F388656

General Info

Members Datasets Scaffolds Average Seq Length
288 152 576 124

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001857|Ga0265338_1000185713
Length 148
Sequence VGYDNILSSIVSARLGLAEVLIFKVNMPKIAIVEDDLAIAQMYRLKFEAEGYKVELAENGKLGLMLCEEMKPDILLLDLMMPEMNGDEMLEKMRKTDWGKDTKVIILTNVGEQEAPDNIKKLNIEDYVVKAEMTPRQVADLVKSKLEG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
143 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
147 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
148 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
151 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
152 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0
Rhizoplane 0.35
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10001857 3300028800 Bacteria 33176
2 JGI24736J21556_1000104 3300001904 Bacteria 14046
3 JGI24737J22298_10040560 3300001990 Bacteria 1428
4 Ga0070658_10000248 3300005327 Bacteria 47854
5 Ga0070658_10049543 3300005327 Bacteria 3403
6 Ga0070683_100060400 3300005329 Bacteria 3523
7 Ga0070683_100116271 3300005329 Bacteria 2525
8 Ga0068869_101687069 3300005334 Unclassified 565
9 Ga0070666_10000503 3300005335 Bacteria 23536
10 Ga0070666_11232757 3300005335 Bacteria 557
11 Ga0070680_100267810 3300005336 Bacteria 1446
12 Ga0070680_100747166 3300005336 Bacteria 842
13 Ga0070680_101917963 3300005336 Unclassified 513
14 Ga0070682_100003285 3300005337 Bacteria 8968
15 Ga0070682_100502229 3300005337 Bacteria 940
16 Ga0070661_101609342 3300005344 Unclassified 549
17 Ga0070668_100769644 3300005347 Bacteria 853
18 Ga0070674_100001749 3300005356 Bacteria 11775
19 Ga0070674_100005879 3300005356 Bacteria 7133
20 Ga0070688_101542133 3300005365 Unclassified 541
21 Ga0070659_100206061 3300005366 Bacteria 1620
22 Ga0070667_100174744 3300005367 Bacteria 1898
23 Ga0070667_100395379 3300005367 Bacteria 1257
24 Ga0070667_100832926 3300005367 Eukaryota 857
25 Ga0070714_100000977 3300005435 Bacteria 20432
26 Ga0070713_100148171 3300005436 Bacteria 2085
27 Ga0070681_10149092 3300005458 Unclassified 2266
28 Ga0070681_10667813 3300005458 Bacteria 954
29 Ga0068867_100408255 3300005459 Bacteria 1147
30 Ga0070685_10097890 3300005466 Bacteria 1786
31 Ga0070685_11046801 3300005466 Unclassified 614
32 Ga0070679_100006318 3300005530 Bacteria 11032
33 Ga0070679_100031763 3300005530 Bacteria 5220
34 Ga0070679_100061630 3300005530 Unclassified 3739
35 Ga0070679_100114242 3300005530 Bacteria 2685
36 Ga0070679_100142968 3300005530 Bacteria 2371
37 Ga0070679_100453419 3300005530 Bacteria 1227
38 Ga0070684_100048945 3300005535 Bacteria 3668
39 Ga0070684_101089687 3300005535 Unclassified 750
40 Ga0068853_100730804 3300005539 Bacteria 945
41 Ga0070696_101414301 3300005546 Bacteria 593
42 Ga0070665_100484660 3300005548 Unclassified 1247
43 Ga0070665_100534604 3300005548 Bacteria 1184
44 Ga0068855_100011475 3300005563 Bacteria 10708
45 Ga0068855_100032577 3300005563 Bacteria 6221
46 Ga0068855_100085367 3300005563 Unclassified 3653
47 Ga0068855_100628508 3300005563 Bacteria 1155
48 Ga0068857_100077617 3300005577 Bacteria 2964
49 Ga0068857_100304481 3300005577 Bacteria 1470
50 Ga0068857_100311098 3300005577 Bacteria 1453
51 Ga0068857_100701886 3300005577 Unclassified 961
52 Ga0068854_100139925 3300005578 Bacteria 1856
53 Ga0068856_100079489 3300005614 Bacteria 3252
54 Ga0068859_100832470 3300005617 Bacteria 1009
55 Ga0068861_100824749 3300005719 Unclassified 872
56 Ga0068863_100328629 3300005841 Bacteria 1486
57 Ga0068858_100009704 3300005842 Bacteria 9170
58 Ga0081539_10013607 3300005985 Bacteria 6118
59 Ga0081539_10072181 3300005985 Bacteria 1846
60 Ga0075365_10249468 3300006038 Bacteria 1247
61 Ga0075363_100979346 3300006048 Bacteria 520
62 Ga0075364_10000204 3300006051 Bacteria 27752
63 Ga0075369_10010832 3300006186 Bacteria 3573
64 Ga0075366_10039395 3300006195 Unclassified 2794
65 Ga0068865_100909196 3300006881 Bacteria 766
66 Ga0097620_100832660 3300006931 Bacteria 1009
67 Ga0105240_10000048 3300009093 Bacteria 237451
68 Ga0105240_10034057 3300009093 Bacteria 6575
69 Ga0105240_10161206 3300009093 Bacteria 2664
70 Ga0105240_10482571 3300009093 Unclassified 1381
71 Ga0105240_10559380 3300009093 Bacteria 1264
72 Ga0105240_12259324 3300009093 Unclassified 564
73 Ga0105245_10000001 3300009098 Bacteria 939270
74 Ga0105245_10029275 3300009098 Bacteria 4864
75 Ga0105245_10073807 3300009098 Bacteria 3103
76 Ga0105245_11402770 3300009098 Unclassified 749
77 Ga0105241_10109832 3300009174 Unclassified 2206
78 Ga0105241_10382003 3300009174 Bacteria 1231
79 Ga0105241_10812516 3300009174 Bacteria 862
80 Ga0105241_10882272 3300009174 Bacteria 829
81 Ga0105241_11038499 3300009174 Bacteria 769
82 Ga0105242_10000001 3300009176 Bacteria 574039
83 Ga0105248_10044353 3300009177 Bacteria 4987
84 Ga0105237_10520282 3300009545 Bacteria 1196
85 Ga0105237_11487722 3300009545 Bacteria 684
86 Ga0105238_10000350 3300009551 Bacteria 49662
87 Ga0105238_10375021 3300009551 Bacteria 1414
88 Ga0105239_10049337 3300010375 Unclassified 4616
89 Ga0105239_10072162 3300010375 Unclassified 3795
90 Ga0105239_10456644 3300010375 Bacteria 1450
91 Ga0105239_10881947 3300010375 Bacteria 1027
92 Ga0157370_10288288 3300013104 Bacteria 1516
93 Ga0157370_10426833 3300013104 Bacteria 1219
94 Ga0157370_10767853 3300013104 Bacteria 878
95 Ga0157370_11739497 3300013104 Bacteria 560
96 Ga0157370_12057915 3300013104 Bacteria 512
97 Ga0157369_10054303 3300013105 Bacteria 4327
98 Ga0157369_10266040 3300013105 Bacteria 1788
99 Ga0157369_10713711 3300013105 Unclassified 1032
100 Ga0157374_10013242 3300013296 Bacteria 7196
101 Ga0157374_10039380 3300013296 Bacteria 4349
102 Ga0157374_10293247 3300013296 Bacteria 1608
103 Ga0157378_10657180 3300013297 Bacteria 1064
104 Ga0157372_10048840 3300013307 Bacteria 4703
105 Ga0157372_10109725 3300013307 Bacteria 3160
106 Ga0157372_10125138 3300013307 Unclassified 2955
107 Ga0157372_10339465 3300013307 Bacteria 1750
108 Ga0157372_11430475 3300013307 Bacteria 797
109 Ga0157372_11623813 3300013307 Unclassified 744
110 Ga0163163_11941870 3300014325 Unclassified 648
111 Ga0207680_10000351 3300025903 Bacteria 22143
112 Ga0207680_10087376 3300025903 Bacteria 1974
113 Ga0207647_10000032 3300025904 Bacteria 103110
114 Ga0207647_10015595 3300025904 Bacteria 5204
115 Ga0207705_10000011 3300025909 Bacteria 517768
116 Ga0207705_10010486 3300025909 Bacteria 6739
117 Ga0207705_10038543 3300025909 Bacteria 3422
118 Ga0207705_10346847 3300025909 Bacteria 1143
119 Ga0207707_10051898 3300025912 Bacteria 3571
120 Ga0207707_10610136 3300025912 Bacteria 923
121 Ga0207695_10001072 3300025913 Bacteria 47825
122 Ga0207695_10290324 3300025913 Bacteria 1528
123 Ga0207695_10375680 3300025913 Unclassified 1307
124 Ga0207695_10592186 3300025913 Unclassified 990
125 Ga0207695_11458916 3300025913 Unclassified 564
126 Ga0207660_10001420 3300025917 Bacteria 16075
127 Ga0207660_10149854 3300025917 Bacteria 1791
128 Ga0207660_10248018 3300025917 Bacteria 1405
129 Ga0207657_10002676 3300025919 Bacteria 19217
130 Ga0207657_10023399 3300025919 Bacteria 5752
131 Ga0207657_10028218 3300025919 Bacteria 5123
132 Ga0207652_10018749 3300025921 Bacteria 5679
133 Ga0207652_10301390 3300025921 Bacteria 1446
134 Ga0207652_10398721 3300025921 Bacteria 1241
135 Ga0207652_10758881 3300025921 Bacteria 863
136 Ga0207694_10002997 3300025924 Bacteria 13542
137 Ga0207687_10000001 3300025927 Bacteria 1130810
138 Ga0207687_10000004 3300025927 Bacteria 841177
139 Ga0207687_10074306 3300025927 Bacteria 2436
140 Ga0207687_10150464 3300025927 Bacteria 1775
141 Ga0207687_11437872 3300025927 Unclassified 592
142 Ga0207700_10038362 3300025928 Bacteria 3477
143 Ga0207664_10003604 3300025929 Bacteria 10364
144 Ga0207690_10098801 3300025932 Bacteria 2080
145 Ga0207669_10009073 3300025937 Bacteria 4714
146 Ga0207661_10049986 3300025944 Bacteria 3330
147 Ga0207661_10095330 3300025944 Bacteria 2488
148 Ga0207661_10438592 3300025944 Bacteria 1188
149 Ga0207667_10000196 3300025949 Bacteria 88101
150 Ga0207667_10035489 3300025949 Bacteria 5349
151 Ga0207667_10046041 3300025949 Bacteria 4619
152 Ga0207667_10311250 3300025949 Bacteria 1609
153 Ga0207667_10655405 3300025949 Bacteria 1055
154 Ga0207651_10602351 3300025960 Eukaryota 960
155 Ga0207668_10703753 3300025972 Bacteria 888
156 Ga0207658_10012332 3300025986 Bacteria 5835
157 Ga0207703_10006173 3300026035 Bacteria 9587
158 Ga0207639_10039168 3300026041 Unclassified 3530
159 Ga0207639_10073324 3300026041 Bacteria 2683
160 Ga0207641_10632337 3300026088 Bacteria 1050
161 Ga0207676_11733072 3300026095 Bacteria 623
162 Ga0207674_10007972 3300026116 Bacteria 12289
163 Ga0207674_10398376 3300026116 Bacteria 1330
164 Ga0207674_10497730 3300026116 Unclassified 1178
165 Ga0207698_10016659 3300026142 Bacteria 4964
166 Ga0209970_1086290 3300027614 Bacteria 593
167 Ga0209998_10021983 3300027717 Bacteria 1373
168 Ga0268266_10408015 3300028379 Bacteria 1286
169 Ga0268264_10268792 3300028381 Unclassified 1592
170 Ga0265337_1000303 3300028556 Bacteria 26144
171 Ga0265337_1000428 3300028556 Bacteria 22332
172 Ga0265326_10000970 3300028558 Bacteria 10382
173 Ga0265326_10005333 3300028558 Bacteria 4053
174 Ga0265326_10007971 3300028558 Bacteria 3220
175 Ga0265319_1004058 3300028563 Bacteria 7386
176 Ga0265319_1033604 3300028563 Bacteria 1770
177 Ga0265319_1057891 3300028563 Bacteria 1263
178 Ga0265319_1150811 3300028563 Bacteria 719
179 Ga0265334_10000253 3300028573 Bacteria 30536
180 Ga0265334_10000327 3300028573 Bacteria 25674
181 Ga0265334_10005766 3300028573 Bacteria 5394
182 Ga0265334_10017672 3300028573 Bacteria 2942
183 Ga0265318_10017289 3300028577 Bacteria 2962
184 Ga0265323_10035895 3300028653 Bacteria 1825
185 Ga0265322_10073300 3300028654 Unclassified 971
186 Ga0265338_10000003 3300028800 Bacteria 733923
187 Ga0265338_10000181 3300028800 Bacteria 117792
188 Ga0265338_10000451 3300028800 Bacteria 73276
189 Ga0265338_10001917 3300028800 Bacteria 32469
190 Ga0265338_10002114 3300028800 Bacteria 30617
191 Ga0265338_10003575 3300028800 Bacteria 21708
192 Ga0265338_10009095 3300028800 Bacteria 11939
193 Ga0265338_10052114 3300028800 Bacteria 3677
194 Ga0265338_10057585 3300028800 Unclassified 3437
195 Ga0265338_10176096 3300028800 Bacteria 1635
196 Ga0265338_10238188 3300028800 Bacteria 1349
197 Ga0265324_10003016 3300029957 Bacteria 8227
198 Ga0265324_10005602 3300029957 Bacteria 5391
199 Ga0265324_10011033 3300029957 Bacteria 3457
200 Ga0265324_10075501 3300029957 Bacteria 1147
201 Ga0265330_10061390 3300031235 Bacteria 1635
202 Ga0265332_10003154 3300031238 Bacteria 8027
203 Ga0265332_10347272 3300031238 Unclassified 612
204 Ga0265328_10042374 3300031239 Bacteria 1675
205 Ga0265328_10341500 3300031239 Bacteria 582
206 Ga0265320_10003258 3300031240 Bacteria 10972
207 Ga0265325_10003849 3300031241 Bacteria 9645
208 Ga0265329_10047455 3300031242 Bacteria 1371
209 Ga0265340_10000330 3300031247 Bacteria 25147
210 Ga0265340_10330614 3300031247 Bacteria 674
211 Ga0265339_10021678 3300031249 Bacteria 3732
212 Ga0265339_10072159 3300031249 Bacteria 1837
213 Ga0265339_10177787 3300031249 Bacteria 1061
214 Ga0265339_10254221 3300031249 Unclassified 849
215 Ga0265331_10134321 3300031250 Bacteria 1127
216 Ga0265327_10002241 3300031251 Bacteria 20944
217 Ga0265327_10010848 3300031251 Bacteria 6349
218 Ga0265327_10012449 3300031251 Bacteria 5739
219 Ga0265316_10003430 3300031344 Bacteria 16032
220 Ga0265316_10009458 3300031344 Bacteria 8977
221 Ga0265316_10076365 3300031344 Bacteria 2574
222 Ga0265316_10759182 3300031344 Bacteria 681
223 Ga0265316_10834390 3300031344 Bacteria 645
224 Ga0265313_10008209 3300031595 Bacteria 6976
225 Ga0265313_10026090 3300031595 Bacteria 3085
226 Ga0265314_10009965 3300031711 Bacteria 7967
227 Ga0265314_10186361 3300031711 Bacteria 1238
228 Ga0265314_10255052 3300031711 Bacteria 1005
229 Ga0265314_10417875 3300031711 Unclassified 721
230 Ga0265342_10025911 3300031712 Bacteria 3681
231 Ga0265342_10089395 3300031712 Bacteria 1767
232 Ga0265342_10387324 3300031712 Unclassified 723
233 Ga0373932_0083420 3300035112 Bacteria 1013
234 Ga0395900_0092059 3300037418 Unclassified 3115
235 Ga0395898_0513339 3300037466 Unclassified 1140
236 Ga0395905_0001783 3300037471 Bacteria 24979
237 Ga0395901_0065472 3300038443 Bacteria 3784
238 Ga0436365_1596550 3300039437 Bacteria 1171
239 Ga0495583_0301718 3300046506 Bacteria 636
240 Ga0495670_0447041 3300046691 Unclassified 700
241 Ga0495660_0166929 3300046810 Unclassified 1075
242 Ga0495680_0599582 3300047322 Bacteria 737
243 Ga0496100_0019836 3300048903 Bacteria 4021
244 Ga0501031_0001506 3300049568 Bacteria 14511
245 Ga0501032_0009081 3300049569 Bacteria 7217
246 Ga0501033_0048217 3300049570 Unclassified 3164
247 Ga0501034_0000982 3300049571 Bacteria 40974
248 Ga0501034_0018974 3300049571 Bacteria 7046
249 Ga0501036_0009517 3300049572 Bacteria 7994
250 Ga0501036_0025432 3300049572 Unclassified 4993
251 Ga0501037_0000031 3300049573 Bacteria 133137
252 Ga0501037_0194999 3300049573 Unclassified 1433
253 Ga0501038_0053950 3300049574 Bacteria 3458
254 Ga0501039_0548695 3300049575 Unclassified 907
255 Ga0501043_0003606 3300049579 Bacteria 12713
256 Ga0501046_0000059 3300049580 Bacteria 126801
257 Ga0501047_0000032 3300049581 Bacteria 208294
258 Ga0501047_0000057 3300049581 Bacteria 140059
259 Ga0501048_0019380 3300049582 Bacteria 4992
260 Ga0501048_0712803 3300049582 Bacteria 720
261 Ga0501069_0675641 3300049585 Bacteria 622
262 Ga0501070_0028501 3300049586 Bacteria 4684
263 Ga0501070_0425009 3300049586 Unclassified 1073
264 Ga0501074_0683177 3300049590 Bacteria 725
265 Ga0501080_0738002 3300049742 Bacteria 867
266 Ga0501035_0000005 3300049822 Bacteria 392980
267 Ga0501035_0001138 3300049822 Bacteria 27818
268 Ga0501044_0043257 3300049823 Bacteria 4681
269 nmdc:mga03n38_899757_c1 3300050490 Bacteria 520
270 nmdc:mga00v17_167_c1 3300050491 Bacteria 27786
271 nmdc:mga0yw44_223871_c1 3300050492 Bacteria 1247
272 nmdc:mga0yw44_3145_c1 3300050492 Bacteria 7248
273 nmdc:mga06z11_746258_c1 3300050494 Unclassified 596
274 nmdc:mga07m45_149761_c1 3300050496 Bacteria 1353
275 nmdc:mga0sz30_10316_c2 3300050516 Unclassified 1445
276 nmdc:mga0sz30_136593_c1 3300050516 Bacteria 1082
277 Ga0500643_000070 3300053087 Bacteria 115371
278 Ga0500583_0020010 3300053092 Bacteria 2755
279 Ga0500651_0000017 3300053093 Bacteria 156318
280 Ga0500651_0001380 3300053093 Bacteria 12163
281 Ga0500562_000001 3300053108 Bacteria 1178987
282 Ga0500614_002808 3300053123 Bacteria 3833
283 Ga0500628_000259 3300053129 Bacteria 10181
284 Ga0500655_045227 3300053133 Unclassified 869
285 Ga0500568_0153832 3300053139 Bacteria 850
286 Ga0500589_012998 3300053147 Bacteria 3658
287 Ga0500570_000004 3300053724 Bacteria 133101
288 Ga0500611_008227 3300053727 Bacteria 1604
289 Ga0265338_10001857
290 JGI24736J21556_1000104
291 JGI24737J22298_10040560
292 Ga0070658_10000248
293 Ga0070658_10049543
294 Ga0070683_100060400
295 Ga0070683_100116271
296 Ga0068869_101687069
297 Ga0070666_10000503
298 Ga0070666_11232757
299 Ga0070680_100267810
300 Ga0070680_100747166
301 Ga0070680_101917963
302 Ga0070682_100003285
303 Ga0070682_100502229
304 Ga0070661_101609342
305 Ga0070668_100769644
306 Ga0070674_100001749
307 Ga0070674_100005879
308 Ga0070688_101542133
309 Ga0070659_100206061
310 Ga0070667_100174744
311 Ga0070667_100395379
312 Ga0070667_100832926
313 Ga0070714_100000977
314 Ga0070713_100148171
315 Ga0070681_10149092
316 Ga0070681_10667813
317 Ga0068867_100408255
318 Ga0070685_10097890
319 Ga0070685_11046801
320 Ga0070679_100006318
321 Ga0070679_100031763
322 Ga0070679_100061630
323 Ga0070679_100114242
324 Ga0070679_100142968
325 Ga0070679_100453419
326 Ga0070684_100048945
327 Ga0070684_101089687
328 Ga0068853_100730804
329 Ga0070696_101414301
330 Ga0070665_100484660
331 Ga0070665_100534604
332 Ga0068855_100011475
333 Ga0068855_100032577
334 Ga0068855_100085367
335 Ga0068855_100628508
336 Ga0068857_100077617
337 Ga0068857_100304481
338 Ga0068857_100311098
339 Ga0068857_100701886
340 Ga0068854_100139925
341 Ga0068856_100079489
342 Ga0068859_100832470
343 Ga0068861_100824749
344 Ga0068863_100328629
345 Ga0068858_100009704
346 Ga0081539_10013607
347 Ga0081539_10072181
348 Ga0075365_10249468
349 Ga0075363_100979346
350 Ga0075364_10000204
351 Ga0075369_10010832
352 Ga0075366_10039395
353 Ga0068865_100909196
354 Ga0097620_100832660
355 Ga0105240_10000048
356 Ga0105240_10034057
357 Ga0105240_10161206
358 Ga0105240_10482571
359 Ga0105240_10559380
360 Ga0105240_12259324
361 Ga0105245_10000001
362 Ga0105245_10029275
363 Ga0105245_10073807
364 Ga0105245_11402770
365 Ga0105241_10109832
366 Ga0105241_10382003
367 Ga0105241_10812516
368 Ga0105241_10882272
369 Ga0105241_11038499
370 Ga0105242_10000001
371 Ga0105248_10044353
372 Ga0105237_10520282
373 Ga0105237_11487722
374 Ga0105238_10000350
375 Ga0105238_10375021
376 Ga0105239_10049337
377 Ga0105239_10072162
378 Ga0105239_10456644
379 Ga0105239_10881947
380 Ga0157370_10288288
381 Ga0157370_10426833
382 Ga0157370_10767853
383 Ga0157370_11739497
384 Ga0157370_12057915
385 Ga0157369_10054303
386 Ga0157369_10266040
387 Ga0157369_10713711
388 Ga0157374_10013242
389 Ga0157374_10039380
390 Ga0157374_10293247
391 Ga0157378_10657180
392 Ga0157372_10048840
393 Ga0157372_10109725
394 Ga0157372_10125138
395 Ga0157372_10339465
396 Ga0157372_11430475
397 Ga0157372_11623813
398 Ga0163163_11941870
399 Ga0207680_10000351
400 Ga0207680_10087376
401 Ga0207647_10000032
402 Ga0207647_10015595
403 Ga0207705_10000011
404 Ga0207705_10010486
405 Ga0207705_10038543
406 Ga0207705_10346847
407 Ga0207707_10051898
408 Ga0207707_10610136
409 Ga0207695_10001072
410 Ga0207695_10290324
411 Ga0207695_10375680
412 Ga0207695_10592186
413 Ga0207695_11458916
414 Ga0207660_10001420
415 Ga0207660_10149854
416 Ga0207660_10248018
417 Ga0207657_10002676
418 Ga0207657_10023399
419 Ga0207657_10028218
420 Ga0207652_10018749
421 Ga0207652_10301390
422 Ga0207652_10398721
423 Ga0207652_10758881
424 Ga0207694_10002997
425 Ga0207687_10000001
426 Ga0207687_10000004
427 Ga0207687_10074306
428 Ga0207687_10150464
429 Ga0207687_11437872
430 Ga0207700_10038362
431 Ga0207664_10003604
432 Ga0207690_10098801
433 Ga0207669_10009073
434 Ga0207661_10049986
435 Ga0207661_10095330
436 Ga0207661_10438592
437 Ga0207667_10000196
438 Ga0207667_10035489
439 Ga0207667_10046041
440 Ga0207667_10311250
441 Ga0207667_10655405
442 Ga0207651_10602351
443 Ga0207668_10703753
444 Ga0207658_10012332
445 Ga0207703_10006173
446 Ga0207639_10039168
447 Ga0207639_10073324
448 Ga0207641_10632337
449 Ga0207676_11733072
450 Ga0207674_10007972
451 Ga0207674_10398376
452 Ga0207674_10497730
453 Ga0207698_10016659
454 Ga0209970_1086290
455 Ga0209998_10021983
456 Ga0268266_10408015
457 Ga0268264_10268792
458 Ga0265337_1000303
459 Ga0265337_1000428
460 Ga0265326_10000970
461 Ga0265326_10005333
462 Ga0265326_10007971
463 Ga0265319_1004058
464 Ga0265319_1033604
465 Ga0265319_1057891
466 Ga0265319_1150811
467 Ga0265334_10000253
468 Ga0265334_10000327
469 Ga0265334_10005766
470 Ga0265334_10017672
471 Ga0265318_10017289
472 Ga0265323_10035895
473 Ga0265322_10073300
474 Ga0265338_10000003
475 Ga0265338_10000181
476 Ga0265338_10000451
477 Ga0265338_10001917
478 Ga0265338_10002114
479 Ga0265338_10003575
480 Ga0265338_10009095
481 Ga0265338_10052114
482 Ga0265338_10057585
483 Ga0265338_10176096
484 Ga0265338_10238188
485 Ga0265324_10003016
486 Ga0265324_10005602
487 Ga0265324_10011033
488 Ga0265324_10075501
489 Ga0265330_10061390
490 Ga0265332_10003154
491 Ga0265332_10347272
492 Ga0265328_10042374
493 Ga0265328_10341500
494 Ga0265320_10003258
495 Ga0265325_10003849
496 Ga0265329_10047455
497 Ga0265340_10000330
498 Ga0265340_10330614
499 Ga0265339_10021678
500 Ga0265339_10072159
501 Ga0265339_10177787
502 Ga0265339_10254221
503 Ga0265331_10134321
504 Ga0265327_10002241
505 Ga0265327_10010848
506 Ga0265327_10012449
507 Ga0265316_10003430
508 Ga0265316_10009458
509 Ga0265316_10076365
510 Ga0265316_10759182
511 Ga0265316_10834390
512 Ga0265313_10008209
513 Ga0265313_10026090
514 Ga0265314_10009965
515 Ga0265314_10186361
516 Ga0265314_10255052
517 Ga0265314_10417875
518 Ga0265342_10025911
519 Ga0265342_10089395
520 Ga0265342_10387324
521 Ga0373932_0083420
522 Ga0395900_0092059
523 Ga0395898_0513339
524 Ga0395905_0001783
525 Ga0395901_0065472
526 Ga0436365_1596550
527 Ga0495583_0301718
528 Ga0495670_0447041
529 Ga0495660_0166929
530 Ga0495680_0599582
531 Ga0496100_0019836
532 Ga0501031_0001506
533 Ga0501032_0009081
534 Ga0501033_0048217
535 Ga0501034_0000982
536 Ga0501034_0018974
537 Ga0501036_0009517
538 Ga0501036_0025432
539 Ga0501037_0000031
540 Ga0501037_0194999
541 Ga0501038_0053950
542 Ga0501039_0548695
543 Ga0501043_0003606
544 Ga0501046_0000059
545 Ga0501047_0000032
546 Ga0501047_0000057
547 Ga0501048_0019380
548 Ga0501048_0712803
549 Ga0501069_0675641
550 Ga0501070_0028501
551 Ga0501070_0425009
552 Ga0501074_0683177
553 Ga0501080_0738002
554 Ga0501035_0000005
555 Ga0501035_0001138
556 Ga0501044_0043257
557 nmdc:mga03n38_899757_c1
558 nmdc:mga00v17_167_c1
559 nmdc:mga0yw44_223871_c1
560 nmdc:mga0yw44_3145_c1
561 nmdc:mga06z11_746258_c1
562 nmdc:mga07m45_149761_c1
563 nmdc:mga0sz30_10316_c2
564 nmdc:mga0sz30_136593_c1
565 Ga0500643_000070
566 Ga0500583_0020010
567 Ga0500651_0000017
568 Ga0500651_0001380
569 Ga0500562_000001
570 Ga0500614_002808
571 Ga0500628_000259
572 Ga0500655_045227
573 Ga0500568_0153832
574 Ga0500589_012998
575 Ga0500570_000004
576 Ga0500611_008227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

30

143

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9722 5 124
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9658 7 125
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9651 7 125
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9624 7 125
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9615 4 124
ID Description Score Start End Superfamily
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9698 4 122 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9644 6 86 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9634 4 125 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9592 6 86 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9581 4 126 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7T8YN75-F1-model_v4 deleted 1.001 3 125
AF-A0A1G2BFX2-F1-model_v4 Response regulatory domain-containing protein 0.9936 4 125 GO:0000160
AF-A0A2H0Y460-F1-model_v4 Response regulator 0.9917 4 124 GO:0000160
AF-A0A2M7US50-F1-model_v4 Response regulator 0.9917 4 124 GO:0000160
AF-A0A7C5G241-F1-model_v4 Response regulator 0.991 7 122 GO:0000160

Map