F388783

General Info

Members Datasets Scaffolds Average Seq Length
288 153 275 271

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0003612|Ga0495620_0003612_7493_8428
Length 311
Sequence MLYYEYALVSLFYALHPLSSNHRHDSHALGSAASAPYVGILMPELPEVETTVRGLARFLEGERIARVAVNRPDLRRPFPPDLVQVLTGARVTGMGRRAKYGLIHTDRDATMVFHLGMSGRWRIEPETPDKHDHLVLETAAGHVLALNDARRFGSVDLVATDQLDAWGPFAKLGPEPLGEGLTPKHLRAAFADRIAPIKQMLLDQTIVAGLGNIYVCEALFRSGIRPDKEAGRVSLPALSKLVPAIREVLSESIAAGGSTIRDYAQPNGELGYFAASWQVYGREGETCACGAPVQRFVQGGRSTFWCRTCQK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
12 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
13 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
128 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
141 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
142 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
143 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
149 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
150 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
151 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
152 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
153 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0
Isolates 4.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.14
Nodule 0.69
Rhizoplane 4.17
Rhizosphere 59.38
Stem 0
Stem Tuber 0
Unclassified 15.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2092658 2162886007 Bacteria 3968
2 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
3 JGI24748J21848_1000454 3300002074 Bacteria 4554
4 Ga0065704_10070205 3300005289 Bacteria 83747
5 Ga0065704_10070413 3300005289 Bacteria 26038
6 Ga0070666_10025171 3300005335 Bacteria 3879
7 Ga0070666_10100240 3300005335 Bacteria 1995
8 Ga0070666_10134578 3300005335 Bacteria 1719
9 Ga0070668_100000028 3300005347 Bacteria 89707
10 Ga0070668_100000927 3300005347 Bacteria 20472
11 Ga0070668_100004618 3300005347 Bacteria 10202
12 Ga0070668_100083773 3300005347 Bacteria 2504
13 Ga0070669_100000776 3300005353 Bacteria 23176
14 Ga0070669_100001504 3300005353 Bacteria 16853
15 Ga0070669_100249763 3300005353 Bacteria 1412
16 Ga0070675_100029966 3300005354 Bacteria 4391
17 Ga0070671_100000829 3300005355 Bacteria 22442
18 Ga0070671_100001575 3300005355 Bacteria 17171
19 Ga0070671_100010845 3300005355 Bacteria 7312
20 Ga0070674_100183647 3300005356 Bacteria 1604
21 Ga0070667_100000626 3300005367 Bacteria 34381
22 Ga0070667_100001140 3300005367 Bacteria 24152
23 Ga0070667_100016515 3300005367 Bacteria 6109
24 Ga0070663_100049466 3300005455 Bacteria 2985
25 Ga0070665_100000070 3300005548 Bacteria 200681
26 Ga0070665_100008683 3300005548 Bacteria 10285
27 Ga0068859_100055617 3300005617 Bacteria 3982
28 Ga0068859_100095478 3300005617 Bacteria 3026
29 Ga0068864_100001835 3300005618 Bacteria 17465
30 Ga0068863_100000052 3300005841 Bacteria 125430
31 Ga0068863_100000092 3300005841 Bacteria 97076
32 Ga0068863_100002981 3300005841 Bacteria 16743
33 Ga0068858_100002691 3300005842 Bacteria 17896
34 Ga0068858_100073903 3300005842 Bacteria 3164
35 Ga0068860_100000007 3300005843 Bacteria 429329
36 Ga0068860_100000196 3300005843 Bacteria 97096
37 Ga0068860_100029952 3300005843 Bacteria 5235
38 Ga0068860_100042994 3300005843 Bacteria 4312
39 Ga0068860_100128610 3300005843 Bacteria 2429
40 Ga0068862_100001863 3300005844 Bacteria 19097
41 Ga0068862_100024968 3300005844 Bacteria 5017
42 Ga0068862_100034343 3300005844 Bacteria 4290
43 Ga0068862_100090810 3300005844 Bacteria 2659
44 Ga0075368_10000152 3300006042 Bacteria 18566
45 Ga0075363_100000467 3300006048 Bacteria 12681
46 Ga0075364_10013287 3300006051 Bacteria 5056
47 Ga0075364_10020634 3300006051 Bacteria 4146
48 Ga0075364_10097135 3300006051 Bacteria 1959
49 Ga0075364_10235055 3300006051 Bacteria 1245
50 Ga0075362_10000066 3300006177 Bacteria 29420
51 Ga0075362_10000596 3300006177 Bacteria 10593
52 Ga0075369_10004971 3300006186 Bacteria 4947
53 Ga0075369_10071245 3300006186 Bacteria 1530
54 Ga0075369_10112666 3300006186 Bacteria 1227
55 Ga0075366_10000145 3300006195 Bacteria 29884
56 Ga0075366_10007378 3300006195 Bacteria 6069
57 Ga0075366_10069721 3300006195 Bacteria 2093
58 Ga0075366_10200385 3300006195 Bacteria 1214
59 Ga0075370_10000055 3300006353 Bacteria 33979
60 Ga0075370_10004306 3300006353 Bacteria 6891
61 Ga0075370_10008006 3300006353 Bacteria 5418
62 Ga0075370_10049565 3300006353 Bacteria 2381
63 Ga0097620_100055618 3300006931 Bacteria 3982
64 Ga0097620_100095482 3300006931 Bacteria 3026
65 Ga0079104_1028204 3300006946 Bacteria 1429
66 Ga0079104_1034343 3300006946 Bacteria 1232
67 Ga0105251_10003158 3300009011 Bacteria 12211
68 Ga0105251_10123116 3300009011 Bacteria 1177
69 Ga0105247_10184413 3300009101 Bacteria 1394
70 Ga0105247_10246694 3300009101 Bacteria 1219
71 Ga0105248_10012649 3300009177 Bacteria 9312
72 Ga0105248_10013983 3300009177 Bacteria 8831
73 Ga0105248_10076069 3300009177 Bacteria 3773
74 Ga0105249_10032567 3300009553 Bacteria 4717
75 Ga0157371_10057495 3300013102 Bacteria 2758
76 Ga0163162_10021575 3300013306 Bacteria 6344
77 Ga0163162_10024944 3300013306 Bacteria 5906
78 Ga0157380_10074423 3300014326 Bacteria 2757
79 Ga0163161_10001840 3300017792 Bacteria 15493
80 Ga0163161_10353331 3300017792 Bacteria 1169
81 Ga0213873_10000009 3300021358 Bacteria 237102
82 Ga0213872_10000285 3300021361 Bacteria 43243
83 Ga0213872_10028123 3300021361 Bacteria 2580
84 Ga0213876_10000004 3300021384 Bacteria 943822
85 Ga0209050_1000262 3300025298 Bacteria 112798
86 Ga0207696_1001953 3300025711 Bacteria 10478
87 Ga0207713_1004906 3300025735 Bacteria 8551
88 Ga0207713_1018913 3300025735 Bacteria 3392
89 Ga0207710_10085132 3300025900 Bacteria 1472
90 Ga0207710_10095852 3300025900 Bacteria 1394
91 Ga0207680_10037075 3300025903 Bacteria 2813
92 Ga0207680_10096216 3300025903 Bacteria 1894
93 Ga0207680_10141006 3300025903 Bacteria 1598
94 Ga0207681_10002329 3300025923 Bacteria 12089
95 Ga0207681_10003582 3300025923 Bacteria 9670
96 Ga0207681_10059028 3300025923 Bacteria 2629
97 Ga0207681_10353983 3300025923 Bacteria 1176
98 Ga0207650_10052193 3300025925 Bacteria 3028
99 Ga0207650_10320707 3300025925 Bacteria 1269
100 Ga0207659_10283878 3300025926 Bacteria 1354
101 Ga0207644_10000125 3300025931 Bacteria 56447
102 Ga0207644_10004486 3300025931 Bacteria 9064
103 Ga0207644_10004676 3300025931 Bacteria 8901
104 Ga0207644_10006854 3300025931 Bacteria 7422
105 Ga0207669_10207985 3300025937 Bacteria 1426
106 Ga0207711_10019004 3300025941 Bacteria 5717
107 Ga0207711_10020863 3300025941 Bacteria 5468
108 Ga0207711_10065527 3300025941 Bacteria 3140
109 Ga0207712_10221058 3300025961 Bacteria 1514
110 Ga0207668_10000076 3300025972 Bacteria 75056
111 Ga0207668_10000746 3300025972 Bacteria 19869
112 Ga0207668_10017031 3300025972 Bacteria 4547
113 Ga0207658_10000075 3300025986 Bacteria 109004
114 Ga0207658_10001382 3300025986 Bacteria 18946
115 Ga0207658_10002739 3300025986 Bacteria 12726
116 Ga0207658_10005000 3300025986 Bacteria 9134
117 Ga0207658_10041579 3300025986 Bacteria 3329
118 Ga0207703_10001073 3300026035 Bacteria 26059
119 Ga0207703_10017723 3300026035 Bacteria 5560
120 Ga0207703_10168040 3300026035 Bacteria 1927
121 Ga0207641_10000004 3300026088 Bacteria 481088
122 Ga0207641_10000042 3300026088 Bacteria 186384
123 Ga0207641_10004191 3300026088 Bacteria 12564
124 Ga0207676_10029432 3300026095 Bacteria 4112
125 Ga0209371_1038290 3300027312 Bacteria 990
126 Ga0209813_10000082 3300027866 Bacteria 34870
127 Ga0268266_10001471 3300028379 Bacteria 27988
128 Ga0268266_10002431 3300028379 Bacteria 20016
129 Ga0268266_10142959 3300028379 Bacteria 2148
130 Ga0268265_10007903 3300028380 Bacteria 7177
131 Ga0268265_10019467 3300028380 Bacteria 4719
132 Ga0268265_10036208 3300028380 Bacteria 3613
133 Ga0268264_10000087 3300028381 Bacteria 236696
134 Ga0268264_10000134 3300028381 Bacteria 179475
135 Ga0268264_10031281 3300028381 Bacteria 4364
136 Ga0268264_10101581 3300028381 Bacteria 2500
137 Ga0265331_10054944 3300031250 Bacteria 1895
138 Ga0307408_100065755 3300031548 Bacteria 2660
139 Ga0307508_10009433 3300031616 Bacteria 8978
140 Ga0307405_10013513 3300031731 Bacteria 4358
141 Ga0307413_10024961 3300031824 Bacteria 3267
142 Ga0307413_10120353 3300031824 Bacteria 1777
143 Ga0307413_10492905 3300031824 Bacteria 982
144 Ga0307410_10035501 3300031852 Bacteria 3238
145 Ga0307410_10092571 3300031852 Bacteria 2149
146 Ga0307406_10254132 3300031901 Bacteria 1326
147 Ga0307407_10005829 3300031903 Bacteria 5397
148 Ga0307407_10343815 3300031903 Bacteria 1054
149 Ga0307412_10158341 3300031911 Bacteria 1679
150 Ga0307409_100050473 3300031995 Bacteria 3177
151 Ga0307409_100205918 3300031995 Bacteria 1764
152 Ga0307416_100849844 3300032002 Bacteria 1011
153 Ga0307415_100069016 3300032126 Bacteria 2477
154 Ga0373931_0012105 3300035691 Bacteria 4176
155 Ga0436365_0192103 3300039437 Bacteria 182879
156 Ga0436361_0411004 3300039447 Bacteria 4672
157 Ga0436362_0383697 3300039453 Bacteria 74416
158 Ga0466970_0161648 3300044765 Bacteria 1239
159 Ga0495627_000372 3300046453 Bacteria 41499
160 Ga0495650_0001266 3300046471 Bacteria 26037
161 Ga0495596_0000008 3300046500 Bacteria 150860
162 Ga0495596_0003454 3300046500 Bacteria 7990
163 Ga0495607_0004625 3300046501 Bacteria 10074
164 Ga0495607_0012033 3300046501 Bacteria 5726
165 Ga0495583_0016829 3300046506 Bacteria 3909
166 Ga0495583_0129284 3300046506 Bacteria 1058
167 Ga0495606_0003149 3300046507 Bacteria 17878
168 Ga0495606_0009831 3300046507 Bacteria 8029
169 Ga0495610_0000033 3300046512 Bacteria 204151
170 Ga0495610_0000756 3300046512 Bacteria 30516
171 Ga0495610_0003356 3300046512 Bacteria 12554
172 Ga0495610_0092849 3300046512 Bacteria 1365
173 Ga0495620_0003612 3300046515 Bacteria 8835
174 Ga0495620_0003995 3300046515 Bacteria 8381
175 Ga0495632_0000309 3300046519 Bacteria 47211
176 Ga0495643_0000048 3300046522 Bacteria 212788
177 Ga0495643_0002195 3300046522 Bacteria 15959
178 Ga0495643_0036318 3300046522 Bacteria 2708
179 Ga0495643_0054520 3300046522 Bacteria 2139
180 Ga0495609_0002388 3300046538 Bacteria 11560
181 Ga0495633_0031026 3300046558 Bacteria 2594
182 Ga0495668_0096658 3300046616 Bacteria 1616
183 Ga0495625_0012995 3300046660 Bacteria 6718
184 Ga0495625_0037180 3300046660 Bacteria 3574
185 Ga0495625_0141433 3300046660 Bacteria 1623
186 Ga0495681_0000041 3300047470 Bacteria 119251
187 Ga0495681_0098089 3300047470 Bacteria 1285
188 Ga0495615_0000287 3300048090 Bacteria 9004
189 Ga0495626_0002802 3300048091 Bacteria 11691
190 Ga0496101_0058355 3300048904 Bacteria 2794
191 Ga0496102_0002022 3300048905 Bacteria 17516
192 Ga0496103_0000581 3300048906 Bacteria 28917
193 Ga0496103_0036666 3300048906 Bacteria 3003
194 Ga0496104_0001657 3300048907 Bacteria 19233
195 Ga0496104_0055124 3300048907 Bacteria 3758
196 Ga0496105_0002144 3300048908 Bacteria 14295
197 Ga0496105_0402062 3300048908 Bacteria 1087
198 Ga0496107_0236516 3300048910 Bacteria 1359
199 Ga0496110_0022610 3300048913 Bacteria 5341
200 Ga0496111_0057600 3300048914 Bacteria 2813
201 Ga0496112_0341085 3300048915 Bacteria 1442
202 Ga0496116_0000062 3300048919 Bacteria 271104
203 Ga0496116_0143972 3300048919 Bacteria 1335
204 Ga0496117_0014507 3300048920 Bacteria 6783
205 Ga0496117_0016703 3300048920 Bacteria 6173
206 Ga0496117_0023122 3300048920 Bacteria 4965
207 Ga0496117_0024307 3300048920 Bacteria 4797
208 Ga0496118_0020501 3300048921 Bacteria 5857
209 Ga0496118_0027419 3300048921 Bacteria 4820
210 Ga0496118_0040683 3300048921 Bacteria 3693
211 Ga0496118_0157837 3300048921 Bacteria 1408
212 Ga0496119_0072596 3300048922 Bacteria 2010
213 Ga0496121_0000087 3300048924 Bacteria 222451
214 Ga0496121_0000196 3300048924 Bacteria 135812
215 Ga0496121_0015255 3300048924 Bacteria 8071
216 Ga0496121_0049171 3300048924 Bacteria 3579
217 Ga0496121_0150887 3300048924 Bacteria 1710
218 Ga0496122_0004355 3300048925 Bacteria 17692
219 Ga0496122_0167563 3300048925 Bacteria 1329
220 Ga0496123_0000545 3300048926 Bacteria 64687
221 Ga0496123_0006948 3300048926 Bacteria 10811
222 Ga0496123_0044829 3300048926 Bacteria 3020
223 Ga0496124_0001905 3300048927 Bacteria 28630
224 Ga0496124_0014784 3300048927 Bacteria 7527
225 Ga0496124_0026937 3300048927 Bacteria 5173
226 Ga0496124_0061735 3300048927 Bacteria 3140
227 Ga0496124_0086022 3300048927 Bacteria 2574
228 Ga0496125_0013648 3300048928 Bacteria 7974
229 Ga0496125_0034978 3300048928 Bacteria 4418
230 Ga0496125_0053313 3300048928 Bacteria 3316
231 Ga0496126_0000801 3300048929 Bacteria 56279
232 Ga0496126_0002590 3300048929 Bacteria 24120
233 Ga0496126_0007548 3300048929 Bacteria 11899
234 Ga0496126_0046811 3300048929 Bacteria 3963
235 Ga0501038_0432939 3300049574 Bacteria 1013
236 Ga0501224_006481 3300049664 Bacteria 1697
237 Ga0501249_042593 3300049679 Bacteria 1032
238 Ga0501044_0000290 3300049823 Bacteria 63934
239 nmdc:mga03683_1345_c1 3300050489 Bacteria 7284
240 nmdc:mga03683_16768_c1 3300050489 Bacteria 2759
241 nmdc:mga03683_55_c1 3300050489 Bacteria 47333
242 nmdc:mga03n38_9585_c1 3300050490 Bacteria 3529
243 nmdc:mga00v17_10632_c1 3300050491 Bacteria 5033
244 nmdc:mga00v17_16647_c1 3300050491 Bacteria 4146
245 nmdc:mga0yw44_122740_c1 3300050492 Bacteria 1675
246 nmdc:mga0k408_159100_c1 3300050493 Bacteria 1345
247 nmdc:mga0k408_45398_c1 3300050493 Bacteria 2535
248 nmdc:mga0k408_6795_c1 3300050493 Bacteria 6101
249 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
250 nmdc:mga06z11_770_c1 3300050494 Bacteria 11686
251 nmdc:mga04h51_339_c1 3300050495 Bacteria 11749
252 nmdc:mga07m45_1849_c1 3300050496 Bacteria 9777
253 nmdc:mga07m45_35_c1 3300050496 Bacteria 74486
254 nmdc:mga07m45_37166_c1 3300050496 Bacteria 2715
255 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
256 nmdc:mga0sz30_303_c1 3300050516 Bacteria 18938
257 nmdc:mga0sz30_34815_c1 3300050516 Bacteria 2099
258 nmdc:mga0sz30_41_c1 3300050516 Bacteria 46173
259 Ga0500643_006007 3300053087 Bacteria 5141
260 Ga0500643_027917 3300053087 Bacteria 1749
261 Ga0500592_009625 3300053116 Bacteria 1538
262 Ga0500607_000077 3300053121 Bacteria 71543
263 Ga0500607_000763 3300053121 Bacteria 30989
264 Ga0500608_000074 3300053122 Bacteria 42636
265 Ga0500614_006488 3300053123 Bacteria 2461
266 Ga0500618_001872 3300053125 Bacteria 8758
267 Ga0500559_0000782 3300053136 Bacteria 20805
268 Ga0500559_0001165 3300053136 Bacteria 15792
269 Ga0500564_000068 3300053138 Bacteria 27518
270 Ga0500573_0000029 3300053140 Bacteria 135595
271 Ga0500590_001145 3300053148 Bacteria 10463
272 Ga0500622_0000119 3300053156 Bacteria 82219
273 Ga0500637_0006374 3300053178 Bacteria 5803
274 Ga0500625_000004 3300053729 Bacteria 245905
275 Ga0500645_003231 3300053730 Bacteria 6744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10028123 Ga0213872_100281232 248
2 3300039447 Ga0436361_0411004 Ga0436361_0411004_1092_1922 248
3 3300031824 Ga0307413_10492905 Ga0307413_104929051 252
4 3300046522 Ga0495643_0036318 Ga0495643_0036318_606_1364 252
5 3300006186 Ga0075369_10071245 Ga0075369_100712452 253
6 iso_pu_bacteria 2510917021 2511126452 266
7 iso_pu_bacteria 2738541275 2738710376 266
8 iso_pu_bacteria 2738541301 2738848801 266
9 iso_pu_bacteria 2738541304 2738864530 266
10 iso_pu_bacteria 2738543022 2739297048 266
11 iso_pu_bacteria 2738543033 2739358726 266
12 iso_pu_bacteria 2739367664 2739650620 266
13 iso_pu_bacteria 2739367865 2740029093 266
14 iso_pu_bacteria 2818991438 2819554692 266
15 iso_pu_bacteria 2919138771 2919142105 266
16 iso_pu_bacteria 2928100450 2928100473 266
17 iso_pu_bacteria 2928959182 2928960538 266
18 iso_pu_bacteria 8054302542 8054305089 266
19 3300005353 Ga0070669_100249763 Ga0070669_1002497632 269
20 3300005455 Ga0070663_100049466 Ga0070663_1000494663 269
21 3300013102 Ga0157371_10057495 Ga0157371_100574952 269
22 3300025923 Ga0207681_10059028 Ga0207681_100590282 269
23 3300031824 Ga0307413_10120353 Ga0307413_101203531 269
24 3300031903 Ga0307407_10343815 Ga0307407_103438151 269
25 3300031995 Ga0307409_100205918 Ga0307409_1002059181 269
26 3300032002 Ga0307416_100849844 Ga0307416_1008498441 269
27 2162886007 SwRhRL2b_contig_2092658 SwRhRL2b_0784.00006270 270
28 2162886007 SwRhRL2b_contig_3207873 SwRhRL2b_0996.00002170 270
29 3300002074 JGI24748J21848_1000454 JGI24748J21848_10004541 270
30 3300005289 Ga0065704_10070205 Ga0065704_1007020558 270
31 3300005289 Ga0065704_10070413 Ga0065704_1007041311 270
32 3300005335 Ga0070666_10025171 Ga0070666_100251713 270
33 3300005335 Ga0070666_10100240 Ga0070666_101002401 270
34 3300005335 Ga0070666_10134578 Ga0070666_101345781 270
35 3300005347 Ga0070668_100000028 Ga0070668_10000002876 270
36 3300005347 Ga0070668_100000927 Ga0070668_1000009276 270
37 3300005347 Ga0070668_100004618 Ga0070668_1000046187 270
38 3300005347 Ga0070668_100083773 Ga0070668_1000837733 270
39 3300005353 Ga0070669_100000776 Ga0070669_1000007764 270
40 3300005353 Ga0070669_100001504 Ga0070669_10000150413 270
41 3300005354 Ga0070675_100029966 Ga0070675_1000299663 270
42 3300005355 Ga0070671_100000829 Ga0070671_1000008293 270
43 3300005355 Ga0070671_100001575 Ga0070671_10000157510 270
44 3300005355 Ga0070671_100010845 Ga0070671_1000108451 270
45 3300005356 Ga0070674_100183647 Ga0070674_1001836472 270
46 3300005367 Ga0070667_100000626 Ga0070667_10000062622 270
47 3300005367 Ga0070667_100001140 Ga0070667_1000011404 270
48 3300005367 Ga0070667_100016515 Ga0070667_1000165155 270
49 3300005548 Ga0070665_100000070 Ga0070665_100000070117 270
50 3300005548 Ga0070665_100008683 Ga0070665_1000086836 270
51 3300005617 Ga0068859_100055617 Ga0068859_1000556174 270
52 3300005617 Ga0068859_100095478 Ga0068859_1000954782 270
53 3300005618 Ga0068864_100001835 Ga0068864_10000183515 270
54 3300005841 Ga0068863_100000052 Ga0068863_10000005274 270
55 3300005841 Ga0068863_100000092 Ga0068863_10000009236 270
56 3300005841 Ga0068863_100002981 Ga0068863_10000298111 270
57 3300005842 Ga0068858_100002691 Ga0068858_10000269113 270
58 3300005842 Ga0068858_100073903 Ga0068858_1000739032 270
59 3300005843 Ga0068860_100000007 Ga0068860_100000007343 270
60 3300005843 Ga0068860_100000196 Ga0068860_10000019663 270
61 3300005843 Ga0068860_100029952 Ga0068860_1000299525 270
62 3300005843 Ga0068860_100042994 Ga0068860_1000429943 270
63 3300005843 Ga0068860_100128610 Ga0068860_1001286103 270
64 3300005844 Ga0068862_100001863 Ga0068862_10000186318 270
65 3300005844 Ga0068862_100024968 Ga0068862_1000249683 270
66 3300005844 Ga0068862_100034343 Ga0068862_1000343432 270
67 3300005844 Ga0068862_100090810 Ga0068862_1000908102 270
68 3300006042 Ga0075368_10000152 Ga0075368_1000015212 270
69 3300006048 Ga0075363_100000467 Ga0075363_1000004679 270
70 3300006051 Ga0075364_10013287 Ga0075364_100132873 270
71 3300006051 Ga0075364_10020634 Ga0075364_100206344 270
72 3300006051 Ga0075364_10097135 Ga0075364_100971351 270
73 3300006051 Ga0075364_10235055 Ga0075364_102350552 270
74 3300006177 Ga0075362_10000066 Ga0075362_1000006614 270
75 3300006177 Ga0075362_10000596 Ga0075362_100005967 270
76 3300006186 Ga0075369_10004971 Ga0075369_100049712 270
77 3300006186 Ga0075369_10112666 Ga0075369_101126662 270
78 3300006195 Ga0075366_10000145 Ga0075366_1000014512 270
79 3300006195 Ga0075366_10007378 Ga0075366_100073783 270
80 3300006195 Ga0075366_10069721 Ga0075366_100697212 270
81 3300006195 Ga0075366_10200385 Ga0075366_102003852 270
82 3300006353 Ga0075370_10000055 Ga0075370_1000005534 270
83 3300006353 Ga0075370_10004306 Ga0075370_100043062 270
84 3300006353 Ga0075370_10008006 Ga0075370_100080064 270
85 3300006353 Ga0075370_10049565 Ga0075370_100495653 270
86 3300006931 Ga0097620_100055618 Ga0097620_1000556182 270
87 3300006931 Ga0097620_100095482 Ga0097620_1000954823 270
88 3300006946 Ga0079104_1028204 Ga0079104_10282042 270
89 3300006946 Ga0079104_1034343 Ga0079104_10343431 270
90 3300009011 Ga0105251_10003158 Ga0105251_100031585 270
91 3300009011 Ga0105251_10123116 Ga0105251_101231161 270
92 3300009101 Ga0105247_10184413 Ga0105247_101844132 270
93 3300009101 Ga0105247_10246694 Ga0105247_102466941 270
94 3300009177 Ga0105248_10012649 Ga0105248_100126491 270
95 3300009177 Ga0105248_10013983 Ga0105248_100139835 270
96 3300009177 Ga0105248_10076069 Ga0105248_100760693 270
97 3300009553 Ga0105249_10032567 Ga0105249_100325674 270
98 3300013306 Ga0163162_10021575 Ga0163162_100215754 270
99 3300013306 Ga0163162_10024944 Ga0163162_100249442 270
100 3300014326 Ga0157380_10074423 Ga0157380_100744232 270
101 3300017792 Ga0163161_10001840 Ga0163161_100018406 270
102 3300017792 Ga0163161_10353331 Ga0163161_103533312 270
103 3300021358 Ga0213873_10000009 Ga0213873_10000009151 270
104 3300021361 Ga0213872_10000285 Ga0213872_1000028528 270
105 3300021384 Ga0213876_10000004 Ga0213876_10000004166 270
106 3300025298 Ga0209050_1000262 Ga0209050_100026272 270
107 3300025711 Ga0207696_1001953 Ga0207696_10019532 270
108 3300025735 Ga0207713_1004906 Ga0207713_10049065 270
109 3300025735 Ga0207713_1018913 Ga0207713_10189132 270
110 3300025900 Ga0207710_10085132 Ga0207710_100851321 270
111 3300025900 Ga0207710_10095852 Ga0207710_100958522 270
112 3300025903 Ga0207680_10037075 Ga0207680_100370751 270
113 3300025903 Ga0207680_10096216 Ga0207680_100962162 270
114 3300025903 Ga0207680_10141006 Ga0207680_101410062 270
115 3300025923 Ga0207681_10002329 Ga0207681_100023294 270
116 3300025923 Ga0207681_10003582 Ga0207681_100035822 270
117 3300025923 Ga0207681_10353983 Ga0207681_103539831 270
118 3300025925 Ga0207650_10052193 Ga0207650_100521932 270
119 3300025925 Ga0207650_10320707 Ga0207650_103207072 270
120 3300025926 Ga0207659_10283878 Ga0207659_102838782 270
121 3300025931 Ga0207644_10000125 Ga0207644_1000012555 270
122 3300025931 Ga0207644_10004486 Ga0207644_100044864 270
123 3300025931 Ga0207644_10004676 Ga0207644_100046762 270
124 3300025931 Ga0207644_10006854 Ga0207644_100068542 270
125 3300025937 Ga0207669_10207985 Ga0207669_102079852 270
126 3300025941 Ga0207711_10019004 Ga0207711_100190042 270
127 3300025941 Ga0207711_10020863 Ga0207711_100208634 270
128 3300025941 Ga0207711_10065527 Ga0207711_100655273 270
129 3300025961 Ga0207712_10221058 Ga0207712_102210581 270
130 3300025972 Ga0207668_10000076 Ga0207668_1000007648 270
131 3300025972 Ga0207668_10000746 Ga0207668_1000074611 270
132 3300025972 Ga0207668_10017031 Ga0207668_100170311 270
133 3300025986 Ga0207658_10000075 Ga0207658_1000007537 270
134 3300025986 Ga0207658_10001382 Ga0207658_1000138213 270
135 3300025986 Ga0207658_10002739 Ga0207658_1000273914 270
136 3300025986 Ga0207658_10005000 Ga0207658_100050003 270
137 3300025986 Ga0207658_10041579 Ga0207658_100415791 270
138 3300026035 Ga0207703_10001073 Ga0207703_100010733 270
139 3300026035 Ga0207703_10017723 Ga0207703_100177236 270
140 3300026035 Ga0207703_10168040 Ga0207703_101680402 270
141 3300026088 Ga0207641_10000004 Ga0207641_10000004454 270
142 3300026088 Ga0207641_10000042 Ga0207641_1000004274 270
143 3300026088 Ga0207641_10004191 Ga0207641_100041917 270
144 3300026095 Ga0207676_10029432 Ga0207676_100294322 270
145 3300027312 Ga0209371_1038290 Ga0209371_10382901 270
146 3300027866 Ga0209813_10000082 Ga0209813_100000829 270
147 3300028379 Ga0268266_10001471 Ga0268266_1000147121 270
148 3300028379 Ga0268266_10002431 Ga0268266_1000243113 270
149 3300028379 Ga0268266_10142959 Ga0268266_101429592 270
150 3300028380 Ga0268265_10007903 Ga0268265_100079036 270
151 3300028380 Ga0268265_10019467 Ga0268265_100194674 270
152 3300028380 Ga0268265_10036208 Ga0268265_100362082 270
153 3300028381 Ga0268264_10000087 Ga0268264_10000087122 270
154 3300028381 Ga0268264_10000134 Ga0268264_1000013472 270
155 3300028381 Ga0268264_10031281 Ga0268264_100312812 270
156 3300028381 Ga0268264_10101581 Ga0268264_101015811 270
157 3300031250 Ga0265331_10054944 Ga0265331_100549442 270
158 3300031548 Ga0307408_100065755 Ga0307408_1000657552 270
159 3300031616 Ga0307508_10009433 Ga0307508_100094338 270
160 3300031731 Ga0307405_10013513 Ga0307405_100135134 270
161 3300031824 Ga0307413_10024961 Ga0307413_100249613 270
162 3300031852 Ga0307410_10035501 Ga0307410_100355013 270
163 3300031852 Ga0307410_10092571 Ga0307410_100925712 270
164 3300031901 Ga0307406_10254132 Ga0307406_102541322 270
165 3300031903 Ga0307407_10005829 Ga0307407_100058294 270
166 3300031911 Ga0307412_10158341 Ga0307412_101583412 270
167 3300031995 Ga0307409_100050473 Ga0307409_1000504733 270
168 3300032126 Ga0307415_100069016 Ga0307415_1000690163 270
169 3300035691 Ga0373931_0012105 Ga0373931_0012105_2600_3412 270
170 3300039437 Ga0436365_0192103 Ga0436365_0192103_14944_15759 270
171 3300039453 Ga0436362_0383697 Ga0436362_0383697_56346_57161 270
172 3300044765 Ga0466970_0161648 Ga0466970_0161648_302_1132 270
173 3300046453 Ga0495627_000372 Ga0495627_000372_15696_16508 270
174 3300046471 Ga0495650_0001266 Ga0495650_0001266_23962_24774 270
175 3300046500 Ga0495596_0000008 Ga0495596_0000008_23638_24450 270
176 3300046500 Ga0495596_0003454 Ga0495596_0003454_2311_3123 270
177 3300046501 Ga0495607_0004625 Ga0495607_0004625_7569_8381 270
178 3300046501 Ga0495607_0012033 Ga0495607_0012033_3998_4810 270
179 3300046506 Ga0495583_0016829 Ga0495583_0016829_328_1140 270
180 3300046506 Ga0495583_0129284 Ga0495583_0129284_63_875 270
181 3300046507 Ga0495606_0003149 Ga0495606_0003149_6977_7852 270
182 3300046507 Ga0495606_0009831 Ga0495606_0009831_5479_6291 270
183 3300046512 Ga0495610_0000033 Ga0495610_0000033_139517_140395 270
184 3300046512 Ga0495610_0000756 Ga0495610_0000756_23256_24068 270
185 3300046512 Ga0495610_0003356 Ga0495610_0003356_3547_4359 270
186 3300046512 Ga0495610_0092849 Ga0495610_0092849_163_975 270
187 3300046515 Ga0495620_0003612 Ga0495620_0003612_7493_8428 270
188 3300046515 Ga0495620_0003995 Ga0495620_0003995_607_1485 270
189 3300046519 Ga0495632_0000309 Ga0495632_0000309_36485_37297 270
190 3300046522 Ga0495643_0000048 Ga0495643_0000048_99490_100302 270
191 3300046522 Ga0495643_0002195 Ga0495643_0002195_11445_12257 270
192 3300046522 Ga0495643_0054520 Ga0495643_0054520_1155_2030 270
193 3300046538 Ga0495609_0002388 Ga0495609_0002388_5596_6408 270
194 3300046558 Ga0495633_0031026 Ga0495633_0031026_1083_1895 270
195 3300046616 Ga0495668_0096658 Ga0495668_0096658_593_1405 270
196 3300046660 Ga0495625_0012995 Ga0495625_0012995_2968_3780 270
197 3300046660 Ga0495625_0037180 Ga0495625_0037180_1247_2059 270
198 3300046660 Ga0495625_0141433 Ga0495625_0141433_27_839 270
199 3300047470 Ga0495681_0000041 Ga0495681_0000041_23960_24772 270
200 3300047470 Ga0495681_0098089 Ga0495681_0098089_62_874 270
201 3300048090 Ga0495615_0000287 Ga0495615_0000287_8055_8867 270
202 3300048091 Ga0495626_0002802 Ga0495626_0002802_3114_3926 270
203 3300048904 Ga0496101_0058355 Ga0496101_0058355_1944_2756 270
204 3300048905 Ga0496102_0002022 Ga0496102_0002022_16225_17037 270
205 3300048906 Ga0496103_0000581 Ga0496103_0000581_13337_14149 270
206 3300048906 Ga0496103_0036666 Ga0496103_0036666_1146_1967 270
207 3300048907 Ga0496104_0001657 Ga0496104_0001657_1076_1888 270
208 3300048907 Ga0496104_0055124 Ga0496104_0055124_2572_3393 270
209 3300048908 Ga0496105_0002144 Ga0496105_0002144_10726_11547 270
210 3300048908 Ga0496105_0402062 Ga0496105_0402062_209_1030 270
211 3300048910 Ga0496107_0236516 Ga0496107_0236516_283_1095 270
212 3300048913 Ga0496110_0022610 Ga0496110_0022610_2375_3190 270
213 3300048914 Ga0496111_0057600 Ga0496111_0057600_1791_2606 270
214 3300048915 Ga0496112_0341085 Ga0496112_0341085_512_1327 270
215 3300048919 Ga0496116_0000062 Ga0496116_0000062_208666_209478 270
216 3300048919 Ga0496116_0143972 Ga0496116_0143972_245_1057 270
217 3300048920 Ga0496117_0014507 Ga0496117_0014507_5730_6542 270
218 3300048920 Ga0496117_0016703 Ga0496117_0016703_1915_2727 270
219 3300048920 Ga0496117_0023122 Ga0496117_0023122_3508_4320 270
220 3300048920 Ga0496117_0024307 Ga0496117_0024307_966_1787 270
221 3300048921 Ga0496118_0020501 Ga0496118_0020501_158_970 270
222 3300048921 Ga0496118_0027419 Ga0496118_0027419_1487_2308 270
223 3300048921 Ga0496118_0040683 Ga0496118_0040683_967_1779 270
224 3300048921 Ga0496118_0157837 Ga0496118_0157837_288_1100 270
225 3300048922 Ga0496119_0072596 Ga0496119_0072596_25_837 270
226 3300048924 Ga0496121_0000087 Ga0496121_0000087_6065_6943 270
227 3300048924 Ga0496121_0000196 Ga0496121_0000196_116367_117188 270
228 3300048924 Ga0496121_0015255 Ga0496121_0015255_484_1296 270
229 3300048924 Ga0496121_0049171 Ga0496121_0049171_754_1566 270
230 3300048924 Ga0496121_0150887 Ga0496121_0150887_789_1610 270
231 3300048925 Ga0496122_0004355 Ga0496122_0004355_8578_9390 270
232 3300048925 Ga0496122_0167563 Ga0496122_0167563_57_869 270
233 3300048926 Ga0496123_0000545 Ga0496123_0000545_61643_62455 270
234 3300048926 Ga0496123_0006948 Ga0496123_0006948_4882_5694 270
235 3300048926 Ga0496123_0044829 Ga0496123_0044829_1302_2114 270
236 3300048927 Ga0496124_0001905 Ga0496124_0001905_3792_4604 270
237 3300048927 Ga0496124_0014784 Ga0496124_0014784_1544_2356 270
238 3300048927 Ga0496124_0026937 Ga0496124_0026937_4262_5074 270
239 3300048927 Ga0496124_0061735 Ga0496124_0061735_57_869 270
240 3300048927 Ga0496124_0086022 Ga0496124_0086022_1588_2400 270
241 3300048928 Ga0496125_0013648 Ga0496125_0013648_1174_1986 270
242 3300048928 Ga0496125_0034978 Ga0496125_0034978_1509_2321 270
243 3300048928 Ga0496125_0053313 Ga0496125_0053313_1925_2737 270
244 3300048929 Ga0496126_0000801 Ga0496126_0000801_53764_54576 270
245 3300048929 Ga0496126_0002590 Ga0496126_0002590_3683_4495 270
246 3300048929 Ga0496126_0007548 Ga0496126_0007548_7917_8732 270
247 3300048929 Ga0496126_0046811 Ga0496126_0046811_1613_2425 270
248 3300049574 Ga0501038_0432939 Ga0501038_0432939_98_910 270
249 3300049664 Ga0501224_006481 Ga0501224_006481_827_1639 270
250 3300049679 Ga0501249_042593 Ga0501249_042593_147_959 270
251 3300049823 Ga0501044_0000290 Ga0501044_0000290_21455_22267 270
252 3300050489 nmdc:mga03683_1345_c1 nmdc:mga03683_1345_c1_1419_2231 270
253 3300050489 nmdc:mga03683_16768_c1 nmdc:mga03683_16768_c1_248_1060 270
254 3300050489 nmdc:mga03683_55_c1 nmdc:mga03683_55_c1_27148_27960 270
255 3300050490 nmdc:mga03n38_9585_c1 nmdc:mga03n38_9585_c1_942_1754 270
256 3300050491 nmdc:mga00v17_10632_c1 nmdc:mga00v17_10632_c1_3724_4536 270
257 3300050491 nmdc:mga00v17_16647_c1 nmdc:mga00v17_16647_c1_2151_2963 270
258 3300050492 nmdc:mga0yw44_122740_c1 nmdc:mga0yw44_122740_c1_366_1178 270
259 3300050493 nmdc:mga0k408_159100_c1 nmdc:mga0k408_159100_c1_259_1080 270
260 3300050493 nmdc:mga0k408_45398_c1 nmdc:mga0k408_45398_c1_900_1712 270
261 3300050493 nmdc:mga0k408_6795_c1 nmdc:mga0k408_6795_c1_1865_2677 270
262 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_19454_20266 270
263 3300050494 nmdc:mga06z11_770_c1 nmdc:mga06z11_770_c1_9480_10292 270
264 3300050495 nmdc:mga04h51_339_c1 nmdc:mga04h51_339_c1_7264_8076 270
265 3300050496 nmdc:mga07m45_1849_c1 nmdc:mga07m45_1849_c1_6955_7767 270
266 3300050496 nmdc:mga07m45_35_c1 nmdc:mga07m45_35_c1_71988_72800 270
267 3300050496 nmdc:mga07m45_37166_c1 nmdc:mga07m45_37166_c1_1717_2529 270
268 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_180607_181449 270
269 3300050516 nmdc:mga0sz30_303_c1 nmdc:mga0sz30_303_c1_12219_13031 270
270 3300050516 nmdc:mga0sz30_34815_c1 nmdc:mga0sz30_34815_c1_278_1090 270
271 3300050516 nmdc:mga0sz30_41_c1 nmdc:mga0sz30_41_c1_25113_25925 270
272 3300053087 Ga0500643_006007 Ga0500643_006007_2448_3260 270
273 3300053087 Ga0500643_027917 Ga0500643_027917_848_1660 270
274 3300053116 Ga0500592_009625 Ga0500592_009625_508_1326 270
275 3300053121 Ga0500607_000077 Ga0500607_000077_24232_25044 270
276 3300053121 Ga0500607_000763 Ga0500607_000763_17043_17855 270
277 3300053122 Ga0500608_000074 Ga0500608_000074_71_883 270
278 3300053123 Ga0500614_006488 Ga0500614_006488_96_908 270
279 3300053125 Ga0500618_001872 Ga0500618_001872_4096_4932 270
280 3300053136 Ga0500559_0000782 Ga0500559_0000782_7387_8199 270
281 3300053136 Ga0500559_0001165 Ga0500559_0001165_11835_12647 270
282 3300053138 Ga0500564_000068 Ga0500564_000068_69_881 270
283 3300053140 Ga0500573_0000029 Ga0500573_0000029_13417_14229 270
284 3300053148 Ga0500590_001145 Ga0500590_001145_7626_8438 270
285 3300053156 Ga0500622_0000119 Ga0500622_0000119_45579_46391 270
286 3300053178 Ga0500637_0006374 Ga0500637_0006374_189_1001 270
287 3300053729 Ga0500625_000004 Ga0500625_000004_199732_200544 270
288 3300053730 Ga0500645_003231 Ga0500645_003231_3983_4795 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

172

264

0.98

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

42

155

0.97

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

284

311

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9318 2 270
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.9284 2 270
1l2d-assembly1.cif.gz_A mutm (fpg)-dna estranged guanine mismatch recognition complex 0.9158 2 270
3saw-assembly1.cif.gz_A mutm slanted complex 8 with r112a mutation 0.9135 2 270
1l2d-assembly1.cif.gz_A mutm (fpg)-dna estranged guanine mismatch recognition complex 0.9124 2 270
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9433 131 270 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9427 131 270 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9358 131 270 1.10.8.50
1k82C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9358 131 270 1.10.8.50
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9209 2 118 3.20.190.10
ID Description Score Start End GO Terms
AF-A0A352H7J1-F1-model_v4 deleted 0.9886 1 168
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9849 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A352H7J1-F1-model_v4 deleted 0.9827 1 168
AF-A0A4Q5SIZ1-F1-model_v4 Bifunctional DNA-formamidopyrimidine glycosylase/DNA-(Apurinic or apyrimidinic site) lyase (EC 3.2.2.23, EC 4.2.99.18) 0.9755 1 208 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A257PRL7-F1-model_v4 DNA-formamidopyrimidine glycosylase 0.9745 1 218 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039

Feature Viewer

pLDDT pTM Quality
89.71 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map