F388789

General Info

Members Datasets Scaffolds Average Seq Length
288 147 576 374

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0140288|Ga0495652_0140288_560_1828
Length 412
Sequence MTRIAATVIVCEMNRSGASPRFHRALVRSVSMSRPAAAESAMRPRRRPRRLRFWIPLFLLVILSPAIYSWTRMAVQPSSLPLGVRTVEWMRQNRMNWLVDSAEHVYYTWKTPAKGGPQLKTLPTVGLHTKVPWPPRIRPVFAHPLRGEGIWKPSGPPVAGGPPVLVTTFRTERDYPRIVAYVAWFDHTRTATAYYPGRYEPPSATVRGPMQVPFGQRWRLLATFNSGFIYSDGLNGDALNGHVNEPLKDGLATLLAYRNGGVDIVDWHGAANPGPGIAFARQSLPLIVDHGRLSPALDNSTKWGFTLGNAVRVWRTGAGIDRHGNLIYAAADYQTVTSLAEILKRAGAVRAMELDINPEWPTLITYRHRHGLLPTRVVPNYQQPPTRYLVPDDRDFFAVYRRLPGPVTVPLR

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 10.76
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 10.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0140288 3300046529 Bacteria 1901
2 Ga0070661_100033433 3300005344 Unclassified 3724
3 Ga0070709_10010071 3300005434 Bacteria 5225
4 Ga0070714_100052251 3300005435 Bacteria 3485
5 Ga0070714_100231179 3300005435 Unclassified 1703
6 Ga0070714_100278834 3300005435 Unclassified 1552
7 Ga0070713_100043595 3300005436 Bacteria 3668
8 Ga0070710_10010580 3300005437 Bacteria 4534
9 Ga0070710_10055808 3300005437 Bacteria 2234
10 Ga0070711_100013680 3300005439 Bacteria 5099
11 Ga0070711_100161471 3300005439 Bacteria 1699
12 Ga0070711_100264219 3300005439 Bacteria 1355
13 Ga0070678_100045782 3300005456 Bacteria 3132
14 Ga0070681_10043716 3300005458 Bacteria 4485
15 Ga0068853_100265650 3300005539 Unclassified 1579
16 Ga0070686_100052630 3300005544 Bacteria 2597
17 Ga0070693_100136610 3300005547 Bacteria 1539
18 Ga0068855_100169475 3300005563 Unclassified 2473
19 Ga0068856_100070496 3300005614 Unclassified 3458
20 Ga0068852_100130176 3300005616 Unclassified 2316
21 Ga0068866_10006061 3300005718 Bacteria 5032
22 Ga0068858_100118217 3300005842 Bacteria 2478
23 Ga0070717_10004232 3300006028 Bacteria 10346
24 Ga0070717_10010244 3300006028 Bacteria 7064
25 Ga0070717_10027617 3300006028 Bacteria 4536
26 Ga0070717_10043077 3300006028 Bacteria 3683
27 Ga0070717_10256107 3300006028 Unclassified 1547
28 Ga0070715_10000283 3300006163 Bacteria 12412
29 Ga0070712_100004705 3300006175 Bacteria 8439
30 Ga0070712_100055088 3300006175 Unclassified 2783
31 Ga0070712_100072715 3300006175 Bacteria 2464
32 Ga0070712_100141480 3300006175 Bacteria 1837
33 Ga0075435_100014811 3300007076 Bacteria 5845
34 Ga0105240_10409679 3300009093 Bacteria 1525
35 Ga0105245_10067372 3300009098 Bacteria 3242
36 Ga0105243_10232810 3300009148 Bacteria 1635
37 Ga0105242_10045076 3300009176 Bacteria 3573
38 Ga0105242_10172463 3300009176 Bacteria 1902
39 Ga0105239_10038097 3300010375 Bacteria 5268
40 Ga0105239_10038630 3300010375 Bacteria 5232
41 Ga0105239_10360063 3300010375 Bacteria 1643
42 Ga0157371_10132351 3300013102 Unclassified 1775
43 Ga0157370_10068320 3300013104 Unclassified 3358
44 Ga0157369_10118692 3300013105 Unclassified 2807
45 Ga0157374_10052858 3300013296 Bacteria 3786
46 Ga0157372_10084506 3300013307 Unclassified 3598
47 Ga0206353_10492122 3300020082 Bacteria 2370
48 Ga0213875_10001641 3300021388 Bacteria 14126
49 Ga0207692_10006944 3300025898 Bacteria 4616
50 Ga0207692_10109913 3300025898 Bacteria 1527
51 Ga0207692_10121800 3300025898 Bacteria 1462
52 Ga0207685_10003657 3300025905 Unclassified 3775
53 Ga0207699_10050488 3300025906 Bacteria 2453
54 Ga0207693_10007796 3300025915 Bacteria 8787
55 Ga0207693_10013109 3300025915 Bacteria 6688
56 Ga0207693_10032598 3300025915 Bacteria 4111
57 Ga0207693_10253479 3300025915 Bacteria 1381
58 Ga0207663_10016960 3300025916 Bacteria 4049
59 Ga0207663_10030658 3300025916 Bacteria 3174
60 Ga0207663_10150524 3300025916 Bacteria 1632
61 Ga0207652_10058680 3300025921 Unclassified 3316
62 Ga0207646_10015797 3300025922 Bacteria 7109
63 Ga0207700_10023438 3300025928 Bacteria 4255
64 Ga0207664_10024994 3300025929 Bacteria 4493
65 Ga0207664_10049409 3300025929 Bacteria 3311
66 Ga0207665_10007146 3300025939 Bacteria 7390
67 Ga0207665_10080108 3300025939 Bacteria 2246
68 Ga0207661_10049997 3300025944 Bacteria 3330
69 Ga0207703_10057456 3300026035 Bacteria 3173
70 Ga0207702_10004189 3300026078 Bacteria 12895
71 Ga0207702_10136777 3300026078 Bacteria 2212
72 Ga0207683_10163621 3300026121 Bacteria 2013
73 Ga0268266_10072452 3300028379 Bacteria 2988
74 Ga0265319_1001750 3300028563 Bacteria 12498
75 Ga0265319_1011426 3300028563 Bacteria 3637
76 Ga0265318_10007351 3300028577 Bacteria 4985
77 Ga0265336_10008781 3300028666 Unclassified 3523
78 Ga0265338_10035156 3300028800 Bacteria 4823
79 Ga0265324_10009357 3300029957 Bacteria 3830
80 Ga0265320_10018457 3300031240 Unclassified 3838
81 Ga0265340_10007986 3300031247 Bacteria 5733
82 Ga0265327_10004773 3300031251 Bacteria 11799
83 Ga0265327_10070962 3300031251 Bacteria 1744
84 Ga0265316_10067983 3300031344 Bacteria 2754
85 Ga0265313_10008218 3300031595 Bacteria 6970
86 Ga0307508_10018466 3300031616 Bacteria 6337
87 Ga0265314_10026523 3300031711 Bacteria 4352
88 Ga0373945_0030068 3300035116 Bacteria 1912
89 Ga0373956_0072545 3300035119 Bacteria 1572
90 Ga0373943_0001435 3300035170 Bacteria 10764
91 Ga0373946_0004637 3300035171 Bacteria 4932
92 Ga0373931_0108863 3300035691 Bacteria 1569
93 Ga0373935_0060223 3300035692 Bacteria 2428
94 Ga0373947_0006332 3300035725 Bacteria 6877
95 Ga0373947_0008574 3300035725 Bacteria 5887
96 Ga0373937_0017359 3300036401 Bacteria 6410
97 Ga0373925_0004852 3300037068 Bacteria 10123
98 Ga0373925_0032309 3300037068 Bacteria 3852
99 Ga0436364_0091298 3300037853 Bacteria 6283
100 Ga0436365_0511563 3300039437 Bacteria 2255
101 Ga0466969_0006808 3300044656 Bacteria 6081
102 Ga0466969_0033527 3300044656 Bacteria 2607
103 Ga0466965_0026315 3300044683 Bacteria 2820
104 Ga0466965_0060174 3300044683 Bacteria 1897
105 Ga0466966_0009480 3300044684 Bacteria 6447
106 Ga0466961_0021029 3300044693 Bacteria 4199
107 Ga0466961_0060025 3300044693 Bacteria 2418
108 Ga0466961_0212388 3300044693 Unclassified 1194
109 Ga0466963_0000778 3300044694 Bacteria 15830
110 Ga0466963_0004810 3300044694 Bacteria 7871
111 Ga0466963_0010811 3300044694 Bacteria 5540
112 Ga0466963_0034342 3300044694 Bacteria 3299
113 Ga0466963_0052496 3300044694 Bacteria 2705
114 Ga0466964_0001903 3300044706 Bacteria 7295
115 Ga0466964_0011233 3300044706 Bacteria 3382
116 Ga0466964_0020399 3300044706 Bacteria 2552
117 Ga0466971_0003178 3300044719 Bacteria 7008
118 Ga0466971_0011764 3300044719 Bacteria 3833
119 Ga0466968_0000261 3300044735 Bacteria 16807
120 Ga0466968_0007563 3300044735 Bacteria 4135
121 Ga0466968_0040499 3300044735 Unclassified 1964
122 Ga0466968_0092375 3300044735 Bacteria 1343
123 Ga0466970_0035596 3300044765 Bacteria 2637
124 Ga0466957_0010870 3300044842 Bacteria 5234
125 Ga0466957_0021797 3300044842 Unclassified 3776
126 Ga0466957_0043524 3300044842 Bacteria 2719
127 Ga0466957_0180126 3300044842 Bacteria 1380
128 Ga0466959_0004399 3300045049 Bacteria 9430
129 Ga0466959_0043132 3300045049 Bacteria 3327
130 Ga0466959_0045825 3300045049 Bacteria 3219
131 Ga0466958_0002225 3300045836 Bacteria 9664
132 Ga0466958_0012804 3300045836 Bacteria 4759
133 Ga0466958_0195329 3300045836 Unclassified 1287
134 Ga0466967_0011273 3300045976 Bacteria 6757
135 Ga0466967_0030166 3300045976 Bacteria 4548
136 Ga0466967_0044047 3300045976 Bacteria 3868
137 Ga0466967_0060034 3300045976 Bacteria 3368
138 Ga0466967_0078016 3300045976 Bacteria 2983
139 Ga0466967_0099123 3300045976 Bacteria 2661
140 Ga0466967_0112949 3300045976 Bacteria 2498
141 Ga0466967_0230134 3300045976 Bacteria 1765
142 Ga0466967_0356451 3300045976 Unclassified 1417
143 Ga0495592_0001078 3300046454 Bacteria 18904
144 Ga0495592_0002824 3300046454 Bacteria 12317
145 Ga0495629_0001824 3300046459 Bacteria 16672
146 Ga0495629_0038825 3300046459 Bacteria 3353
147 Ga0495629_0144800 3300046459 Bacteria 1653
148 Ga0495641_0005841 3300046461 Bacteria 8149
149 Ga0495641_0018879 3300046461 Bacteria 3545
150 Ga0495641_0039954 3300046461 Bacteria 2184
151 Ga0495651_0000621 3300046462 Bacteria 27474
152 Ga0495651_0024396 3300046462 Bacteria 4705
153 Ga0495653_0001779 3300046463 Bacteria 16985
154 Ga0495653_0019699 3300046463 Bacteria 5472
155 Ga0495653_0089743 3300046463 Bacteria 2251
156 Ga0495582_0022609 3300046473 Bacteria 3441
157 Ga0495582_0040205 3300046473 Unclassified 2575
158 Ga0495582_0126678 3300046473 Bacteria 1441
159 Ga0495639_0001069 3300046475 Bacteria 12345
160 Ga0495639_0095074 3300046475 Bacteria 1402
161 Ga0495639_0107128 3300046475 Bacteria 1324
162 Ga0495662_0014221 3300046476 Bacteria 3872
163 Ga0495664_0002315 3300046477 Bacteria 10207
164 Ga0495664_0022823 3300046477 Bacteria 3630
165 Ga0495664_0043832 3300046477 Bacteria 2651
166 Ga0495664_0112837 3300046477 Bacteria 1641
167 Ga0495608_0000982 3300046511 Bacteria 20136
168 Ga0495608_0090819 3300046511 Bacteria 1975
169 Ga0495608_0094927 3300046511 Unclassified 1927
170 Ga0495618_0000514 3300046514 Bacteria 27432
171 Ga0495618_0002545 3300046514 Bacteria 11675
172 Ga0495618_0022725 3300046514 Archaea 3874
173 Ga0495618_0023762 3300046514 Bacteria 3793
174 Ga0495628_0000209 3300046516 Bacteria 51173
175 Ga0495628_0228707 3300046516 Bacteria 1395
176 Ga0495630_0018450 3300046517 Bacteria 5125
177 Ga0495630_0140032 3300046517 Bacteria 1839
178 Ga0495666_0001005 3300046526 Bacteria 13355
179 Ga0495652_0011469 3300046529 Bacteria 8016
180 Ga0495652_0029211 3300046529 Bacteria 4844
181 Ga0495665_0001296 3300046531 Bacteria 13332
182 Ga0495665_0047297 3300046531 Bacteria 2282
183 Ga0495665_0069016 3300046531 Bacteria 1863
184 Ga0495640_0030844 3300046533 Bacteria 3833
185 Ga0495640_0048600 3300046533 Bacteria 2930
186 Ga0495640_0133369 3300046533 Bacteria 1606
187 Ga0495640_0189245 3300046533 Bacteria 1309
188 Ga0495586_0001110 3300046535 Bacteria 15212
189 Ga0495586_0013041 3300046535 Bacteria 4404
190 Ga0495586_0015961 3300046535 Bacteria 3996
191 Ga0495587_0012255 3300046536 Bacteria 5408
192 Ga0495587_0028422 3300046536 Bacteria 3400
193 Ga0495645_0000126 3300046543 Bacteria 51697
194 Ga0495645_0017775 3300046543 Bacteria 5099
195 Ga0495645_0084826 3300046543 Bacteria 2268
196 Ga0495645_0086307 3300046543 Bacteria 2246
197 Ga0495667_0066755 3300046559 Bacteria 2351
198 Ga0495634_0009814 3300046642 Bacteria 7043
199 Ga0495634_0039144 3300046642 Bacteria 3230
200 Ga0495634_0057382 3300046642 Archaea 2599
201 Ga0495634_0156509 3300046642 Bacteria 1438
202 Ga0495635_0000250 3300046663 Bacteria 34198
203 Ga0495635_0030895 3300046663 Bacteria 3720
204 Ga0495635_0106694 3300046663 Bacteria 1913
205 Ga0495657_0216346 3300046675 Bacteria 1163
206 Ga0495599_0000130 3300046678 Bacteria 48631
207 Ga0495623_0002437 3300046679 Bacteria 12335
208 Ga0495623_0068309 3300046679 Bacteria 2217
209 Ga0495646_0002171 3300046680 Bacteria 11953
210 Ga0495647_0001765 3300046681 Bacteria 6703
211 Ga0495647_0018798 3300046681 Bacteria 2465
212 Ga0495658_0012047 3300046683 Bacteria 4367
213 Ga0495658_0028294 3300046683 Unclassified 3024
214 Ga0495658_0061976 3300046683 Unclassified 2149
215 Ga0495658_0093431 3300046683 Bacteria 1785
216 Ga0495613_0011866 3300046689 Bacteria 6474
217 Ga0495613_0013062 3300046689 Bacteria 6171
218 Ga0495624_0000914 3300046690 Bacteria 23364
219 Ga0495600_0060125 3300046809 Bacteria 2481
220 Ga0495581_0003321 3300047315 Bacteria 9239
221 Ga0495581_0152182 3300047315 Bacteria 1351
222 Ga0495604_0001502 3300047317 Bacteria 19221
223 Ga0495604_0123149 3300047317 Bacteria 1874
224 Ga0495674_0010703 3300047319 Bacteria 8678
225 Ga0495674_0039646 3300047319 Bacteria 4220
226 Ga0495674_0121101 3300047319 Bacteria 2210
227 Ga0495676_0000792 3300047321 Bacteria 26471
228 Ga0495676_0016960 3300047321 Bacteria 6449
229 Ga0495680_0038777 3300047322 Bacteria 3804
230 Ga0495680_0058772 3300047322 Bacteria 2970
231 Ga0495675_0003728 3300047444 Bacteria 9213
232 Ga0495684_0008241 3300047471 Bacteria 8067
233 Ga0495684_0059535 3300047471 Bacteria 2908
234 Ga0495684_0116055 3300047471 Bacteria 2018
235 Ga0495593_0002583 3300047673 Bacteria 10880
236 Ga0495602_0000147 3300048088 Bacteria 65372
237 Ga0495602_0019238 3300048088 Bacteria 6788
238 Ga0495614_0000710 3300048089 Bacteria 14037
239 Ga0496100_0026959 3300048903 Bacteria 3528
240 Ga0496100_0124979 3300048903 Bacteria 1804
241 Ga0496101_0075974 3300048904 Bacteria 2474
242 Ga0496102_0007061 3300048905 Bacteria 9585
243 Ga0496102_0009932 3300048905 Bacteria 8187
244 Ga0496102_0080627 3300048905 Bacteria 2998
245 Ga0496102_0104290 3300048905 Bacteria 2637
246 Ga0496104_0007464 3300048907 Bacteria 9664
247 Ga0496105_0096954 3300048908 Unclassified 2435
248 Ga0496106_0008121 3300048909 Bacteria 7753
249 Ga0496106_0022433 3300048909 Bacteria 4689
250 Ga0496107_0015639 3300048910 Bacteria 5319
251 Ga0496107_0017980 3300048910 Bacteria 4974
252 Ga0496107_0062141 3300048910 Unclassified 2705
253 Ga0496107_0286778 3300048910 Unclassified 1225
254 Ga0496108_0008034 3300048911 Bacteria 8566
255 Ga0496108_0052868 3300048911 Bacteria 3405
256 Ga0496109_0015349 3300048912 Bacteria 6673
257 Ga0496109_0058608 3300048912 Unclassified 3517
258 Ga0496109_0287430 3300048912 Bacteria 1550
259 Ga0496110_0029080 3300048913 Bacteria 4752
260 Ga0496111_0020936 3300048914 Bacteria 4560
261 Ga0496111_0185449 3300048914 Bacteria 1547
262 Ga0496112_0216637 3300048915 Bacteria 1871
263 Ga0496112_0397709 3300048915 Bacteria 1318
264 Ga0496114_0012718 3300048917 Bacteria 6743
265 Ga0496114_0038442 3300048917 Bacteria 3960
266 Ga0496114_0057967 3300048917 Bacteria 3233
267 Ga0496114_0088254 3300048917 Bacteria 2631
268 Ga0496115_0001270 3300048918 Bacteria 18067
269 Ga0496115_0011543 3300048918 Bacteria 6622
270 Ga0501067_0021459 3300049583 Bacteria 3574
271 Ga0495601_0000275 3300053077 Bacteria 27636
272 Ga0495601_0013445 3300053077 Bacteria 4924
273 Ga0495601_0016603 3300053077 Bacteria 4463
274 Ga0495601_0049347 3300053077 Bacteria 2653
275 Ga0495601_0129050 3300053077 Bacteria 1646
276 Ga0495601_0135331 3300053077 Bacteria 1606
277 Ga0495612_0013896 3300053078 Bacteria 3244
278 Ga0495612_0025842 3300053078 Bacteria 2359
279 Ga0495612_0049138 3300053078 Bacteria 1730
280 Ga0495612_0069925 3300053078 Bacteria 1462
281 Ga0495595_0005712 3300053084 Bacteria 5039
282 Ga0495619_0008330 3300053085 Bacteria 6555
283 Ga0495619_0024214 3300053085 Bacteria 3893
284 Ga0495619_0036393 3300053085 Bacteria 3205
285 Ga0495619_0048504 3300053085 Bacteria 2798
286 Ga0500566_0051477 3300053094 Bacteria 2355
287 Ga0500630_049167 3300053159 Bacteria 2041
288 Ga0466962_0009858 3300061719 Bacteria 4582
289 Ga0495652_0140288
290 Ga0070661_100033433
291 Ga0070709_10010071
292 Ga0070714_100052251
293 Ga0070714_100231179
294 Ga0070714_100278834
295 Ga0070713_100043595
296 Ga0070710_10010580
297 Ga0070710_10055808
298 Ga0070711_100013680
299 Ga0070711_100161471
300 Ga0070711_100264219
301 Ga0070678_100045782
302 Ga0070681_10043716
303 Ga0068853_100265650
304 Ga0070686_100052630
305 Ga0070693_100136610
306 Ga0068855_100169475
307 Ga0068856_100070496
308 Ga0068852_100130176
309 Ga0068866_10006061
310 Ga0068858_100118217
311 Ga0070717_10004232
312 Ga0070717_10010244
313 Ga0070717_10027617
314 Ga0070717_10043077
315 Ga0070717_10256107
316 Ga0070715_10000283
317 Ga0070712_100004705
318 Ga0070712_100055088
319 Ga0070712_100072715
320 Ga0070712_100141480
321 Ga0075435_100014811
322 Ga0105240_10409679
323 Ga0105245_10067372
324 Ga0105243_10232810
325 Ga0105242_10045076
326 Ga0105242_10172463
327 Ga0105239_10038097
328 Ga0105239_10038630
329 Ga0105239_10360063
330 Ga0157371_10132351
331 Ga0157370_10068320
332 Ga0157369_10118692
333 Ga0157374_10052858
334 Ga0157372_10084506
335 Ga0206353_10492122
336 Ga0213875_10001641
337 Ga0207692_10006944
338 Ga0207692_10109913
339 Ga0207692_10121800
340 Ga0207685_10003657
341 Ga0207699_10050488
342 Ga0207693_10007796
343 Ga0207693_10013109
344 Ga0207693_10032598
345 Ga0207693_10253479
346 Ga0207663_10016960
347 Ga0207663_10030658
348 Ga0207663_10150524
349 Ga0207652_10058680
350 Ga0207646_10015797
351 Ga0207700_10023438
352 Ga0207664_10024994
353 Ga0207664_10049409
354 Ga0207665_10007146
355 Ga0207665_10080108
356 Ga0207661_10049997
357 Ga0207703_10057456
358 Ga0207702_10004189
359 Ga0207702_10136777
360 Ga0207683_10163621
361 Ga0268266_10072452
362 Ga0265319_1001750
363 Ga0265319_1011426
364 Ga0265318_10007351
365 Ga0265336_10008781
366 Ga0265338_10035156
367 Ga0265324_10009357
368 Ga0265320_10018457
369 Ga0265340_10007986
370 Ga0265327_10004773
371 Ga0265327_10070962
372 Ga0265316_10067983
373 Ga0265313_10008218
374 Ga0307508_10018466
375 Ga0265314_10026523
376 Ga0373945_0030068
377 Ga0373956_0072545
378 Ga0373943_0001435
379 Ga0373946_0004637
380 Ga0373931_0108863
381 Ga0373935_0060223
382 Ga0373947_0006332
383 Ga0373947_0008574
384 Ga0373937_0017359
385 Ga0373925_0004852
386 Ga0373925_0032309
387 Ga0436364_0091298
388 Ga0436365_0511563
389 Ga0466969_0006808
390 Ga0466969_0033527
391 Ga0466965_0026315
392 Ga0466965_0060174
393 Ga0466966_0009480
394 Ga0466961_0021029
395 Ga0466961_0060025
396 Ga0466961_0212388
397 Ga0466963_0000778
398 Ga0466963_0004810
399 Ga0466963_0010811
400 Ga0466963_0034342
401 Ga0466963_0052496
402 Ga0466964_0001903
403 Ga0466964_0011233
404 Ga0466964_0020399
405 Ga0466971_0003178
406 Ga0466971_0011764
407 Ga0466968_0000261
408 Ga0466968_0007563
409 Ga0466968_0040499
410 Ga0466968_0092375
411 Ga0466970_0035596
412 Ga0466957_0010870
413 Ga0466957_0021797
414 Ga0466957_0043524
415 Ga0466957_0180126
416 Ga0466959_0004399
417 Ga0466959_0043132
418 Ga0466959_0045825
419 Ga0466958_0002225
420 Ga0466958_0012804
421 Ga0466958_0195329
422 Ga0466967_0011273
423 Ga0466967_0030166
424 Ga0466967_0044047
425 Ga0466967_0060034
426 Ga0466967_0078016
427 Ga0466967_0099123
428 Ga0466967_0112949
429 Ga0466967_0230134
430 Ga0466967_0356451
431 Ga0495592_0001078
432 Ga0495592_0002824
433 Ga0495629_0001824
434 Ga0495629_0038825
435 Ga0495629_0144800
436 Ga0495641_0005841
437 Ga0495641_0018879
438 Ga0495641_0039954
439 Ga0495651_0000621
440 Ga0495651_0024396
441 Ga0495653_0001779
442 Ga0495653_0019699
443 Ga0495653_0089743
444 Ga0495582_0022609
445 Ga0495582_0040205
446 Ga0495582_0126678
447 Ga0495639_0001069
448 Ga0495639_0095074
449 Ga0495639_0107128
450 Ga0495662_0014221
451 Ga0495664_0002315
452 Ga0495664_0022823
453 Ga0495664_0043832
454 Ga0495664_0112837
455 Ga0495608_0000982
456 Ga0495608_0090819
457 Ga0495608_0094927
458 Ga0495618_0000514
459 Ga0495618_0002545
460 Ga0495618_0022725
461 Ga0495618_0023762
462 Ga0495628_0000209
463 Ga0495628_0228707
464 Ga0495630_0018450
465 Ga0495630_0140032
466 Ga0495666_0001005
467 Ga0495652_0011469
468 Ga0495652_0029211
469 Ga0495665_0001296
470 Ga0495665_0047297
471 Ga0495665_0069016
472 Ga0495640_0030844
473 Ga0495640_0048600
474 Ga0495640_0133369
475 Ga0495640_0189245
476 Ga0495586_0001110
477 Ga0495586_0013041
478 Ga0495586_0015961
479 Ga0495587_0012255
480 Ga0495587_0028422
481 Ga0495645_0000126
482 Ga0495645_0017775
483 Ga0495645_0084826
484 Ga0495645_0086307
485 Ga0495667_0066755
486 Ga0495634_0009814
487 Ga0495634_0039144
488 Ga0495634_0057382
489 Ga0495634_0156509
490 Ga0495635_0000250
491 Ga0495635_0030895
492 Ga0495635_0106694
493 Ga0495657_0216346
494 Ga0495599_0000130
495 Ga0495623_0002437
496 Ga0495623_0068309
497 Ga0495646_0002171
498 Ga0495647_0001765
499 Ga0495647_0018798
500 Ga0495658_0012047
501 Ga0495658_0028294
502 Ga0495658_0061976
503 Ga0495658_0093431
504 Ga0495613_0011866
505 Ga0495613_0013062
506 Ga0495624_0000914
507 Ga0495600_0060125
508 Ga0495581_0003321
509 Ga0495581_0152182
510 Ga0495604_0001502
511 Ga0495604_0123149
512 Ga0495674_0010703
513 Ga0495674_0039646
514 Ga0495674_0121101
515 Ga0495676_0000792
516 Ga0495676_0016960
517 Ga0495680_0038777
518 Ga0495680_0058772
519 Ga0495675_0003728
520 Ga0495684_0008241
521 Ga0495684_0059535
522 Ga0495684_0116055
523 Ga0495593_0002583
524 Ga0495602_0000147
525 Ga0495602_0019238
526 Ga0495614_0000710
527 Ga0496100_0026959
528 Ga0496100_0124979
529 Ga0496101_0075974
530 Ga0496102_0007061
531 Ga0496102_0009932
532 Ga0496102_0080627
533 Ga0496102_0104290
534 Ga0496104_0007464
535 Ga0496105_0096954
536 Ga0496106_0008121
537 Ga0496106_0022433
538 Ga0496107_0015639
539 Ga0496107_0017980
540 Ga0496107_0062141
541 Ga0496107_0286778
542 Ga0496108_0008034
543 Ga0496108_0052868
544 Ga0496109_0015349
545 Ga0496109_0058608
546 Ga0496109_0287430
547 Ga0496110_0029080
548 Ga0496111_0020936
549 Ga0496111_0185449
550 Ga0496112_0216637
551 Ga0496112_0397709
552 Ga0496114_0012718
553 Ga0496114_0038442
554 Ga0496114_0057967
555 Ga0496114_0088254
556 Ga0496115_0001270
557 Ga0496115_0011543
558 Ga0501067_0021459
559 Ga0495601_0000275
560 Ga0495601_0013445
561 Ga0495601_0016603
562 Ga0495601_0049347
563 Ga0495601_0129050
564 Ga0495601_0135331
565 Ga0495612_0013896
566 Ga0495612_0025842
567 Ga0495612_0049138
568 Ga0495612_0069925
569 Ga0495595_0005712
570 Ga0495619_0008330
571 Ga0495619_0024214
572 Ga0495619_0036393
573 Ga0495619_0048504
574 Ga0500566_0051477
575 Ga0500630_049167
576 Ga0466962_0009858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09992

NAGPA

Phosphodiester glycosidase

219

355

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ohg-assembly1.cif.gz_A crystal structure of a protein with unknown function from duf2233 family (bacova_00430) from bacteroides ovatus at 1.80 a resolution 0.7216 152 392
6pku-assembly2.cif.gz_D guinea pig n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c51s c221s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.6492 152 391
3ohg-assembly1.cif.gz_A crystal structure of a protein with unknown function from duf2233 family (bacova_00430) from bacteroides ovatus at 1.80 a resolution 0.6182 152 392
6pki-assembly1.cif.gz_A zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain (c56s c230s) in complex with n-acetyl-alpha-d-glucosamine (alpha-glcnac) and mannose 6-phosphate (m6p) 0.6127 142 392
6pkh-assembly1.cif.gz_A-2 zebrafish n-acetylglucosamine-1-phosphodiester alpha-n-acetylglucosaminidase (nagpa) catalytic domain auto-inhibited by pro-peptide 0.6062 144 392
ID Description Score Start End Superfamily
af_P47110_1_93_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6511 236 272 1.20.140.150
af_A0A1D8PH14_1281_1421_1.25.40.410 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DOCK DHR2 domain, lobe A 0.5785 56 83 1.25.40.410
af_Q21463_4_196_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.5347 304 354 3.60.20.10
4i4bA01 Alpha Beta;Alpha-Beta Complex;3-hydroxy-3-methylglutaryl-coenzyme A Reductase; Chain A, domain 2;3-hydroxy-3-methylglutaryl-coenzyme A Reductase; Chain A, domain 2 0.5333 305 335 3.90.770.10
af_D3ZFP5_121_198_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.5326 302 347 2.10.60.10
ID Description Score Start End GO Terms
AF-A0A538KGQ1-F1-model_v4 Phosphodiester glycosidase family protein 0.9352 201 401 GO:0016798
AF-A0A542Z9B8-F1-model_v4 Uncharacterized protein DUF2233 0.9196 61 401
AF-A0A6J5YH06-F1-model_v4 Unannotated protein 0.9183 121 392
AF-A0A2G4FEE4-F1-model_v4 deleted 0.9141 235 383
AF-A0A538KGQ1-F1-model_v4 Phosphodiester glycosidase family protein 0.9134 201 401 GO:0016798

Map