81 3300046460 Ga0495638_0000551 Ga0495638_0000551_37180_37524 113
82 3300048903 Ga0496100_0564003 Ga0496100_0564003_341_778 113
83 3300048904 Ga0496101_0488997 Ga0496101_0488997_130_567 113
84 3300053109 Ga0500569_000018 Ga0500569_000018_37180_37524 113
85 3300053146 Ga0500588_0000557 Ga0500588_0000557_480_824 113
86 3300005339 Ga0070660_100000316 Ga0070660_10000031614 114
87 3300005577 Ga0068857_100021011 Ga0068857_1000210111 114
88 3300005578 Ga0068854_100026707 Ga0068854_1000267076 114
89 3300005616 Ga0068852_100000001 Ga0068852_100000001461 114
90 3300006038 Ga0075365_10000014 Ga0075365_1000001417 114
91 3300009093 Ga0105240_10000004 Ga0105240_10000004168 114
92 3300009545 Ga0105237_10000001 Ga0105237_10000001601 114
93 3300009545 Ga0105237_10000002 Ga0105237_10000002355 114
94 3300009551 Ga0105238_10062208 Ga0105238_100622086 114
95 3300013104 Ga0157370_10002357 Ga0157370_1000235714 114
96 3300013105 Ga0157369_10000151 Ga0157369_1000015177 114
97 3300013307 Ga0157372_10000002 Ga0157372_10000002146 114
98 3300014326 Ga0157380_13032532 Ga0157380_130325322 114
99 3300025913 Ga0207695_10000009 Ga0207695_10000009548 114
100 3300025914 Ga0207671_10000003 Ga0207671_10000003604 114
101 3300025914 Ga0207671_10000008 Ga0207671_10000008459 114
102 3300025919 Ga0207657_10002562 Ga0207657_1000256214 114
103 3300025924 Ga0207694_10056409 Ga0207694_100564094 114
104 3300025924 Ga0207694_10707111 Ga0207694_107071111 114
105 3300025981 Ga0207640_10019721 Ga0207640_100197212 114
106 3300026116 Ga0207674_10020195 Ga0207674_1002019511 114
107 3300026142 Ga0207698_10000001 Ga0207698_10000001412 114
108 3300030745 Ga0316182_1175280 Ga0316182_11752804 114
109 3300041491 Ga0451833_1049327 Ga0451833_1049327_99_446 114
110 3300042145 Ga0450906_035846 Ga0450906_035846_417_776 114
111 3300042531 Ga0450918_027776 Ga0450918_027776_573_932 114
112 3300048903 Ga0496100_0058590 Ga0496100_0058590_1335_1727 114
113 3300048912 Ga0496109_0631883 Ga0496109_0631883_199_624 114
114 3300048913 Ga0496110_0486132 Ga0496110_0486132_225_650 114
115 3300049571 Ga0501034_0009503 Ga0501034_0009503_1526_1885 114
116 3300050492 nmdc:mga0yw44_16_c1 nmdc:mga0yw44_16_c1_65983_66330 114
117 3300003323 rootH1_10030295 rootH1_100302957 115
118 3300014969 Ga0157376_10000027 Ga0157376_100000275 115
119 3300031730 Ga0307516_10000078 Ga0307516_1000007890 115
120 3300037418 Ga0395900_0825092 Ga0395900_0825092_434_808 115
121 3300041460 Ga0451802_0044704 Ga0451802_0044704_239_610 115
122 3300041486 Ga0451807_2408538 Ga0451807_2408538_156_527 115
123 2162886011 MRS1b_contig_542959 MRS1b_0860.00002650 116
124 3300001915 JGI24741J21665_1029691 JGI24741J21665_10296912 116
125 3300001979 JGI24740J21852_10004913 JGI24740J21852_100049137 116
126 3300001979 JGI24740J21852_10019351 JGI24740J21852_100193515 116
127 3300001989 JGI24739J22299_10005141 JGI24739J22299_100051417 116
128 3300001990 JGI24737J22298_10002203 JGI24737J22298_100022037 116
129 3300001991 JGI24743J22301_10000630 JGI24743J22301_100006304 116
130 3300002067 JGI24735J21928_10000149 JGI24735J21928_100001498 116
131 3300002075 JGI24738J21930_10001791 JGI24738J21930_100017917 116
132 3300002155 JGI24033J26618_1001309 JGI24033J26618_10013094 116
133 3300003316 rootH1_10002936 rootH1_1000293634 116
134 3300003316 rootH1_10154833 rootH1_101548331 116
135 3300003320 rootH2_10006847 rootH2_1000684721 116
136 3300003322 rootL2_10183129 rootL2_101831293 116
137 3300003323 rootH1_10196557 rootH1_101965572 116
138 3300005290 Ga0065712_10284678 Ga0065712_102846781 116
139 3300005327 Ga0070658_10000024 Ga0070658_10000024146 116
140 3300005329 Ga0070683_100010750 Ga0070683_1000107505 116
141 3300005329 Ga0070683_100724814 Ga0070683_1007248142 116
142 3300005334 Ga0068869_100155766 Ga0068869_1001557662 116
143 3300005339 Ga0070660_100045343 Ga0070660_1000453437 116
144 3300005339 Ga0070660_101454377 Ga0070660_1014543771 116
145 3300005344 Ga0070661_100056640 Ga0070661_1000566401 116
146 3300005345 Ga0070692_10438243 Ga0070692_104382432 116
147 3300005354 Ga0070675_100093937 Ga0070675_1000939373 116
148 3300005366 Ga0070659_100089113 Ga0070659_1000891131 116
149 3300005455 Ga0070663_100455377 Ga0070663_1004553772 116
150 3300005457 Ga0070662_100009029 Ga0070662_1000090297 116
151 3300005468 Ga0070707_101579984 Ga0070707_1015799841 116
152 3300005535 Ga0070684_100046576 Ga0070684_1000465765 116
153 3300005563 Ga0068855_100000663 Ga0068855_10000066344 116
154 3300005564 Ga0070664_100000123 Ga0070664_1000001231 116
155 3300005564 Ga0070664_100003334 Ga0070664_1000033342 116
156 3300005577 Ga0068857_100000441 Ga0068857_10000044116 116
157 3300005577 Ga0068857_100158594 Ga0068857_1001585941 116
158 3300005614 Ga0068856_100000027 Ga0068856_10000002713 116
159 3300005614 Ga0068856_100000200 Ga0068856_1000002005 116
160 3300005616 Ga0068852_100000155 Ga0068852_10000015555 116
161 3300005616 Ga0068852_100269563 Ga0068852_1002695632 116
162 3300005618 Ga0068864_101873381 Ga0068864_1018733811 116
163 3300005937 Ga0081455_10000001 Ga0081455_10000001318 116
164 3300006038 Ga0075365_10007875 Ga0075365_100078756 116
165 3300006038 Ga0075365_10185564 Ga0075365_101855642 116
166 3300006042 Ga0075368_10002082 Ga0075368_100020824 116
167 3300006048 Ga0075363_100018117 Ga0075363_1000181176 116
168 3300006051 Ga0075364_10002700 Ga0075364_1000270014 116
169 3300006051 Ga0075364_10133714 Ga0075364_101337141 116
170 3300006177 Ga0075362_10032747 Ga0075362_100327473 116
171 3300006178 Ga0075367_10008164 Ga0075367_100081644 116
172 3300006178 Ga0075367_10245941 Ga0075367_102459412 116
173 3300006186 Ga0075369_10000181 Ga0075369_1000018130 116
174 3300006195 Ga0075366_10010874 Ga0075366_100108747 116
175 3300006353 Ga0075370_10111592 Ga0075370_101115921 116
176 3300006844 Ga0075428_100001999 Ga0075428_10000199918 116
177 3300006881 Ga0068865_100000307 Ga0068865_10000030721 116
178 3300009093 Ga0105240_10001357 Ga0105240_1000135743 116
179 3300009098 Ga0105245_10287831 Ga0105245_102878312 116
180 3300009174 Ga0105241_10058310 Ga0105241_100583104 116
181 3300009174 Ga0105241_10082024 Ga0105241_100820245 116
182 3300009551 Ga0105238_10140584 Ga0105238_101405844 116
183 3300009979 Ga0105032_100001 Ga0105032_100001315 116
184 3300009979 Ga0105032_100020 Ga0105032_1000205 116
185 3300009984 Ga0105029_100086 Ga0105029_1000862 116
186 3300010375 Ga0105239_10001223 Ga0105239_1000122331 116
187 3300011119 Ga0105246_10052123 Ga0105246_100521232 116
188 3300011119 Ga0105246_10538441 Ga0105246_105384412 116
189 3300012475 Ga0157317_1024739 Ga0157317_10247392 116
190 3300012503 Ga0157313_1046517 Ga0157313_10465172 116
191 3300013100 Ga0157373_10043985 Ga0157373_100439855 116
192 3300013102 Ga0157371_10007527 Ga0157371_1000752711 116
193 3300013104 Ga0157370_10012318 Ga0157370_100123184 116
194 3300013104 Ga0157370_10290543 Ga0157370_102905432 116
195 3300013105 Ga0157369_10000029 Ga0157369_10000029222 116
196 3300013105 Ga0157369_10000567 Ga0157369_1000056751 116
197 3300013296 Ga0157374_10004073 Ga0157374_100040738 116
198 3300013297 Ga0157378_10461045 Ga0157378_104610452 116
199 3300013307 Ga0157372_10403635 Ga0157372_104036353 116
200 3300013308 Ga0157375_10074210 Ga0157375_100742102 116
201 3300014325 Ga0163163_10211208 Ga0163163_102112084 116
202 3300014745 Ga0157377_10000920 Ga0157377_1000092015 116
203 3300014969 Ga0157376_10276006 Ga0157376_102760063 116
204 3300025315 Ga0207697_10044198 Ga0207697_100441981 116
205 3300025901 Ga0207688_10501377 Ga0207688_105013772 116
206 3300025904 Ga0207647_10001245 Ga0207647_1000124519 116
207 3300025909 Ga0207705_10000047 Ga0207705_1000004761 116
208 3300025911 Ga0207654_10068504 Ga0207654_100685042 116
209 3300025913 Ga0207695_10012231 Ga0207695_100122312 116
210 3300025919 Ga0207657_10011048 Ga0207657_1001104810 116
211 3300025920 Ga0207649_10240105 Ga0207649_102401052 116
212 3300025924 Ga0207694_10088559 Ga0207694_100885594 116
213 3300025927 Ga0207687_10270848 Ga0207687_102708482 116
214 3300025932 Ga0207690_10002652 Ga0207690_100026527 116
215 3300025933 Ga0207706_10000073 Ga0207706_1000007353 116
216 3300025938 Ga0207704_10001468 Ga0207704_100014688 116
217 3300025944 Ga0207661_10002445 Ga0207661_1000244516 116
218 3300025945 Ga0207679_10000124 Ga0207679_1000012462 116
219 3300025949 Ga0207667_10000756 Ga0207667_1000075643 116
220 3300026078 Ga0207702_10000015 Ga0207702_10000015106 116
221 3300026078 Ga0207702_10000034 Ga0207702_10000034106 116
222 3300026078 Ga0207702_10000057 Ga0207702_1000005798 116
223 3300026095 Ga0207676_11742972 Ga0207676_117429721 116
224 3300026116 Ga0207674_10000878 Ga0207674_1000087816 116
225 3300026116 Ga0207674_10310606 Ga0207674_103106063 116
226 3300026142 Ga0207698_10000048 Ga0207698_1000004813 116
227 3300026142 Ga0207698_10447660 Ga0207698_104476601 116
228 3300026142 Ga0207698_10974393 Ga0207698_109743932 116
229 3300027866 Ga0209813_10000335 Ga0209813_1000033517 116
230 3300030733 Ga0314311_1166584 Ga0314311_11665842 116
231 3300030734 Ga0316179_1064424 Ga0316179_10644249 116
232 3300030736 Ga0316180_1178386 Ga0316180_11783862 116
233 3300030742 Ga0316183_1028961 Ga0316183_10289611 116
234 3300030742 Ga0316183_1086663 Ga0316183_10866631 116
235 3300030742 Ga0316183_1192095 Ga0316183_11920959 116
236 3300030742 Ga0316183_1206173 Ga0316183_12061732 116
237 3300030744 Ga0316181_1019399 Ga0316181_10193993 116
238 3300030744 Ga0316181_1182127 Ga0316181_11821272 116
239 3300030745 Ga0316182_1017501 Ga0316182_10175016 116
240 3300030745 Ga0316182_1396058 Ga0316182_13960589 116
241 3300031731 Ga0307405_11892504 Ga0307405_118925041 116
242 3300031901 Ga0307406_10000901 Ga0307406_1000090116 116
243 3300037068 Ga0373925_0514898 Ga0373925_0514898_528_893 116
244 3300037312 Ga0395899_0039022 Ga0395899_0039022_472_822 116
245 3300037418 Ga0395900_0000001 Ga0395900_0000001_260137_260487 116
246 3300037466 Ga0395898_0000002 Ga0395898_0000002_845519_845869 116
247 3300038443 Ga0395901_0000006 Ga0395901_0000006_491195_491545 116
248 3300041507 Ga0451851_1338469 Ga0451851_1338469_21_380 116
249 3300042000 Ga0439437_040033 Ga0439437_040033_10_360 116
250 3300042002 Ga0439442_045479 Ga0439442_045479_356_706 116
251 3300042004 Ga0439445_0001581 Ga0439445_0001581_570_920 116
252 3300042006 Ga0439432_007573 Ga0439432_007573_1622_1972 116
253 3300042438 Ga0439459_0210636 Ga0439459_0210636_141_491 116
254 3300042439 Ga0439464_0000130 Ga0439464_0000130_10612_10962 116
255 3300042531 Ga0450918_000617 Ga0450918_000617_893_1279 116
256 3300044658 Ga0466972_0031376 Ga0466972_0031376_1083_1433 116
257 3300044683 Ga0466965_0000206 Ga0466965_0000206_5006_5356 116
258 3300048916 Ga0496113_0025550 Ga0496113_0025550_478_828 116
259 3300049579 Ga0501043_0896718 Ga0501043_0896718_217_579 116
260 3300050491 nmdc:mga00v17_120_c1 nmdc:mga00v17_120_c1_25696_26061 116
261 3300050491 nmdc:mga00v17_137512_c1 nmdc:mga00v17_137512_c1_171_521 116
262 3300050491 nmdc:mga00v17_724240_c1 nmdc:mga00v17_724240_c1_24_389 116
263 3300050492 nmdc:mga0yw44_157232_c1 nmdc:mga0yw44_157232_c1_720_1082 116
264 3300050492 nmdc:mga0yw44_185349_c1 nmdc:mga0yw44_185349_c1_493_843 116
265 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_181842_182213 116
266 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_321440_321805 116
267 3300050493 nmdc:mga0k408_3696_c1 nmdc:mga0k408_3696_c1_5621_5971 116
268 3300050493 nmdc:mga0k408_545276_c1 nmdc:mga0k408_545276_c1_211_576 116
269 3300050494 nmdc:mga06z11_198_c1 nmdc:mga06z11_198_c1_14183_14548 116
270 3300050494 nmdc:mga06z11_215659_c1 nmdc:mga06z11_215659_c1_177_527 116
271 3300050495 nmdc:mga04h51_251_c1 nmdc:mga04h51_251_c1_12209_12574 116
272 3300050496 nmdc:mga07m45_10022_c1 nmdc:mga07m45_10022_c1_2695_3045 116
273 3300050496 nmdc:mga07m45_450985_c1 nmdc:mga07m45_450985_c1_225_584 116
274 3300050496 nmdc:mga07m45_65156_c1 nmdc:mga07m45_65156_c1_1183_1548 116
275 3300050516 nmdc:mga0sz30_13016_c1 nmdc:mga0sz30_13016_c1_59_409 116
276 3300050516 nmdc:mga0sz30_1978_c1 nmdc:mga0sz30_1978_c1_654_1019 116
277 3300053087 Ga0500643_003979 Ga0500643_003979_4673_5023 116
278 3300053093 Ga0500651_0000001 Ga0500651_0000001_340148_340498 116
279 3300053103 Ga0500555_000009 Ga0500555_000009_257617_257979 116
280 3300053117 Ga0500593_017808 Ga0500593_017808_184_546 116
281 3300053118 Ga0500594_0000018 Ga0500594_0000018_7066_7416 116
282 3300053129 Ga0500628_192827 Ga0500628_192827_169_531 116
283 3300053153 Ga0500616_0000012 Ga0500616_0000012_397157_397516 116
284 3300053153 Ga0500616_0015635 Ga0500616_0015635_1626_1988 116
285 3300053153 Ga0500616_0025837 Ga0500616_0025837_1769_2134 116
286 3300053722 Ga0500649_179282 Ga0500649_179282_258_617 116
287 3300053724 Ga0500570_008150 Ga0500570_008150_3569_3937 116
288 3300053724 Ga0500570_114608 Ga0500570_114608_642_1001 116
289 3300053738 Ga0500613_001285 Ga0500613_001285_818_1180 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00886

Ribosomal_S16

Ribosomal protein S16

8

65

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mmm-assembly1.cif.gz_p structure of the 70s chloroplast ribosome 0.9443 1 77
5zeb-assembly1.cif.gz_p m. smegmatis p/p state 70s ribosome structure 0.9343 1 76
6eri-assembly1.cif.gz_BP structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.9335 1 77
8ced-assembly1.cif.gz_P rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.9324 1 77
7p7u-assembly1.cif.gz_q e. faecalis 70s ribosome with p-trna, state iv 0.9277 1 77
ID Description Score Start End Superfamily
af_P56806_1_79_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.959 1 77 3.30.1320.10
af_Q2FZ45_1_91_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.923 2 77 3.30.1320.10
af_P56806_1_79_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.9128 1 77 3.30.1320.10
af_A0A0R0FN90_1_75_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.9031 16 77 3.30.1320.10
4kdgP00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8983 1 77 3.30.1320.10
ID Description Score Start End GO Terms
AF-A0A7C4CBZ1-F1-model_v4 Small ribosomal subunit protein bS16 0.9639 1 75 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-G0WVK4-F1-model_v4 Small ribosomal subunit protein bS16c 0.9626 1 77 GO:0003735
GO:0005739
GO:0009507
GO:0015935
GO:0032543
AF-A0A3Q8UGP8-F1-model_v4 Small ribosomal subunit protein bS16c 0.9625 1 77 GO:0003735
GO:0005739
GO:0009507
GO:0015935
GO:0032543
AF-A0A7G8JS17-F1-model_v4 Small ribosomal subunit protein bS16c 0.9612 1 77 GO:0003735
GO:0005739
GO:0009507
GO:0015935
GO:0032543
AF-Q0ZJ38-F1-model_v4 Small ribosomal subunit protein bS16c (30S ribosomal protein S16, chloroplastic) 0.9609 1 77 GO:0003735
GO:0006412
GO:0009507
GO:0015935

Feature Viewer

pLDDT pTM Quality
80.08 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map