F388718

General Info

Members Datasets Scaffolds Average Seq Length
288 140 287 93

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000041|Ga0395901_0000041_13119_13406
Length 95
Sequence MAWRVTEPAEQRCWLCARPIGTRVESHHPVPKSRGGRETVPVHPICHRALHKGFTNKQLASTSLDQLRASAELAPFLGWIANKDPDFHAPTRGRR

Samples

Sample ID Description Type Environment
1 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
96 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
107 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 5.21
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10011720 3300001990 Bacteria 2868
2 JGI24735J21928_10026286 3300002067 Bacteria 1750
3 JGI24735J21928_10051804 3300002067 Unclassified 1184
4 JGI24738J21930_10009661 3300002075 Unclassified 2165
5 Ga0070658_10000584 3300005327 Bacteria 31661
6 Ga0070658_10051804 3300005327 Bacteria 3327
7 Ga0070658_10090835 3300005327 Bacteria 2516
8 Ga0070658_10177954 3300005327 Bacteria 1789
9 Ga0070658_10698447 3300005327 Bacteria 880
10 Ga0070658_10795789 3300005327 Bacteria 821
11 Ga0070683_100013630 3300005329 Bacteria 7096
12 Ga0070683_101046084 3300005329 Unclassified 784
13 Ga0070690_100060366 3300005330 Unclassified 2440
14 Ga0070670_100077242 3300005331 Unclassified 2861
15 Ga0070670_100124011 3300005331 Bacteria 2229
16 Ga0070666_10000216 3300005335 Bacteria 39574
17 Ga0070680_101692796 3300005336 Unclassified 548
18 Ga0070682_100017557 3300005337 Bacteria 4174
19 Ga0068868_100490744 3300005338 Unclassified 1074
20 Ga0070660_100000147 3300005339 Bacteria 45250
21 Ga0070660_100039280 3300005339 Bacteria 3597
22 Ga0070660_100070791 3300005339 Bacteria 2722
23 Ga0070660_100566167 3300005339 Bacteria 948
24 Ga0070660_100883021 3300005339 Unclassified 753
25 Ga0070661_100000213 3300005344 Bacteria 48218
26 Ga0070661_100219194 3300005344 Bacteria 1459
27 Ga0070661_100418177 3300005344 Bacteria 1062
28 Ga0070675_100889809 3300005354 Bacteria 816
29 Ga0070671_100000297 3300005355 Bacteria 33662
30 Ga0070671_100000902 3300005355 Bacteria 21648
31 Ga0070671_100030251 3300005355 Unclassified 4469
32 Ga0070673_100337165 3300005364 Unclassified 1335
33 Ga0070659_100000123 3300005366 Bacteria 58613
34 Ga0070659_100125710 3300005366 Bacteria 2080
35 Ga0070659_100292267 3300005366 Bacteria 1357
36 Ga0070659_100471828 3300005366 Bacteria 1067
37 Ga0070659_100523303 3300005366 Bacteria 1013
38 Ga0070667_100277873 3300005367 Unclassified 1503
39 Ga0070709_10709912 3300005434 Unclassified 783
40 Ga0070714_100810630 3300005435 Bacteria 907
41 Ga0070714_101241772 3300005435 Bacteria 727
42 Ga0070663_100003532 3300005455 Bacteria 9023
43 Ga0070662_100000060 3300005457 Bacteria 59430
44 Ga0070662_100164238 3300005457 Bacteria 1739
45 Ga0070662_100677721 3300005457 Unclassified 871
46 Ga0070681_10908376 3300005458 Bacteria 799
47 Ga0070681_11061991 3300005458 Unclassified 730
48 Ga0070684_100077127 3300005535 Bacteria 2943
49 Ga0070684_100384260 3300005535 Unclassified 1293
50 Ga0068853_100000277 3300005539 Bacteria 36116
51 Ga0070672_100074390 3300005543 Bacteria 2710
52 Ga0070696_100230455 3300005546 Bacteria 1393
53 Ga0070693_100011940 3300005547 Bacteria 4384
54 Ga0070665_100016998 3300005548 Bacteria 7294
55 Ga0068855_100000877 3300005563 Bacteria 37389
56 Ga0068855_100726204 3300005563 Bacteria 1061
57 Ga0068855_101599013 3300005563 Bacteria 667
58 Ga0070664_100000158 3300005564 Bacteria 46496
59 Ga0070664_100823076 3300005564 Bacteria 869
60 Ga0068857_100002884 3300005577 Bacteria 14149
61 Ga0068857_100010766 3300005577 Bacteria 7961
62 Ga0068854_100077362 3300005578 Bacteria 2448
63 Ga0068854_101444352 3300005578 Bacteria 623
64 Ga0068856_100000974 3300005614 Bacteria 30540
65 Ga0068856_101489029 3300005614 Bacteria 691
66 Ga0068852_100483189 3300005616 Unclassified 1231
67 Ga0068852_100647253 3300005616 Unclassified 1064
68 Ga0068864_100001662 3300005618 Bacteria 18314
69 Ga0068864_100013854 3300005618 Bacteria 6682
70 Ga0068851_10485250 3300005834 Bacteria 739
71 Ga0068851_10978024 3300005834 Bacteria 533
72 Ga0068863_100003448 3300005841 Bacteria 15593
73 Ga0068863_100057298 3300005841 Bacteria 3688
74 Ga0068858_100130166 3300005842 Bacteria 2359
75 Ga0068860_100750685 3300005843 Unclassified 987
76 Ga0068862_101432753 3300005844 Bacteria 695
77 Ga0081539_10007386 3300005985 Bacteria 10047
78 Ga0070717_10005714 3300006028 Bacteria 9098
79 Ga0075366_10216762 3300006195 Bacteria 1166
80 Ga0097621_100067944 3300006237 Unclassified 2938
81 Ga0075370_10272359 3300006353 Bacteria 1005
82 Ga0068871_100175766 3300006358 Unclassified 1838
83 Ga0068871_100557888 3300006358 Bacteria 1038
84 Ga0105241_10074714 3300009174 Unclassified 2640
85 Ga0105248_10000278 3300009177 Bacteria 60305
86 Ga0105248_10000902 3300009177 Bacteria 33207
87 Ga0105248_10004414 3300009177 Bacteria 15570
88 Ga0105238_10048319 3300009551 Bacteria 4289
89 Ga0157373_10008459 3300013100 Bacteria 7640
90 Ga0157373_10050472 3300013100 Bacteria 2962
91 Ga0157371_10021827 3300013102 Bacteria 4697
92 Ga0157371_10025940 3300013102 Bacteria 4264
93 Ga0157371_11209879 3300013102 Unclassified 582
94 Ga0157370_10347672 3300013104 Bacteria 1367
95 Ga0157370_11261180 3300013104 Bacteria 666
96 Ga0157369_10151482 3300013105 Unclassified 2451
97 Ga0157369_12153867 3300013105 Unclassified 565
98 Ga0157374_10038900 3300013296 Bacteria 4374
99 Ga0157374_10705466 3300013296 Unclassified 1022
100 Ga0157372_12460154 3300013307 Unclassified 598
101 Ga0163163_10009274 3300014325 Bacteria 8779
102 Ga0163163_10148404 3300014325 Bacteria 2389
103 Ga0163163_11622393 3300014325 Bacteria 708
104 Ga0157380_10071256 3300014326 Plasmid 2811
105 Ga0157379_10065791 3300014968 Bacteria 3241
106 Ga0207656_10274569 3300025321 Bacteria 830
107 Ga0207656_10650341 3300025321 Bacteria 539
108 Ga0207680_10037468 3300025903 Unclassified 2799
109 Ga0207647_10005987 3300025904 Bacteria 8859
110 Ga0207647_10028912 3300025904 Bacteria 3594
111 Ga0207705_10000295 3300025909 Bacteria 46532
112 Ga0207705_10043550 3300025909 Bacteria 3225
113 Ga0207705_10096861 3300025909 Bacteria 2166
114 Ga0207705_10099086 3300025909 Bacteria 2142
115 Ga0207705_10117157 3300025909 Bacteria 1973
116 Ga0207705_10218774 3300025909 Bacteria 1446
117 Ga0207707_10711189 3300025912 Unclassified 843
118 Ga0207707_10784203 3300025912 Bacteria 795
119 Ga0207657_10000334 3300025919 Bacteria 49890
120 Ga0207657_10081284 3300025919 Bacteria 2722
121 Ga0207657_10113628 3300025919 Unclassified 2234
122 Ga0207657_10154207 3300025919 Bacteria 1869
123 Ga0207657_10256031 3300025919 Bacteria 1394
124 Ga0207649_10000211 3300025920 Bacteria 48545
125 Ga0207649_10308159 3300025920 Bacteria 1160
126 Ga0207649_10731226 3300025920 Unclassified 769
127 Ga0207649_10851634 3300025920 Unclassified 713
128 Ga0207694_10047871 3300025924 Unclassified 3307
129 Ga0207650_10318250 3300025925 Unclassified 1274
130 Ga0207650_10341677 3300025925 Bacteria 1229
131 Ga0207659_10730904 3300025926 Bacteria 848
132 Ga0207664_10814134 3300025929 Bacteria 840
133 Ga0207664_11022783 3300025929 Unclassified 740
134 Ga0207644_10000090 3300025931 Bacteria 65122
135 Ga0207644_10056874 3300025931 Unclassified 2823
136 Ga0207690_10000182 3300025932 Bacteria 48302
137 Ga0207690_10818575 3300025932 Unclassified 770
138 Ga0207706_10001196 3300025933 Bacteria 26205
139 Ga0207706_10692573 3300025933 Unclassified 871
140 Ga0207665_10087736 3300025939 Bacteria 2151
141 Ga0207711_10000536 3300025941 Bacteria 38861
142 Ga0207711_10242053 3300025941 Unclassified 1654
143 Ga0207661_10001052 3300025944 Bacteria 18329
144 Ga0207661_10906321 3300025944 Unclassified 812
145 Ga0207679_10000293 3300025945 Bacteria 37744
146 Ga0207679_10571246 3300025945 Bacteria 1016
147 Ga0207667_10001632 3300025949 Bacteria 28244
148 Ga0207651_10173432 3300025960 Bacteria 1703
149 Ga0207640_10025452 3300025981 Bacteria 3583
150 Ga0207658_10005856 3300025986 Bacteria 8407
151 Ga0207677_11799799 3300026023 Unclassified 568
152 Ga0207639_10000154 3300026041 Bacteria 52098
153 Ga0207678_10005133 3300026067 Bacteria 11735
154 Ga0207678_10133187 3300026067 Bacteria 2121
155 Ga0207702_10000497 3300026078 Bacteria 44238
156 Ga0207641_10026088 3300026088 Bacteria 4821
157 Ga0207641_10120712 3300026088 Bacteria 2338
158 Ga0207676_10001011 3300026095 Bacteria 21577
159 Ga0207676_10030564 3300026095 Bacteria 4044
160 Ga0207674_10001796 3300026116 Bacteria 27331
161 Ga0207674_10006205 3300026116 Bacteria 14085
162 Ga0207674_11376136 3300026116 Bacteria 675
163 Ga0207698_10434136 3300026142 Unclassified 1264
164 Ga0207698_10756417 3300026142 Bacteria 971
165 Ga0209371_1050067 3300027312 Unclassified 805
166 Ga0268266_10029322 3300028379 Bacteria 4678
167 Ga0268264_10765490 3300028381 Unclassified 963
168 Ga0307411_11461598 3300032005 Bacteria 627
169 Ga0373928_0186153 3300035084 Unclassified 592
170 Ga0373929_0017119 3300035085 Unclassified 1428
171 Ga0373932_0062263 3300035112 Unclassified 1137
172 Ga0373962_0093696 3300035242 Bacteria 928
173 Ga0373931_0037397 3300035691 Unclassified 2534
174 Ga0395899_0050191 3300037312 Unclassified 3099
175 Ga0395899_0067355 3300037312 Bacteria 2627
176 Ga0395899_0287762 3300037312 Unclassified 1116
177 Ga0395899_0330419 3300037312 Unclassified 1024
178 Ga0395899_0981538 3300037312 Bacteria 510
179 Ga0395900_0003925 3300037418 Bacteria 15869
180 Ga0395900_0013853 3300037418 Bacteria 8228
181 Ga0395900_0036502 3300037418 Bacteria 5067
182 Ga0395900_0077236 3300037418 Bacteria 3421
183 Ga0395900_0086819 3300037418 Bacteria 3215
184 Ga0395900_0096865 3300037418 Bacteria 3031
185 Ga0395900_0123537 3300037418 Bacteria 2655
186 Ga0395900_0136428 3300037418 Bacteria 2514
187 Ga0395900_0155593 3300037418 Bacteria 2335
188 Ga0395900_0280127 3300037418 Bacteria 1659
189 Ga0395900_0827450 3300037418 Bacteria 852
190 Ga0395900_1214541 3300037418 Bacteria 669
191 Ga0395900_1302438 3300037418 Unclassified 640
192 Ga0395900_1877047 3300037418 Bacteria 510
193 Ga0395898_0047674 3300037466 Bacteria 4203
194 Ga0395898_0057591 3300037466 Bacteria 3786
195 Ga0395898_0063597 3300037466 Bacteria 3580
196 Ga0395898_0124426 3300037466 Unclassified 2470
197 Ga0395898_0254147 3300037466 Bacteria 1676
198 Ga0395898_0262000 3300037466 Bacteria 1649
199 Ga0395898_0339502 3300037466 Unclassified 1432
200 Ga0395898_1816810 3300037466 Unclassified 530
201 Ga0395905_0001046 3300037471 Bacteria 35041
202 Ga0395905_0001314 3300037471 Bacteria 30557
203 Ga0395905_0002916 3300037471 Bacteria 18646
204 Ga0395905_0023392 3300037471 Bacteria 5839
205 Ga0395905_0027103 3300037471 Bacteria 5403
206 Ga0395905_0037421 3300037471 Bacteria 4555
207 Ga0395905_0039515 3300037471 Bacteria 4426
208 Ga0395905_0069578 3300037471 Bacteria 3297
209 Ga0395905_0109732 3300037471 Bacteria 2590
210 Ga0395905_0110509 3300037471 Unclassified 2581
211 Ga0395905_0128564 3300037471 Bacteria 2382
212 Ga0395905_0204602 3300037471 Unclassified 1850
213 Ga0395905_0256450 3300037471 Bacteria 1633
214 Ga0395905_0272907 3300037471 Bacteria 1577
215 Ga0395905_0321497 3300037471 Bacteria 1437
216 Ga0395905_0969690 3300037471 Bacteria 753
217 Ga0395905_1006835 3300037471 Bacteria 736
218 Ga0395901_0000041 3300038443 Bacteria 202314
219 Ga0395901_0057306 3300038443 Bacteria 4052
220 Ga0395901_0117258 3300038443 Bacteria 2797
221 Ga0395901_0117811 3300038443 Bacteria 2790
222 Ga0395901_0131273 3300038443 Bacteria 2632
223 Ga0395901_0154855 3300038443 Bacteria 2407
224 Ga0395901_0179328 3300038443 Bacteria 2222
225 Ga0395901_0522968 3300038443 Bacteria 1205
226 Ga0395901_0673283 3300038443 Unclassified 1035
227 Ga0395901_0677700 3300038443 Unclassified 1031
228 Ga0395901_1109595 3300038443 Unclassified 761
229 Ga0395901_1409189 3300038443 Bacteria 655
230 Ga0395901_1504125 3300038443 Bacteria 629
231 Ga0395901_1741865 3300038443 Bacteria 573
232 Ga0395901_1977600 3300038443 Bacteria 529
233 Ga0439448_0002922 3300042005 Bacteria 4686
234 Ga0439455_0002157 3300042012 Bacteria 3521
235 Ga0439458_0001420 3300042157 Bacteria 6046
236 Ga0439458_0003433 3300042157 Bacteria 3707
237 Ga0466972_0154950 3300044658 Bacteria 1076
238 Ga0466972_0193067 3300044658 Bacteria 954
239 Ga0466965_0257596 3300044683 Bacteria 937
240 Ga0466966_0816033 3300044684 Bacteria 562
241 Ga0466961_0035469 3300044693 Bacteria 3203
242 Ga0466963_0089721 3300044694 Bacteria 2092
243 Ga0466963_0903536 3300044694 Bacteria 622
244 Ga0466964_0386736 3300044706 Bacteria 727
245 Ga0466964_0836240 3300044706 Bacteria 522
246 Ga0466971_0074545 3300044719 Bacteria 1543
247 Ga0466968_0024348 3300044735 Bacteria 2472
248 Ga0466970_0137922 3300044765 Bacteria 1342
249 Ga0466957_0058847 3300044842 Bacteria 2354
250 Ga0466957_0138230 3300044842 Bacteria 1567
251 Ga0466957_0460050 3300044842 Bacteria 878
252 Ga0466957_0737675 3300044842 Bacteria 697
253 Ga0466960_0506070 3300044901 Bacteria 708
254 Ga0466960_0639559 3300044901 Bacteria 634
255 Ga0466959_0142112 3300045049 Bacteria 1695
256 Ga0466958_0120644 3300045836 Bacteria 1641
257 Ga0466958_0153972 3300045836 Bacteria 1450
258 Ga0466967_0017051 3300045976 Bacteria 5750
259 Ga0466967_0137012 3300045976 Bacteria 2277
260 Ga0466967_0206364 3300045976 Bacteria 1863
261 Ga0466967_0390071 3300045976 Bacteria 1353
262 Ga0466967_1065109 3300045976 Bacteria 805
263 Ga0466967_1162997 3300045976 Bacteria 769
264 Ga0495642_0013351 3300046528 Bacteria 3175
265 Ga0495645_0895289 3300046543 Unclassified 527
266 Ga0495669_0060008 3300046684 Bacteria 1719
267 Ga0496100_0273286 3300048903 Bacteria 1257
268 Ga0496101_0033849 3300048904 Bacteria 3607
269 Ga0496104_0428261 3300048907 Bacteria 1235
270 Ga0496104_0652120 3300048907 Bacteria 962
271 Ga0496105_0497111 3300048908 Bacteria 958
272 Ga0496106_0004765 3300048909 Bacteria 10027
273 Ga0496107_0006715 3300048910 Bacteria 7924
274 Ga0496107_0046332 3300048910 Unclassified 3130
275 Ga0496108_0007935 3300048911 Bacteria 8605
276 Ga0496108_1369372 3300048911 Unclassified 593
277 Ga0496109_0002316 3300048912 Bacteria 15857
278 Ga0496110_0005189 3300048913 Bacteria 10191
279 Ga0496111_0005686 3300048914 Bacteria 8033
280 Ga0496112_0003660 3300048915 Bacteria 12811
281 Ga0496113_0205996 3300048916 Bacteria 1564
282 nmdc:mga03683_202002_c1 3300050489 Bacteria 912
283 nmdc:mga00v17_759002_c1 3300050491 Bacteria 620
284 nmdc:mga07m45_491375_c1 3300050496 Bacteria 711
285 Ga0466962_0307794 3300061719 Bacteria 785
286 Ga0466962_0309594 3300061719 Bacteria 782
287 Ga0466962_0369437 3300061719 Bacteria 716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1977600 Ga0395901_1977600_31_297 82
2 3300005985 Ga0081539_10007386 Ga0081539_100073866 84
3 3300037418 Ga0395900_1214541 Ga0395900_1214541_278_544 85
4 3300037471 Ga0395905_0969690 Ga0395905_0969690_216_482 85
5 3300037471 Ga0395905_0002916 Ga0395905_0002916_8838_9107 86
6 3300045976 Ga0466967_1065109 Ga0466967_1065109_204_479 87
7 3300037418 Ga0395900_0003925 Ga0395900_0003925_15205_15501 88
8 3300037418 Ga0395900_0077236 Ga0395900_0077236_1425_1712 88
9 3300037466 Ga0395898_0063597 Ga0395898_0063597_90_386 88
10 3300037466 Ga0395898_1816810 Ga0395898_1816810_90_386 88
11 3300037471 Ga0395905_0001046 Ga0395905_0001046_62_358 88
12 3300038443 Ga0395901_0000041 Ga0395901_0000041_13119_13406 88
13 3300038443 Ga0395901_0117258 Ga0395901_0117258_1375_1671 88
14 3300038443 Ga0395901_1741865 Ga0395901_1741865_109_384 88
15 3300045976 Ga0466967_0206364 Ga0466967_0206364_1228_1506 89
16 3300061719 Ga0466962_0369437 Ga0466962_0369437_59_328 89
17 3300001990 JGI24737J22298_10011720 JGI24737J22298_100117203 90
18 3300002067 JGI24735J21928_10026286 JGI24735J21928_100262862 90
19 3300002067 JGI24735J21928_10051804 JGI24735J21928_100518042 90
20 3300002075 JGI24738J21930_10009661 JGI24738J21930_100096614 90
21 3300005327 Ga0070658_10000584 Ga0070658_1000058410 90
22 3300005327 Ga0070658_10051804 Ga0070658_100518043 90
23 3300005327 Ga0070658_10090835 Ga0070658_100908352 90
24 3300005327 Ga0070658_10177954 Ga0070658_101779543 90
25 3300005327 Ga0070658_10698447 Ga0070658_106984472 90
26 3300005327 Ga0070658_10795789 Ga0070658_107957893 90
27 3300005329 Ga0070683_100013630 Ga0070683_1000136306 90
28 3300005329 Ga0070683_101046084 Ga0070683_1010460842 90
29 3300005330 Ga0070690_100060366 Ga0070690_1000603662 90
30 3300005331 Ga0070670_100077242 Ga0070670_1000772421 90
31 3300005331 Ga0070670_100124011 Ga0070670_1001240111 90
32 3300005335 Ga0070666_10000216 Ga0070666_1000021616 90
33 3300005336 Ga0070680_101692796 Ga0070680_1016927961 90
34 3300005337 Ga0070682_100017557 Ga0070682_1000175572 90
35 3300005338 Ga0068868_100490744 Ga0068868_1004907441 90
36 3300005339 Ga0070660_100000147 Ga0070660_10000014734 90
37 3300005339 Ga0070660_100039280 Ga0070660_1000392803 90
38 3300005339 Ga0070660_100070791 Ga0070660_1000707914 90
39 3300005339 Ga0070660_100566167 Ga0070660_1005661672 90
40 3300005339 Ga0070660_100883021 Ga0070660_1008830212 90
41 3300005344 Ga0070661_100000213 Ga0070661_10000021329 90
42 3300005344 Ga0070661_100219194 Ga0070661_1002191942 90
43 3300005344 Ga0070661_100418177 Ga0070661_1004181772 90
44 3300005354 Ga0070675_100889809 Ga0070675_1008898091 90
45 3300005355 Ga0070671_100000297 Ga0070671_10000029712 90
46 3300005355 Ga0070671_100000902 Ga0070671_1000009028 90
47 3300005355 Ga0070671_100030251 Ga0070671_1000302516 90
48 3300005364 Ga0070673_100337165 Ga0070673_1003371651 90
49 3300005366 Ga0070659_100000123 Ga0070659_10000012334 90
50 3300005366 Ga0070659_100125710 Ga0070659_1001257103 90
51 3300005366 Ga0070659_100292267 Ga0070659_1002922673 90
52 3300005366 Ga0070659_100471828 Ga0070659_1004718281 90
53 3300005366 Ga0070659_100523303 Ga0070659_1005233032 90
54 3300005367 Ga0070667_100277873 Ga0070667_1002778731 90
55 3300005434 Ga0070709_10709912 Ga0070709_107099122 90
56 3300005435 Ga0070714_100810630 Ga0070714_1008106302 90
57 3300005435 Ga0070714_101241772 Ga0070714_1012417722 90
58 3300005455 Ga0070663_100003532 Ga0070663_1000035327 90
59 3300005457 Ga0070662_100000060 Ga0070662_10000006034 90
60 3300005457 Ga0070662_100164238 Ga0070662_1001642383 90
61 3300005457 Ga0070662_100677721 Ga0070662_1006777211 90
62 3300005458 Ga0070681_10908376 Ga0070681_109083762 90
63 3300005458 Ga0070681_11061991 Ga0070681_110619912 90
64 3300005535 Ga0070684_100077127 Ga0070684_1000771274 90
65 3300005535 Ga0070684_100384260 Ga0070684_1003842602 90
66 3300005539 Ga0068853_100000277 Ga0068853_10000027716 90
67 3300005543 Ga0070672_100074390 Ga0070672_1000743903 90
68 3300005546 Ga0070696_100230455 Ga0070696_1002304552 90
69 3300005547 Ga0070693_100011940 Ga0070693_1000119406 90
70 3300005548 Ga0070665_100016998 Ga0070665_1000169987 90
71 3300005563 Ga0068855_100000877 Ga0068855_10000087724 90
72 3300005563 Ga0068855_100726204 Ga0068855_1007262042 90
73 3300005563 Ga0068855_101599013 Ga0068855_1015990132 90
74 3300005564 Ga0070664_100000158 Ga0070664_10000015834 90
75 3300005564 Ga0070664_100823076 Ga0070664_1008230762 90
76 3300005577 Ga0068857_100002884 Ga0068857_10000288413 90
77 3300005577 Ga0068857_100010766 Ga0068857_1000107668 90
78 3300005578 Ga0068854_100077362 Ga0068854_1000773622 90
79 3300005578 Ga0068854_101444352 Ga0068854_1014443522 90
80 3300005614 Ga0068856_100000974 Ga0068856_10000097426 90
81 3300005614 Ga0068856_101489029 Ga0068856_1014890292 90
82 3300005616 Ga0068852_100483189 Ga0068852_1004831892 90
83 3300005616 Ga0068852_100647253 Ga0068852_1006472532 90
84 3300005618 Ga0068864_100001662 Ga0068864_1000016624 90
85 3300005618 Ga0068864_100013854 Ga0068864_1000138546 90
86 3300005834 Ga0068851_10485250 Ga0068851_104852502 90
87 3300005834 Ga0068851_10978024 Ga0068851_109780241 90
88 3300005841 Ga0068863_100003448 Ga0068863_1000034482 90
89 3300005841 Ga0068863_100057298 Ga0068863_1000572985 90
90 3300005842 Ga0068858_100130166 Ga0068858_1001301662 90
91 3300005843 Ga0068860_100750685 Ga0068860_1007506852 90
92 3300005844 Ga0068862_101432753 Ga0068862_1014327532 90
93 3300006028 Ga0070717_10005714 Ga0070717_100057142 90
94 3300006195 Ga0075366_10216762 Ga0075366_102167622 90
95 3300006237 Ga0097621_100067944 Ga0097621_1000679443 90
96 3300006353 Ga0075370_10272359 Ga0075370_102723592 90
97 3300006358 Ga0068871_100175766 Ga0068871_1001757663 90
98 3300006358 Ga0068871_100557888 Ga0068871_1005578882 90
99 3300009174 Ga0105241_10074714 Ga0105241_100747143 90
100 3300009177 Ga0105248_10000278 Ga0105248_1000027829 90
101 3300009177 Ga0105248_10000902 Ga0105248_100009027 90
102 3300009177 Ga0105248_10004414 Ga0105248_1000441411 90
103 3300009551 Ga0105238_10048319 Ga0105238_100483194 90
104 3300013100 Ga0157373_10008459 Ga0157373_100084597 90
105 3300013100 Ga0157373_10050472 Ga0157373_100504723 90
106 3300013102 Ga0157371_10021827 Ga0157371_100218274 90
107 3300013102 Ga0157371_10025940 Ga0157371_100259403 90
108 3300013102 Ga0157371_11209879 Ga0157371_112098792 90
109 3300013104 Ga0157370_10347672 Ga0157370_103476721 90
110 3300013104 Ga0157370_11261180 Ga0157370_112611801 90
111 3300013105 Ga0157369_10151482 Ga0157369_101514823 90
112 3300013105 Ga0157369_12153867 Ga0157369_121538671 90
113 3300013296 Ga0157374_10038900 Ga0157374_100389001 90
114 3300013296 Ga0157374_10705466 Ga0157374_107054662 90
115 3300013307 Ga0157372_12460154 Ga0157372_124601541 90
116 3300014325 Ga0163163_10009274 Ga0163163_100092741 90
117 3300014325 Ga0163163_10148404 Ga0163163_101484043 90
118 3300014325 Ga0163163_11622393 Ga0163163_116223932 90
119 3300014326 Ga0157380_10071256 Ga0157380_100712562 90
120 3300014968 Ga0157379_10065791 Ga0157379_100657914 90
121 3300025321 Ga0207656_10274569 Ga0207656_102745692 90
122 3300025321 Ga0207656_10650341 Ga0207656_106503412 90
123 3300025903 Ga0207680_10037468 Ga0207680_100374682 90
124 3300025904 Ga0207647_10005987 Ga0207647_100059874 90
125 3300025904 Ga0207647_10028912 Ga0207647_100289123 90
126 3300025909 Ga0207705_10000295 Ga0207705_1000029534 90
127 3300025909 Ga0207705_10043550 Ga0207705_100435505 90
128 3300025909 Ga0207705_10096861 Ga0207705_100968613 90
129 3300025909 Ga0207705_10099086 Ga0207705_100990864 90
130 3300025909 Ga0207705_10117157 Ga0207705_101171571 90
131 3300025909 Ga0207705_10218774 Ga0207705_102187743 90
132 3300025912 Ga0207707_10711189 Ga0207707_107111892 90
133 3300025912 Ga0207707_10784203 Ga0207707_107842031 90
134 3300025919 Ga0207657_10000334 Ga0207657_1000033434 90
135 3300025919 Ga0207657_10081284 Ga0207657_100812842 90
136 3300025919 Ga0207657_10113628 Ga0207657_101136282 90
137 3300025919 Ga0207657_10154207 Ga0207657_101542073 90
138 3300025919 Ga0207657_10256031 Ga0207657_102560313 90
139 3300025920 Ga0207649_10000211 Ga0207649_1000021128 90
140 3300025920 Ga0207649_10308159 Ga0207649_103081592 90
141 3300025920 Ga0207649_10731226 Ga0207649_107312262 90
142 3300025920 Ga0207649_10851634 Ga0207649_108516342 90
143 3300025924 Ga0207694_10047871 Ga0207694_100478715 90
144 3300025925 Ga0207650_10318250 Ga0207650_103182503 90
145 3300025925 Ga0207650_10341677 Ga0207650_103416772 90
146 3300025926 Ga0207659_10730904 Ga0207659_107309042 90
147 3300025929 Ga0207664_10814134 Ga0207664_108141341 90
148 3300025929 Ga0207664_11022783 Ga0207664_110227831 90
149 3300025931 Ga0207644_10000090 Ga0207644_1000009031 90
150 3300025931 Ga0207644_10056874 Ga0207644_100568743 90
151 3300025932 Ga0207690_10000182 Ga0207690_1000018224 90
152 3300025932 Ga0207690_10818575 Ga0207690_108185751 90
153 3300025933 Ga0207706_10001196 Ga0207706_1000119619 90
154 3300025933 Ga0207706_10692573 Ga0207706_106925732 90
155 3300025939 Ga0207665_10087736 Ga0207665_100877362 90
156 3300025941 Ga0207711_10000536 Ga0207711_1000053623 90
157 3300025941 Ga0207711_10242053 Ga0207711_102420532 90
158 3300025944 Ga0207661_10001052 Ga0207661_100010524 90
159 3300025944 Ga0207661_10906321 Ga0207661_109063211 90
160 3300025945 Ga0207679_10000293 Ga0207679_1000029329 90
161 3300025945 Ga0207679_10571246 Ga0207679_105712462 90
162 3300025949 Ga0207667_10001632 Ga0207667_1000163214 90
163 3300025960 Ga0207651_10173432 Ga0207651_101734322 90
164 3300025981 Ga0207640_10025452 Ga0207640_100254522 90
165 3300025986 Ga0207658_10005856 Ga0207658_100058562 90
166 3300026023 Ga0207677_11799799 Ga0207677_117997992 90
167 3300026041 Ga0207639_10000154 Ga0207639_1000015431 90
168 3300026067 Ga0207678_10005133 Ga0207678_100051333 90
169 3300026067 Ga0207678_10133187 Ga0207678_101331873 90
170 3300026078 Ga0207702_10000497 Ga0207702_1000049734 90
171 3300026088 Ga0207641_10026088 Ga0207641_100260882 90
172 3300026088 Ga0207641_10120712 Ga0207641_101207121 90
173 3300026095 Ga0207676_10001011 Ga0207676_1000101121 90
174 3300026095 Ga0207676_10030564 Ga0207676_100305646 90
175 3300026116 Ga0207674_10001796 Ga0207674_1000179616 90
176 3300026116 Ga0207674_10006205 Ga0207674_1000620510 90
177 3300026116 Ga0207674_11376136 Ga0207674_113761362 90
178 3300026142 Ga0207698_10434136 Ga0207698_104341362 90
179 3300026142 Ga0207698_10756417 Ga0207698_107564172 90
180 3300027312 Ga0209371_1050067 Ga0209371_10500671 90
181 3300028379 Ga0268266_10029322 Ga0268266_100293224 90
182 3300028381 Ga0268264_10765490 Ga0268264_107654902 90
183 3300032005 Ga0307411_11461598 Ga0307411_114615982 90
184 3300035084 Ga0373928_0186153 Ga0373928_0186153_190_471 90
185 3300035085 Ga0373929_0017119 Ga0373929_0017119_890_1171 90
186 3300035112 Ga0373932_0062263 Ga0373932_0062263_363_644 90
187 3300035242 Ga0373962_0093696 Ga0373962_0093696_102_383 90
188 3300035691 Ga0373931_0037397 Ga0373931_0037397_1803_2084 90
189 3300037312 Ga0395899_0050191 Ga0395899_0050191_2376_2657 90
190 3300037312 Ga0395899_0067355 Ga0395899_0067355_546_827 90
191 3300037312 Ga0395899_0287762 Ga0395899_0287762_42_323 90
192 3300037312 Ga0395899_0330419 Ga0395899_0330419_322_603 90
193 3300037312 Ga0395899_0981538 Ga0395899_0981538_179_457 90
194 3300037418 Ga0395900_0013853 Ga0395900_0013853_580_861 90
195 3300037418 Ga0395900_0036502 Ga0395900_0036502_1228_1509 90
196 3300037418 Ga0395900_0086819 Ga0395900_0086819_1676_1957 90
197 3300037418 Ga0395900_0096865 Ga0395900_0096865_2038_2319 90
198 3300037418 Ga0395900_0123537 Ga0395900_0123537_1337_1615 90
199 3300037418 Ga0395900_0136428 Ga0395900_0136428_1035_1316 90
200 3300037418 Ga0395900_0155593 Ga0395900_0155593_381_659 90
201 3300037418 Ga0395900_0280127 Ga0395900_0280127_175_447 90
202 3300037418 Ga0395900_0827450 Ga0395900_0827450_303_584 90
203 3300037418 Ga0395900_1302438 Ga0395900_1302438_217_498 90
204 3300037418 Ga0395900_1877047 Ga0395900_1877047_78_359 90
205 3300037466 Ga0395898_0047674 Ga0395898_0047674_1288_1569 90
206 3300037466 Ga0395898_0057591 Ga0395898_0057591_385_666 90
207 3300037466 Ga0395898_0124426 Ga0395898_0124426_137_418 90
208 3300037466 Ga0395898_0254147 Ga0395898_0254147_46_327 90
209 3300037466 Ga0395898_0262000 Ga0395898_0262000_223_501 90
210 3300037466 Ga0395898_0339502 Ga0395898_0339502_311_583 90
211 3300037471 Ga0395905_0001314 Ga0395905_0001314_114_398 90
212 3300037471 Ga0395905_0023392 Ga0395905_0023392_308_589 90
213 3300037471 Ga0395905_0027103 Ga0395905_0027103_2847_3128 90
214 3300037471 Ga0395905_0037421 Ga0395905_0037421_3029_3310 90
215 3300037471 Ga0395905_0039515 Ga0395905_0039515_3927_4208 90
216 3300037471 Ga0395905_0069578 Ga0395905_0069578_1396_1677 90
217 3300037471 Ga0395905_0109732 Ga0395905_0109732_1514_1786 90
218 3300037471 Ga0395905_0110509 Ga0395905_0110509_1670_1951 90
219 3300037471 Ga0395905_0128564 Ga0395905_0128564_1600_1881 90
220 3300037471 Ga0395905_0204602 Ga0395905_0204602_864_1151 90
221 3300037471 Ga0395905_0256450 Ga0395905_0256450_587_868 90
222 3300037471 Ga0395905_0272907 Ga0395905_0272907_14_295 90
223 3300037471 Ga0395905_0321497 Ga0395905_0321497_463_744 90
224 3300037471 Ga0395905_1006835 Ga0395905_1006835_306_587 90
225 3300038443 Ga0395901_0057306 Ga0395901_0057306_787_1068 90
226 3300038443 Ga0395901_0117811 Ga0395901_0117811_1385_1666 90
227 3300038443 Ga0395901_0131273 Ga0395901_0131273_700_981 90
228 3300038443 Ga0395901_0154855 Ga0395901_0154855_622_894 90
229 3300038443 Ga0395901_0179328 Ga0395901_0179328_1635_1916 90
230 3300038443 Ga0395901_0522968 Ga0395901_0522968_655_936 90
231 3300038443 Ga0395901_0673283 Ga0395901_0673283_519_806 90
232 3300038443 Ga0395901_0677700 Ga0395901_0677700_85_366 90
233 3300038443 Ga0395901_1109595 Ga0395901_1109595_257_538 90
234 3300038443 Ga0395901_1409189 Ga0395901_1409189_77_361 90
235 3300038443 Ga0395901_1504125 Ga0395901_1504125_152_430 90
236 3300042005 Ga0439448_0002922 Ga0439448_0002922_1053_1334 90
237 3300042012 Ga0439455_0002157 Ga0439455_0002157_191_472 90
238 3300042157 Ga0439458_0001420 Ga0439458_0001420_4316_4597 90
239 3300042157 Ga0439458_0003433 Ga0439458_0003433_133_414 90
240 3300044658 Ga0466972_0154950 Ga0466972_0154950_494_775 90
241 3300044658 Ga0466972_0193067 Ga0466972_0193067_155_442 90
242 3300044683 Ga0466965_0257596 Ga0466965_0257596_382_663 90
243 3300044684 Ga0466966_0816033 Ga0466966_0816033_184_465 90
244 3300044693 Ga0466961_0035469 Ga0466961_0035469_2688_2969 90
245 3300044694 Ga0466963_0089721 Ga0466963_0089721_988_1269 90
246 3300044694 Ga0466963_0903536 Ga0466963_0903536_114_395 90
247 3300044706 Ga0466964_0386736 Ga0466964_0386736_113_394 90
248 3300044706 Ga0466964_0836240 Ga0466964_0836240_126_407 90
249 3300044719 Ga0466971_0074545 Ga0466971_0074545_437_718 90
250 3300044735 Ga0466968_0024348 Ga0466968_0024348_504_785 90
251 3300044765 Ga0466970_0137922 Ga0466970_0137922_727_1008 90
252 3300044842 Ga0466957_0058847 Ga0466957_0058847_797_1108 90
253 3300044842 Ga0466957_0138230 Ga0466957_0138230_1044_1325 90
254 3300044842 Ga0466957_0460050 Ga0466957_0460050_152_436 90
255 3300044842 Ga0466957_0737675 Ga0466957_0737675_162_443 90
256 3300044901 Ga0466960_0506070 Ga0466960_0506070_240_527 90
257 3300044901 Ga0466960_0639559 Ga0466960_0639559_182_469 90
258 3300045049 Ga0466959_0142112 Ga0466959_0142112_1294_1575 90
259 3300045836 Ga0466958_0120644 Ga0466958_0120644_583_864 90
260 3300045836 Ga0466958_0153972 Ga0466958_0153972_398_679 90
261 3300045976 Ga0466967_0017051 Ga0466967_0017051_1780_2061 90
262 3300045976 Ga0466967_0137012 Ga0466967_0137012_366_647 90
263 3300045976 Ga0466967_0390071 Ga0466967_0390071_134_409 90
264 3300045976 Ga0466967_1162997 Ga0466967_1162997_215_526 90
265 3300046528 Ga0495642_0013351 Ga0495642_0013351_1399_1680 90
266 3300046543 Ga0495645_0895289 Ga0495645_0895289_140_421 90
267 3300046684 Ga0495669_0060008 Ga0495669_0060008_1070_1351 90
268 3300048903 Ga0496100_0273286 Ga0496100_0273286_291_572 90
269 3300048904 Ga0496101_0033849 Ga0496101_0033849_90_371 90
270 3300048907 Ga0496104_0428261 Ga0496104_0428261_403_684 90
271 3300048907 Ga0496104_0652120 Ga0496104_0652120_278_559 90
272 3300048908 Ga0496105_0497111 Ga0496105_0497111_627_908 90
273 3300048909 Ga0496106_0004765 Ga0496106_0004765_1973_2254 90
274 3300048910 Ga0496107_0006715 Ga0496107_0006715_2389_2670 90
275 3300048910 Ga0496107_0046332 Ga0496107_0046332_199_480 90
276 3300048911 Ga0496108_0007935 Ga0496108_0007935_2250_2531 90
277 3300048911 Ga0496108_1369372 Ga0496108_1369372_62_343 90
278 3300048912 Ga0496109_0002316 Ga0496109_0002316_13492_13773 90
279 3300048913 Ga0496110_0005189 Ga0496110_0005189_2266_2547 90
280 3300048914 Ga0496111_0005686 Ga0496111_0005686_2153_2434 90
281 3300048915 Ga0496112_0003660 Ga0496112_0003660_11058_11339 90
282 3300048916 Ga0496113_0205996 Ga0496113_0205996_827_1108 90
283 3300050489 nmdc:mga03683_202002_c1 nmdc:mga03683_202002_c1_20_301 90
284 3300050491 nmdc:mga00v17_759002_c1 nmdc:mga00v17_759002_c1_83_361 90
285 3300050496 nmdc:mga07m45_491375_c1 nmdc:mga07m45_491375_c1_257_538 90
286 3300061719 Ga0466962_0307794 Ga0466962_0307794_404_685 90
287 3300061719 Ga0466962_0309594 Ga0466962_0309594_61_372 90
288 iso_pu_bacteria 2837678835 2837680842 90

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vek-assembly2.cif.gz_F both zn fingers of gata1 bound to palindromic dna recognition site, p1 crystal form 0.7191 1 46
5din-assembly1.cif.gz_A structural basis for the indispensable role of a unique zinc finger motif in lnx2 ubiquitination 0.7081 3 47
6yxe-assembly1.cif.gz_A-3 structure of the trim69 ring domain 0.6952 3 45
3dfx-assembly1.cif.gz_B opposite gata dna binding 0.6866 1 46
5vo0-assembly1.cif.gz_A structure of a traf6-ubc13~ub complex 0.6829 1 45
ID Description Score Start End Superfamily
af_Q86I44_1_66_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.76 5 41 2.10.110.10
4hc7A02 Alpha Beta;2-Layer Sandwich;Erythroid Transcription Factor GATA-1; Chain A;Erythroid Transcription Factor GATA-1, subunit A 0.7259 2 46 3.30.50.10
4hc7B01 Alpha Beta;2-Layer Sandwich;Erythroid Transcription Factor GATA-1; Chain A;Erythroid Transcription Factor GATA-1, subunit A 0.7162 1 46 3.30.50.10
4hc7B02 Alpha Beta;2-Layer Sandwich;Erythroid Transcription Factor GATA-1; Chain A;Erythroid Transcription Factor GATA-1, subunit A 0.7161 4 46 3.30.50.10
af_Q8INQ9_139_209_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.7006 5 41 2.10.110.10
ID Description Score Start End GO Terms
AF-A0A3D2LDS4-F1-model_v4 deleted 0.9716 3 65
AF-A0A1C7D7W0-F1-model_v4 Uncharacterized protein 0.951 1 87
AF-A0A7X1F5D8-F1-model_v4 HNH endonuclease 0.947 2 90 GO:0004519
AF-A0A2D8AXG0-F1-model_v4 HNH endonuclease 0.9463 1 87 GO:0004519
AF-A0A845AVP7-F1-model_v4 HNH endonuclease 0.942 4 87 GO:0004519

Feature Viewer

pLDDT pTM Quality
86.57 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map