F388761

General Info

Members Datasets Scaffolds Average Seq Length
288 209 576 227

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0004880|Ga0466967_0004880_2705_3445
Length 246
Sequence MSRKARQRVLTKPRVLENAMQGTAQPTSPPAAYTPTDRTVPTRSADRASYDRELVHAILDEGCVCHLGFVRDGRPVVLPTLYGRVGERLYVHGSTGSRPLRMTGQTDPGLPVCLTVTHVDALVLARSAFHHSINYRSVVVHGIAHDVTDPEEKRAALDALVDHVVPGRAADSRPANKKELAATAVIRLDLDEVSAKLRTGGVNDEPEDLALPHWAGLVPLRKGYDTPVPDADLTPGIEVPDYLAVR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
8 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
13 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
18 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
19 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
20 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
21 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
22 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
23 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
24 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
25 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
26 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
27 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
28 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
29 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
30 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
31 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
32 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
33 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
34 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
35 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
36 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
40 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
41 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
42 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
43 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
44 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
45 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
46 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
47 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
48 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
49 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
76 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
125 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
142 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
143 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
144 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
145 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
147 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
148 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
149 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
150 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
151 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
152 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
153 2643221548 Streptomyces sp. Root55 Isolate Unclassified
154 2643221578 Streptomyces sp. Root63 Isolate Unclassified
155 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
156 2643221647 Streptomyces sp. Root369 Isolate Unclassified
157 2643221670 Streptomyces sp. Root431 Isolate Unclassified
158 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
159 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
160 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
161 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
162 2643221714 Streptomyces sp. Root264 Isolate Unclassified
163 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
164 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
165 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
166 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
167 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
168 2808606448 Streptomyces sp. 193411 Isolate Unclassified
169 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
170 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
171 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
172 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
173 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
174 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
175 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
176 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
177 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
178 2867428634 Streptomyces sp. RP5T Isolate Unclassified
179 2867475112 Streptomyces sp. TM32 Isolate Unclassified
180 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
181 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
182 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
183 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
184 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
185 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
186 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
187 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
188 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
189 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
190 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
191 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
192 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
193 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
194 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
195 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
196 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
197 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
198 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
199 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
200 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
201 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
202 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
203 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
204 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
205 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
206 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
207 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
208 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
209 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.12
Metatranscriptomes 0
Isolates 21.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.94
Nodule 1.04
Rhizoplane 0
Rhizosphere 73.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0004880 3300045976 Bacteria 9160
2 rootH1_10098085 3300003316 Bacteria 2740
3 rootL2_10083662 3300003322 Bacteria 7614
4 JGI25160J50197_1018284 3300003354 Bacteria 2190
5 JGI25160J50197_1018548 3300003354 Bacteria 2163
6 JGI25160J50197_1020761 3300003354 Bacteria 1971
7 Ga0075368_10007595 3300006042 Bacteria 3828
8 Ga0075367_10002011 3300006178 Bacteria 9072
9 Ga0075370_10357269 3300006353 Bacteria 873
10 Ga0099826_10212010 3300006948 Bacteria 1051
11 Ga0105250_10011373 3300009092 Bacteria 3693
12 Ga0105246_10440109 3300011119 Bacteria 1093
13 Ga0182008_10002562 3300014497 Bacteria 11317
14 Ga0183367_1003 3300015688 Bacteria 814276
15 Ga0209758_1019263 3300025297 Bacteria 3299
16 Ga0207426_1000593 3300025302 Bacteria 47865
17 Ga0207426_1001376 3300025302 Bacteria 20591
18 Ga0207426_1006503 3300025302 Bacteria 5066
19 Ga0207647_10054887 3300025904 Bacteria 2450
20 Ga0207667_10359591 3300025949 Bacteria 1484
21 Ga0209813_10010010 3300027866 Bacteria 2440
22 Ga0307517_10002665 3300028786 Bacteria 28516
23 Ga0307515_10003056 3300028794 Bacteria 35446
24 Ga0307515_10119921 3300028794 Bacteria 2988
25 Ga0307511_10000457 3300030521 Bacteria 44027
26 Ga0307511_10036125 3300030521 Bacteria 4297
27 Ga0307512_10000296 3300030522 Bacteria 71852
28 Ga0307513_10050253 3300031456 Bacteria 4509
29 Ga0307513_10093267 3300031456 Bacteria 3061
30 Ga0307509_10009384 3300031507 Bacteria 12247
31 Ga0307509_10011654 3300031507 Bacteria 10621
32 Ga0307508_10003992 3300031616 Bacteria 14622
33 Ga0307508_10015038 3300031616 Bacteria 7054
34 Ga0307508_10231919 3300031616 Bacteria 1444
35 Ga0307508_10516562 3300031616 Bacteria 790
36 Ga0307514_10004354 3300031649 Bacteria 13048
37 Ga0307514_10021029 3300031649 Bacteria 5318
38 Ga0307516_10002132 3300031730 Bacteria 26795
39 Ga0307516_10007156 3300031730 Bacteria 12883
40 Ga0307518_10149746 3300031838 Bacteria 1616
41 Ga0307416_100028948 3300032002 Bacteria 4130
42 Ga0307507_10091755 3300033179 Bacteria 2597
43 Ga0307507_10145083 3300033179 Bacteria 1806
44 Ga0307510_10002844 3300033180 Bacteria 19883
45 Ga0395900_0581280 3300037418 Bacteria 1062
46 Ga0395898_0046771 3300037466 Bacteria 4249
47 Ga0395898_0084849 3300037466 Bacteria 3053
48 Ga0395898_0161254 3300037466 Bacteria 2145
49 Ga0395905_0343146 3300037471 Bacteria 1385
50 Ga0395901_0080352 3300038443 Bacteria 3404
51 Ga0439436_0010393 3300041404 Bacteria 2839
52 Ga0439436_0064275 3300041404 Bacteria 1025
53 Ga0451837_0998046 3300041494 Bacteria 1014
54 Ga0451853_1051951 3300041512 Bacteria 1806
55 Ga0451853_2341392 3300041512 Bacteria 1622
56 Ga0439433_0000748 3300041999 Bacteria 6398
57 Ga0439448_0024440 3300042005 Bacteria 1889
58 Ga0439449_0001762 3300042007 Bacteria 8505
59 Ga0439449_0015704 3300042007 Bacteria 2847
60 Ga0439455_0002397 3300042012 Bacteria 3397
61 Ga0439457_001800 3300042014 Bacteria 6329
62 Ga0439457_050093 3300042014 Bacteria 937
63 Ga0439462_0008501 3300042015 Bacteria 2590
64 Ga0450894_000421 3300042131 Bacteria 7270
65 Ga0450898_006687 3300042134 Bacteria 1777
66 Ga0450899_000761 3300042135 Bacteria 3672
67 Ga0450900_034826 3300042136 Bacteria 740
68 Ga0450903_000084 3300042138 Bacteria 19348
69 Ga0450903_006812 3300042138 Bacteria 1893
70 Ga0450906_003276 3300042145 Bacteria 3495
71 Ga0439458_0001478 3300042157 Bacteria 5915
72 Ga0439458_0007287 3300042157 Bacteria 2462
73 Ga0450901_001672 3300042533 Bacteria 2502
74 Ga0466972_0005374 3300044658 Bacteria 6416
75 Ga0466972_0048624 3300044658 Bacteria 2049
76 Ga0466965_0045060 3300044683 Bacteria 2181
77 Ga0466971_0024528 3300044719 Bacteria 2691
78 Ga0466970_0013927 3300044765 Bacteria 4126
79 Ga0466960_0035935 3300044901 Bacteria 2318
80 Ga0466958_0679956 3300045836 Bacteria 670
81 Ga0466967_0376106 3300045976 Bacteria 1378
82 Ga0495617_030315 3300046452 Bacteria 1818
83 Ga0495627_025582 3300046453 Bacteria 1913
84 Ga0495592_0023109 3300046454 Bacteria 4729
85 Ga0495592_0046741 3300046454 Bacteria 3226
86 Ga0495603_0002798 3300046455 Bacteria 10297
87 Ga0495603_0003343 3300046455 Bacteria 9550
88 Ga0495603_0016477 3300046455 Bacteria 4471
89 Ga0495603_0031299 3300046455 Bacteria 3202
90 Ga0495629_0003025 3300046459 Bacteria 12790
91 Ga0495629_0003961 3300046459 Bacteria 11134
92 Ga0495629_0020621 3300046459 Bacteria 4707
93 Ga0495629_0023342 3300046459 Bacteria 4407
94 Ga0495629_0028410 3300046459 Bacteria 3971
95 Ga0495629_0032017 3300046459 Bacteria 3723
96 Ga0495629_0220860 3300046459 Bacteria 1307
97 Ga0495638_0235522 3300046460 Bacteria 1016
98 Ga0495651_0005389 3300046462 Bacteria 9757
99 Ga0495580_0549627 3300046472 Bacteria 767
100 Ga0495582_0188136 3300046473 Bacteria 1177
101 Ga0495605_0016421 3300046474 Bacteria 4007
102 Ga0495639_0031665 3300046475 Bacteria 2355
103 Ga0495662_0000321 3300046476 Bacteria 20834
104 Ga0495662_0001428 3300046476 Bacteria 11824
105 Ga0495662_0006202 3300046476 Bacteria 5979
106 Ga0495662_0083319 3300046476 Bacteria 1556
107 Ga0495664_0000413 3300046477 Bacteria 20858
108 Ga0495584_0110048 3300046491 Bacteria 1394
109 Ga0495594_0000861 3300046499 Bacteria 15627
110 Ga0495594_0141737 3300046499 Bacteria 1363
111 Ga0495607_0038191 3300046501 Bacteria 2878
112 Ga0495606_0007043 3300046507 Bacteria 10188
113 Ga0495606_0030952 3300046507 Bacteria 3728
114 Ga0495610_0013846 3300046512 Bacteria 4768
115 Ga0495616_0025340 3300046513 Bacteria 3170
116 Ga0495620_0003673 3300046515 Bacteria 8763
117 Ga0495620_0028970 3300046515 Bacteria 2568
118 Ga0495628_0237984 3300046516 Bacteria 1362
119 Ga0495630_0026414 3300046517 Bacteria 4298
120 Ga0495631_0024936 3300046518 Bacteria 2757
121 Ga0495643_0003222 3300046522 Bacteria 12101
122 Ga0495648_0035527 3300046524 Bacteria 3230
123 Ga0495666_0006683 3300046526 Bacteria 5798
124 Ga0495666_0032961 3300046526 Bacteria 2533
125 Ga0495652_0023962 3300046529 Bacteria 5406
126 Ga0495652_0227780 3300046529 Bacteria 1396
127 Ga0495665_0175260 3300046531 Bacteria 1115
128 Ga0495640_0142816 3300046533 Bacteria 1542
129 Ga0495586_0042561 3300046535 Bacteria 2446
130 Ga0495587_0001474 3300046536 Bacteria 15693
131 Ga0495609_0015616 3300046538 Bacteria 3552
132 Ga0495597_0022452 3300046542 Bacteria 2927
133 Ga0495645_0019467 3300046543 Bacteria 4887
134 Ga0495622_0006104 3300046557 Bacteria 5598
135 Ga0495622_0007640 3300046557 Bacteria 5021
136 Ga0495622_0084384 3300046557 Bacteria 1461
137 Ga0495633_0175875 3300046558 Bacteria 986
138 Ga0495667_0121162 3300046559 Bacteria 1689
139 Ga0495668_0002754 3300046616 Bacteria 14047
140 Ga0495634_0006089 3300046642 Bacteria 9195
141 Ga0495634_0168485 3300046642 Bacteria 1377
142 Ga0495611_0090296 3300046648 Bacteria 1415
143 Ga0495635_0015836 3300046663 Bacteria 5266
144 Ga0495635_0184830 3300046663 Bacteria 1416
145 Ga0495588_0004885 3300046674 Bacteria 5944
146 Ga0495588_0095763 3300046674 Bacteria 1556
147 Ga0495588_0218198 3300046674 Bacteria 1007
148 Ga0495657_0004940 3300046675 Bacteria 10605
149 Ga0495657_0012134 3300046675 Bacteria 6409
150 Ga0495657_0015967 3300046675 Bacteria 5479
151 Ga0495658_0016634 3300046683 Bacteria 3786
152 Ga0495613_0001002 3300046689 Bacteria 21489
153 Ga0495613_0018557 3300046689 Bacteria 5186
154 Ga0495613_0038259 3300046689 Bacteria 3555
155 Ga0495613_0039403 3300046689 Bacteria 3503
156 Ga0495613_0135026 3300046689 Bacteria 1765
157 Ga0495624_0083043 3300046690 Bacteria 1982
158 Ga0495624_0092489 3300046690 Bacteria 1865
159 Ga0495671_0180409 3300046692 Bacteria 1026
160 Ga0495671_0233424 3300046692 Bacteria 889
161 Ga0495671_0282919 3300046692 Bacteria 799
162 Ga0495649_0044221 3300046694 Bacteria 2431
163 Ga0495649_0054804 3300046694 Bacteria 2155
164 Ga0495649_0127053 3300046694 Bacteria 1346
165 Ga0495589_0118019 3300046794 Bacteria 1278
166 Ga0495600_0006315 3300046809 Bacteria 7203
167 Ga0495600_0140381 3300046809 Bacteria 1568
168 Ga0495581_0003784 3300047315 Bacteria 8706
169 Ga0495581_0037306 3300047315 Bacteria 2812
170 Ga0495604_0006738 3300047317 Bacteria 9106
171 Ga0495604_0033579 3300047317 Bacteria 4061
172 Ga0495636_0023348 3300047318 Bacteria 2503
173 Ga0495636_0028006 3300047318 Bacteria 2296
174 Ga0495674_0189438 3300047319 Bacteria 1710
175 Ga0495672_0146175 3300047320 Bacteria 1230
176 Ga0495676_0000588 3300047321 Bacteria 30009
177 Ga0495676_0015293 3300047321 Bacteria 6837
178 Ga0495676_0071241 3300047321 Bacteria 2672
179 Ga0495676_0081457 3300047321 Bacteria 2453
180 Ga0495676_0114629 3300047321 Bacteria 1971
181 Ga0495680_0007677 3300047322 Bacteria 9850
182 Ga0495683_0096105 3300047323 Bacteria 1429
183 Ga0495687_001736 3300047443 Bacteria 19307
184 Ga0495687_005525 3300047443 Bacteria 8026
185 Ga0495677_0046726 3300047445 Bacteria 1589
186 Ga0495685_004734 3300047447 Bacteria 4416
187 Ga0495685_014107 3300047447 Bacteria 2712
188 Ga0495685_082328 3300047447 Bacteria 1071
189 Ga0495681_0001210 3300047470 Bacteria 19624
190 Ga0495681_0086974 3300047470 Bacteria 1386
191 Ga0495684_0070803 3300047471 Bacteria 2651
192 Ga0495686_0019771 3300047472 Bacteria 4496
193 Ga0495686_0312853 3300047472 Bacteria 863
194 Ga0495593_0000579 3300047673 Bacteria 20815
195 Ga0495602_0042115 3300048088 Bacteria 4163
196 Ga0495614_0005184 3300048089 Bacteria 5880
197 Ga0495614_0029173 3300048089 Bacteria 2374
198 Ga0495614_0104993 3300048089 Bacteria 1237
199 Ga0495626_0101887 3300048091 Bacteria 1251
200 Ga0496121_0401326 3300048924 Bacteria 898
201 Ga0501032_0302368 3300049569 Bacteria 1034
202 Ga0501033_0010901 3300049570 Bacteria 6969
203 Ga0501033_0061488 3300049570 Bacteria 2767
204 Ga0501034_0050331 3300049571 Bacteria 4202
205 Ga0501034_0403425 3300049571 Bacteria 1290
206 Ga0501036_0003122 3300049572 Bacteria 13222
207 Ga0501037_0074255 3300049573 Bacteria 2471
208 Ga0501038_0000698 3300049574 Bacteria 29884
209 Ga0501042_0045911 3300049578 Bacteria 3114
210 Ga0501047_0000191 3300049581 Bacteria 74396
211 Ga0501047_0075037 3300049581 Bacteria 3254
212 Ga0501070_0535776 3300049586 Bacteria 938
213 Ga0501035_0134744 3300049822 Bacteria 2151
214 Ga0501035_0472164 3300049822 Bacteria 1036
215 Ga0501044_0026567 3300049823 Bacteria 6128
216 Ga0501044_0039066 3300049823 Bacteria 4953
217 nmdc:mga06z11_3958_c1 3300050494 Bacteria 5775
218 nmdc:mga04h51_1637_c1 3300050495 Bacteria 5227
219 nmdc:mga07m45_142539_c1 3300050496 Bacteria 1388
220 Ga0500610_0056959 3300053079 Bacteria 2040
221 Ga0500640_039980 3300053095 Bacteria 2060
222 Ga0500553_103087 3300053101 Bacteria 1222
223 Ga0500560_023039 3300053107 Bacteria 1801
224 Ga0500600_0050980 3300053149 Bacteria 2348
225 Ga0500624_005876 3300053157 Bacteria 1646
226 2547409205 2547132111 Bacteria 8013147
227 2585297831 2582581312 Bacteria 7308206
228 2585310888 2582581313 Bacteria 10042643
229 2585316029 2582581314 Bacteria 11452267
230 2616701601 2616644814 Bacteria 11555299
231 2616905353 2616644941 Bacteria 8510691
232 2643764545 2643221548 Bacteria 8053412
233 2643905193 2643221578 Bacteria 9213798
234 2643942698 2643221587 Bacteria 7586415
235 2644264185 2643221647 Bacteria 10741251
236 2644385914 2643221670 Bacteria 6497041
237 2644403251 2643221673 Bacteria 9196637
238 2644430157 2643221677 Bacteria 7584031
239 2644438208 2643221678 Bacteria 9540101
240 2644458396 2643221682 Bacteria 6743283
241 2644629951 2643221714 Bacteria 9015452
242 2784586609 2784132148 Bacteria 8627943
243 2785366984 2784746768 Bacteria 10036182
244 2786668028 2786546132 Bacteria 10419719
245 2808847491 2808606359 Bacteria 9866990
246 2808918221 2808606375 Bacteria 9466072
247 2809230130 2808606448 Bacteria 8656184
248 2812360471 2811994879 Bacteria 9313447
249 2812482558 2811994917 Bacteria 7761064
250 2819699754 2818991463 Bacteria 7948711
251 2852641286 2852635781 Bacteria 8251373
252 2862289819 2862281513 Bacteria 9621493
253 2862290463 2862290372 Bacteria 7471434
254 2862383298 2862382967 Bacteria 10317375
255 2862508440 2862507626 Bacteria 9425308
256 2863407118 2863404153 Bacteria 9672205
257 2867437142 2867428634 Bacteria 9590268
258 2867477393 2867475112 Bacteria 6909112
259 2875392561 2875391855 Bacteria 7600475
260 2877683554 2877676314 Bacteria 9512378
261 2912722661 2912715099 Bacteria 9460473
262 2912726339 2912723979 Bacteria 8557534
263 2919474446 2919468124 Bacteria 9133025
264 2935394146 2935390628 Bacteria 7043367
265 2946052160 2946045630 Bacteria 8527308
266 2946065418 2946064051 Bacteria 8957905
267 2946073774 2946072368 Bacteria 8999607
268 2947231990 2947224130 Bacteria 9938529
269 2954388809 2954380949 Bacteria 10050426
270 2954674314 2954673503 Bacteria 9685905
271 2954689817 2954682443 Bacteria 9862841
272 2954699596 2954691527 Bacteria 10720516
273 2954702621 2954701450 Bacteria 10834262
274 2954718538 2954711539 Bacteria 10867210
275 2954728509 2954721474 Bacteria 10456478
276 2954733302 2954731030 Bacteria 10243860
277 2954747404 2954740390 Bacteria 10229294
278 2954752184 2954749733 Bacteria 10366972
279 2954766519 2954759201 Bacteria 9358192
280 2966604564 2966598605 Bacteria 7676064
281 2990063739 2990059506 Bacteria 9321252
282 2997451938 2997451912 Bacteria 8492419
283 3006498313 3006493962 Bacteria 8825450
284 8008561163 8008558824 Bacteria 10610750
285 8008580897 8008574985 Bacteria 7815457
286 8023630962 8023623736 Bacteria 8593882
287 8048409949 8048406513 Bacteria 8936924
288 8056832476 8056829672 Bacteria 9045328
289 Ga0466967_0004880
290 rootH1_10098085
291 rootL2_10083662
292 JGI25160J50197_1018284
293 JGI25160J50197_1018548
294 JGI25160J50197_1020761
295 Ga0075368_10007595
296 Ga0075367_10002011
297 Ga0075370_10357269
298 Ga0099826_10212010
299 Ga0105250_10011373
300 Ga0105246_10440109
301 Ga0182008_10002562
302 Ga0183367_1003
303 Ga0209758_1019263
304 Ga0207426_1000593
305 Ga0207426_1001376
306 Ga0207426_1006503
307 Ga0207647_10054887
308 Ga0207667_10359591
309 Ga0209813_10010010
310 Ga0307517_10002665
311 Ga0307515_10003056
312 Ga0307515_10119921
313 Ga0307511_10000457
314 Ga0307511_10036125
315 Ga0307512_10000296
316 Ga0307513_10050253
317 Ga0307513_10093267
318 Ga0307509_10009384
319 Ga0307509_10011654
320 Ga0307508_10003992
321 Ga0307508_10015038
322 Ga0307508_10231919
323 Ga0307508_10516562
324 Ga0307514_10004354
325 Ga0307514_10021029
326 Ga0307516_10002132
327 Ga0307516_10007156
328 Ga0307518_10149746
329 Ga0307416_100028948
330 Ga0307507_10091755
331 Ga0307507_10145083
332 Ga0307510_10002844
333 Ga0395900_0581280
334 Ga0395898_0046771
335 Ga0395898_0084849
336 Ga0395898_0161254
337 Ga0395905_0343146
338 Ga0395901_0080352
339 Ga0439436_0010393
340 Ga0439436_0064275
341 Ga0451837_0998046
342 Ga0451853_1051951
343 Ga0451853_2341392
344 Ga0439433_0000748
345 Ga0439448_0024440
346 Ga0439449_0001762
347 Ga0439449_0015704
348 Ga0439455_0002397
349 Ga0439457_001800
350 Ga0439457_050093
351 Ga0439462_0008501
352 Ga0450894_000421
353 Ga0450898_006687
354 Ga0450899_000761
355 Ga0450900_034826
356 Ga0450903_000084
357 Ga0450903_006812
358 Ga0450906_003276
359 Ga0439458_0001478
360 Ga0439458_0007287
361 Ga0450901_001672
362 Ga0466972_0005374
363 Ga0466972_0048624
364 Ga0466965_0045060
365 Ga0466971_0024528
366 Ga0466970_0013927
367 Ga0466960_0035935
368 Ga0466958_0679956
369 Ga0466967_0376106
370 Ga0495617_030315
371 Ga0495627_025582
372 Ga0495592_0023109
373 Ga0495592_0046741
374 Ga0495603_0002798
375 Ga0495603_0003343
376 Ga0495603_0016477
377 Ga0495603_0031299
378 Ga0495629_0003025
379 Ga0495629_0003961
380 Ga0495629_0020621
381 Ga0495629_0023342
382 Ga0495629_0028410
383 Ga0495629_0032017
384 Ga0495629_0220860
385 Ga0495638_0235522
386 Ga0495651_0005389
387 Ga0495580_0549627
388 Ga0495582_0188136
389 Ga0495605_0016421
390 Ga0495639_0031665
391 Ga0495662_0000321
392 Ga0495662_0001428
393 Ga0495662_0006202
394 Ga0495662_0083319
395 Ga0495664_0000413
396 Ga0495584_0110048
397 Ga0495594_0000861
398 Ga0495594_0141737
399 Ga0495607_0038191
400 Ga0495606_0007043
401 Ga0495606_0030952
402 Ga0495610_0013846
403 Ga0495616_0025340
404 Ga0495620_0003673
405 Ga0495620_0028970
406 Ga0495628_0237984
407 Ga0495630_0026414
408 Ga0495631_0024936
409 Ga0495643_0003222
410 Ga0495648_0035527
411 Ga0495666_0006683
412 Ga0495666_0032961
413 Ga0495652_0023962
414 Ga0495652_0227780
415 Ga0495665_0175260
416 Ga0495640_0142816
417 Ga0495586_0042561
418 Ga0495587_0001474
419 Ga0495609_0015616
420 Ga0495597_0022452
421 Ga0495645_0019467
422 Ga0495622_0006104
423 Ga0495622_0007640
424 Ga0495622_0084384
425 Ga0495633_0175875
426 Ga0495667_0121162
427 Ga0495668_0002754
428 Ga0495634_0006089
429 Ga0495634_0168485
430 Ga0495611_0090296
431 Ga0495635_0015836
432 Ga0495635_0184830
433 Ga0495588_0004885
434 Ga0495588_0095763
435 Ga0495588_0218198
436 Ga0495657_0004940
437 Ga0495657_0012134
438 Ga0495657_0015967
439 Ga0495658_0016634
440 Ga0495613_0001002
441 Ga0495613_0018557
442 Ga0495613_0038259
443 Ga0495613_0039403
444 Ga0495613_0135026
445 Ga0495624_0083043
446 Ga0495624_0092489
447 Ga0495671_0180409
448 Ga0495671_0233424
449 Ga0495671_0282919
450 Ga0495649_0044221
451 Ga0495649_0054804
452 Ga0495649_0127053
453 Ga0495589_0118019
454 Ga0495600_0006315
455 Ga0495600_0140381
456 Ga0495581_0003784
457 Ga0495581_0037306
458 Ga0495604_0006738
459 Ga0495604_0033579
460 Ga0495636_0023348
461 Ga0495636_0028006
462 Ga0495674_0189438
463 Ga0495672_0146175
464 Ga0495676_0000588
465 Ga0495676_0015293
466 Ga0495676_0071241
467 Ga0495676_0081457
468 Ga0495676_0114629
469 Ga0495680_0007677
470 Ga0495683_0096105
471 Ga0495687_001736
472 Ga0495687_005525
473 Ga0495677_0046726
474 Ga0495685_004734
475 Ga0495685_014107
476 Ga0495685_082328
477 Ga0495681_0001210
478 Ga0495681_0086974
479 Ga0495684_0070803
480 Ga0495686_0019771
481 Ga0495686_0312853
482 Ga0495593_0000579
483 Ga0495602_0042115
484 Ga0495614_0005184
485 Ga0495614_0029173
486 Ga0495614_0104993
487 Ga0495626_0101887
488 Ga0496121_0401326
489 Ga0501032_0302368
490 Ga0501033_0010901
491 Ga0501033_0061488
492 Ga0501034_0050331
493 Ga0501034_0403425
494 Ga0501036_0003122
495 Ga0501037_0074255
496 Ga0501038_0000698
497 Ga0501042_0045911
498 Ga0501047_0000191
499 Ga0501047_0075037
500 Ga0501070_0535776
501 Ga0501035_0134744
502 Ga0501035_0472164
503 Ga0501044_0026567
504 Ga0501044_0039066
505 nmdc:mga06z11_3958_c1
506 nmdc:mga04h51_1637_c1
507 nmdc:mga07m45_142539_c1
508 Ga0500610_0056959
509 Ga0500640_039980
510 Ga0500553_103087
511 Ga0500560_023039
512 Ga0500600_0050980
513 Ga0500624_005876
514 2547409205
515 2585297831
516 2585310888
517 2585316029
518 2616701601
519 2616905353
520 2643764545
521 2643905193
522 2643942698
523 2644264185
524 2644385914
525 2644403251
526 2644430157
527 2644438208
528 2644458396
529 2644629951
530 2784586609
531 2785366984
532 2786668028
533 2808847491
534 2808918221
535 2809230130
536 2812360471
537 2812482558
538 2819699754
539 2852641286
540 2862289819
541 2862290463
542 2862383298
543 2862508440
544 2863407118
545 2867437142
546 2867477393
547 2875392561
548 2877683554
549 2912722661
550 2912726339
551 2919474446
552 2935394146
553 2946052160
554 2946065418
555 2946073774
556 2947231990
557 2954388809
558 2954674314
559 2954689817
560 2954699596
561 2954702621
562 2954718538
563 2954728509
564 2954733302
565 2954747404
566 2954752184
567 2954766519
568 2966604564
569 2990063739
570 2997451938
571 3006498313
572 8008561163
573 8008580897
574 8023630962
575 8048409949
576 8056832476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

51

197

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ybn-assembly1.cif.gz_B structure of the fad and heme binding protein msmeg_4975 from mycobacterium smegmatis 0.8351 28 226
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8335 14 226
2fur-assembly1.cif.gz_B crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution 0.8161 33 227
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8126 14 226
2fg9-assembly1.cif.gz_A crystal structure of a putative 5-nitroimidazole antibiotic resistance protein (bt_3078) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution 0.8077 29 178
ID Description Score Start End Superfamily
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8405 28 226 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8223 33 227 2.30.110.10
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8073 28 226 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8071 32 180 2.30.110.10
2furB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7788 33 227 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1Q5GAA2-F1-model_v4 Flavin-nucleotide-binding protein 0.9067 30 226
AF-V7KNW3-F1-model_v4 deleted 0.9013 14 180
AF-A0A246RIT7-F1-model_v4 GNAT family N-acetyltransferase 0.8968 14 225 GO:0016747
AF-A0A1C6SMT9-F1-model_v4 Nitroimidazol reductase NimA, pyridoxamine 5'-phosphate oxidase superfamily 0.8913 14 224
AF-A0A6I3HDR7-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.891 15 226

Map