F388584

General Info

Members Datasets Scaffolds Average Seq Length
288 142 576 274

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10743826|Ga0157372_107438261
Length 303
Sequence MAEGQIMEEQAVAADRPRAGASPLLALSISADYAGKPGVLRDLRLEMQPGEILGLVGESGSGKSTLALSILRLLDLKGGKVSGSIRFSGRELMQLPESEMRAIRGRDIGLVLQSPMSSLNPALKIGTQMHETWRAHKPGSRKECVPRFLEILRKLNLDVDEKFLERKPSQLSVGQAQRVLIAMAVLHRPPLLLADECTSALDLITQKEVLNIFRNFSREMQMGILFISHDLLAVSSLCHRMAILCKGELVEVGETSAILTRPQHPYTKQLVRALPLPQGLRSNLRQSRFPISEKLRDKSEHPG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
58 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 2.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 16.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10743826 3300013307 Bacteria 1140
2 Ga0070683_100065391 3300005329 Bacteria 3386
3 Ga0070683_100345040 3300005329 Bacteria 1418
4 Ga0068868_100009249 3300005338 Bacteria 7082
5 Ga0070709_10000323 3300005434 Bacteria 30234
6 Ga0070709_10006659 3300005434 Bacteria 6308
7 Ga0070709_10012513 3300005434 Bacteria 4750
8 Ga0070709_10186969 3300005434 Bacteria 1459
9 Ga0070714_100000184 3300005435 Bacteria 49943
10 Ga0070714_100093233 3300005435 Bacteria 2640
11 Ga0070714_100268950 3300005435 Unclassified 1580
12 Ga0070714_100367175 3300005435 Bacteria 1354
13 Ga0070713_100000034 3300005436 Bacteria 86671
14 Ga0070713_100001589 3300005436 Bacteria 14554
15 Ga0070713_100003476 3300005436 Bacteria 10398
16 Ga0070713_100004652 3300005436 Bacteria 9260
17 Ga0070713_100070133 3300005436 Bacteria 2958
18 Ga0070713_100258330 3300005436 Bacteria 1591
19 Ga0070713_100339512 3300005436 Bacteria 1391
20 Ga0070710_10002286 3300005437 Bacteria 9059
21 Ga0070710_10008522 3300005437 Unclassified 4992
22 Ga0070711_100004093 3300005439 Bacteria 8576
23 Ga0070711_100015813 3300005439 Bacteria 4779
24 Ga0070711_100195707 3300005439 Unclassified 1556
25 Ga0070708_100000389 3300005445 Bacteria 33171
26 Ga0070708_100003036 3300005445 Bacteria 13035
27 Ga0070708_100005019 3300005445 Bacteria 10469
28 Ga0070708_100008949 3300005445 Bacteria 8065
29 Ga0070708_100108466 3300005445 Bacteria 2550
30 Ga0070681_10001433 3300005458 Bacteria 20981
31 Ga0070681_10058116 3300005458 Unclassified 3848
32 Ga0070681_10126117 3300005458 Bacteria 2493
33 Ga0068867_100039841 3300005459 Unclassified 3427
34 Ga0070706_100001566 3300005467 Bacteria 23892
35 Ga0070706_100016921 3300005467 Bacteria 6737
36 Ga0070706_100017394 3300005467 Bacteria 6634
37 Ga0070706_100042052 3300005467 Bacteria 4220
38 Ga0070707_100000557 3300005468 Bacteria 37459
39 Ga0070707_100001808 3300005468 Bacteria 20555
40 Ga0070707_100036114 3300005468 Unclassified 4715
41 Ga0070707_100317372 3300005468 Bacteria 1514
42 Ga0070698_100000012 3300005471 Bacteria 116260
43 Ga0070698_100006255 3300005471 Bacteria 12948
44 Ga0070698_100164191 3300005471 Bacteria 2164
45 Ga0070698_100188759 3300005471 Bacteria 1999
46 Ga0070699_100000340 3300005518 Bacteria 45329
47 Ga0070699_100007021 3300005518 Bacteria 9785
48 Ga0070699_100096789 3300005518 Bacteria 2585
49 Ga0070699_100446391 3300005518 Bacteria 1172
50 Ga0070679_100197616 3300005530 Bacteria 1978
51 Ga0070679_100475657 3300005530 Bacteria 1194
52 Ga0070684_100046238 3300005535 Bacteria 3771
53 Ga0070697_100001429 3300005536 Bacteria 18164
54 Ga0070697_100003414 3300005536 Bacteria 12212
55 Ga0070697_100006102 3300005536 Bacteria 9319
56 Ga0070697_100036343 3300005536 Bacteria 3979
57 Ga0070693_100034152 3300005547 Bacteria 2813
58 Ga0068855_100000457 3300005563 Bacteria 50165
59 Ga0068855_100057879 3300005563 Bacteria 4542
60 Ga0070664_100021794 3300005564 Bacteria 5283
61 Ga0068856_100007075 3300005614 Bacteria 10953
62 Ga0068856_100031864 3300005614 Bacteria 5158
63 Ga0068856_100274511 3300005614 Bacteria 1702
64 Ga0068859_100001698 3300005617 Bacteria 22416
65 Ga0068866_10001638 3300005718 Bacteria 9437
66 Ga0068863_100030341 3300005841 Bacteria 5165
67 Ga0068858_100039327 3300005842 Bacteria 4386
68 Ga0068860_100022282 3300005843 Bacteria 6131
69 Ga0070717_10000698 3300006028 Bacteria 21684
70 Ga0070717_10002213 3300006028 Bacteria 13668
71 Ga0070717_10014544 3300006028 Bacteria 6057
72 Ga0070717_10030621 3300006028 Bacteria 4322
73 Ga0070717_10032855 3300006028 Bacteria 4183
74 Ga0070717_10049805 3300006028 Bacteria 3440
75 Ga0070717_10049973 3300006028 Bacteria 3435
76 Ga0070717_10068464 3300006028 Bacteria 2955
77 Ga0070717_10069921 3300006028 Bacteria 2924
78 Ga0070717_10160140 3300006028 Unclassified 1952
79 Ga0070717_10270554 3300006028 Bacteria 1505
80 Ga0070717_10691082 3300006028 Unclassified 927
81 Ga0070715_10031008 3300006163 Unclassified 2167
82 Ga0070716_100012367 3300006173 Bacteria 4325
83 Ga0070716_100024939 3300006173 Bacteria 3185
84 Ga0070716_100091496 3300006173 Bacteria 1842
85 Ga0070712_100000020 3300006175 Bacteria 84120
86 Ga0070712_100021288 3300006175 Bacteria 4257
87 Ga0070712_100041153 3300006175 Bacteria 3171
88 Ga0070712_100056085 3300006175 Bacteria 2762
89 Ga0070712_100063906 3300006175 Bacteria 2608
90 Ga0097621_100000413 3300006237 Bacteria 29856
91 Ga0097621_100557680 3300006237 Unclassified 1043
92 Ga0068871_100000150 3300006358 Bacteria 45815
93 Ga0075434_100046142 3300006871 Bacteria 4324
94 Ga0075434_100067725 3300006871 Bacteria 3556
95 Ga0068865_100329266 3300006881 Bacteria 1231
96 Ga0075436_100013877 3300006914 Bacteria 5517
97 Ga0075436_100014592 3300006914 Bacteria 5385
98 Ga0075436_100101142 3300006914 Bacteria 2007
99 Ga0075436_100154491 3300006914 Bacteria 1616
100 Ga0075436_100318229 3300006914 Bacteria 1118
101 Ga0097620_100001699 3300006931 Bacteria 22416
102 Ga0075435_100018821 3300007076 Bacteria 5262
103 Ga0075435_100043148 3300007076 Bacteria 3610
104 Ga0099794_10060332 3300007265 Bacteria 1842
105 Ga0099794_10071345 3300007265 Bacteria 1702
106 Ga0099795_10035776 3300007788 Bacteria 1738
107 Ga0105240_10000983 3300009093 Bacteria 50850
108 Ga0105240_10014948 3300009093 Bacteria 10574
109 Ga0105240_10058505 3300009093 Unclassified 4812
110 Ga0105243_10281087 3300009148 Bacteria 1499
111 Ga0105241_10059524 3300009174 Bacteria 2937
112 Ga0105241_10093532 3300009174 Bacteria 2376
113 Ga0105248_10001154 3300009177 Bacteria 29468
114 Ga0105248_10380602 3300009177 Bacteria 1589
115 Ga0105237_10112862 3300009545 Unclassified 2710
116 Ga0105237_10411590 3300009545 Unclassified 1357
117 Ga0099796_10139581 3300010159 Bacteria 946
118 Ga0105246_10092453 3300011119 Bacteria 2183
119 Ga0157373_10061409 3300013100 Bacteria 2662
120 Ga0157373_10153748 3300013100 Bacteria 1619
121 Ga0157371_10024020 3300013102 Bacteria 4453
122 Ga0157371_10087180 3300013102 Bacteria 2211
123 Ga0157369_10004684 3300013105 Bacteria 16081
124 Ga0157374_10005652 3300013296 Bacteria 10544
125 Ga0157374_10005979 3300013296 Bacteria 10295
126 Ga0157378_10005493 3300013297 Bacteria 11111
127 Ga0157372_10013770 3300013307 Bacteria 8643
128 Ga0157372_10028784 3300013307 Bacteria 6063
129 Ga0157372_10040487 3300013307 Bacteria 5148
130 Ga0157376_10023574 3300014969 Bacteria 4819
131 Ga0182005_1022205 3300015265 Bacteria 1739
132 Ga0213874_10011690 3300021377 Bacteria 2232
133 Ga0213875_10080251 3300021388 Bacteria 1522
134 Ga0224569_101750 3300022732 Bacteria 1797
135 Ga0224572_1001634 3300024225 Bacteria 3387
136 Ga0224572_1006392 3300024225 Bacteria 2131
137 Ga0228598_1001584 3300024227 Bacteria 4980
138 Ga0207692_10010369 3300025898 Bacteria 3925
139 Ga0207692_10046549 3300025898 Bacteria 2175
140 Ga0207692_10193184 3300025898 Bacteria 1192
141 Ga0207685_10017000 3300025905 Unclassified 2340
142 Ga0207699_10000574 3300025906 Bacteria 18102
143 Ga0207699_10024517 3300025906 Bacteria 3301
144 Ga0207699_10161652 3300025906 Bacteria 1491
145 Ga0207699_10496829 3300025906 Bacteria 880
146 Ga0207684_10000311 3300025910 Bacteria 69074
147 Ga0207684_10000745 3300025910 Bacteria 38041
148 Ga0207684_10021517 3300025910 Bacteria 5507
149 Ga0207684_10166256 3300025910 Unclassified 1901
150 Ga0207707_10010580 3300025912 Bacteria 8011
151 Ga0207707_10111400 3300025912 Bacteria 2393
152 Ga0207695_10020972 3300025913 Bacteria 7466
153 Ga0207695_10096087 3300025913 Bacteria 2965
154 Ga0207693_10000080 3300025915 Bacteria 86060
155 Ga0207693_10001045 3300025915 Bacteria 24744
156 Ga0207693_10006488 3300025915 Bacteria 9690
157 Ga0207693_10077309 3300025915 Bacteria 2606
158 Ga0207693_10285014 3300025915 Bacteria 1294
159 Ga0207663_10003095 3300025916 Bacteria 8068
160 Ga0207663_10018319 3300025916 Bacteria 3923
161 Ga0207663_10029157 3300025916 Bacteria 3238
162 Ga0207657_10224734 3300025919 Bacteria 1503
163 Ga0207652_10022368 3300025921 Bacteria 5230
164 Ga0207652_10266126 3300025921 Bacteria 1546
165 Ga0207646_10000287 3300025922 Bacteria 69461
166 Ga0207646_10000565 3300025922 Bacteria 48737
167 Ga0207646_10078714 3300025922 Bacteria 2947
168 Ga0207646_10319517 3300025922 Bacteria 1403
169 Ga0207700_10000304 3300025928 Bacteria 29208
170 Ga0207700_10002525 3300025928 Bacteria 10502
171 Ga0207700_10003397 3300025928 Bacteria 9245
172 Ga0207700_10004500 3300025928 Bacteria 8231
173 Ga0207700_10179198 3300025928 Unclassified 1773
174 Ga0207664_10000236 3300025929 Bacteria 41929
175 Ga0207664_10244650 3300025929 Bacteria 1563
176 Ga0207706_10050327 3300025933 Bacteria 3682
177 Ga0207709_10176871 3300025935 Bacteria 1503
178 Ga0207704_10255273 3300025938 Bacteria 1319
179 Ga0207704_10292812 3300025938 Bacteria 1243
180 Ga0207665_10002361 3300025939 Bacteria 12745
181 Ga0207665_10038538 3300025939 Bacteria 3183
182 Ga0207665_10112016 3300025939 Bacteria 1918
183 Ga0207711_10134645 3300025941 Bacteria 2218
184 Ga0207711_10262045 3300025941 Bacteria 1589
185 Ga0207689_10035883 3300025942 Unclassified 4116
186 Ga0207661_10004604 3300025944 Bacteria 9669
187 Ga0207661_10046558 3300025944 Bacteria 3440
188 Ga0207661_10056468 3300025944 Bacteria 3152
189 Ga0207661_10238215 3300025944 Bacteria 1614
190 Ga0207679_10051681 3300025945 Bacteria 3009
191 Ga0207667_10007222 3300025949 Bacteria 13405
192 Ga0207640_10004363 3300025981 Bacteria 7665
193 Ga0207677_10010321 3300026023 Bacteria 5281
194 Ga0207703_10035330 3300026035 Bacteria 3972
195 Ga0207703_10078448 3300026035 Unclassified 2744
196 Ga0207702_10001513 3300026078 Bacteria 22979
197 Ga0207702_10003790 3300026078 Bacteria 13646
198 Ga0207702_10012673 3300026078 Bacteria 7016
199 Ga0207702_10150707 3300026078 Bacteria 2115
200 Ga0207641_10022440 3300026088 Bacteria 5196
201 Ga0207648_10056043 3300026089 Unclassified 3440
202 Ga0207676_10595123 3300026095 Bacteria 1061
203 Ga0207674_10007566 3300026116 Bacteria 12655
204 Ga0265356_1005029 3300028017 Unclassified 1593
205 Ga0265356_1005172 3300028017 Bacteria 1569
206 Ga0268264_10072526 3300028381 Bacteria 2920
207 Ga0265338_10000762 3300028800 Bacteria 54962
208 Ga0265338_10137423 3300028800 Bacteria 1919
209 Ga0265762_1000039 3300030760 Bacteria 15446
210 Ga0265762_1000163 3300030760 Bacteria 10507
211 Ga0265762_1010947 3300030760 Unclassified 1621
212 Ga0265762_1012999 3300030760 Bacteria 1497
213 Ga0265760_10001773 3300031090 Bacteria 6341
214 Ga0265760_10003230 3300031090 Bacteria 4776
215 Ga0265760_10010485 3300031090 Unclassified 2645
216 Ga0265325_10087784 3300031241 Unclassified 1537
217 Ga0265339_10018216 3300031249 Unclassified 4144
218 Ga0265316_10011697 3300031344 Bacteria 7903
219 Ga0265316_10102250 3300031344 Unclassified 2177
220 Ga0316212_1001822 3300033547 Bacteria 2964
221 Ga0373926_0014720 3300035083 Unclassified 2662
222 Ga0373934_0012201 3300035086 Unclassified 3243
223 Ga0373923_0048685 3300035111 Unclassified 1770
224 Ga0373936_0003438 3300035113 Bacteria 5939
225 Ga0373957_0065555 3300035120 Bacteria 1414
226 Ga0373943_0000008 3300035170 Bacteria 69214
227 Ga0373946_0005828 3300035171 Bacteria 4458
228 Ga0373946_0018525 3300035171 Unclassified 2675
229 Ga0373955_0056409 3300035172 Bacteria 2155
230 Ga0373955_0085071 3300035172 Unclassified 1794
231 Ga0373924_0079410 3300035410 Unclassified 1394
232 Ga0373924_0103958 3300035410 Bacteria 1223
233 Ga0373935_0016776 3300035692 Bacteria 4432
234 Ga0373935_0039748 3300035692 Bacteria 2950
235 Ga0373935_0041683 3300035692 Bacteria 2885
236 Ga0373927_0002364 3300035695 Bacteria 13745
237 Ga0373927_0030546 3300035695 Unclassified 3515
238 Ga0373927_0342549 3300035695 Bacteria 985
239 Ga0373947_0000210 3300035725 Bacteria 32754
240 Ga0373947_0079976 3300035725 Bacteria 2021
241 Ga0373937_0085504 3300036401 Bacteria 2919
242 Ga0373937_0135606 3300036401 Bacteria 2301
243 Ga0373937_0149638 3300036401 Unclassified 2186
244 Ga0373925_0002144 3300037068 Bacteria 16124
245 Ga0373925_0036766 3300037068 Unclassified 3613
246 Ga0395905_0010932 3300037471 Bacteria 8784
247 Ga0395905_0323248 3300037471 Bacteria 1433
248 Ga0395905_0543799 3300037471 Bacteria 1062
249 Ga0436364_0432523 3300037853 Bacteria 3776
250 Ga0395901_0273662 3300038443 Unclassified 1756
251 Ga0436365_0998202 3300039437 Bacteria 4921
252 Ga0436360_1072846 3300039438 Bacteria 1189
253 Ga0436363_0418720 3300039450 Bacteria 2973
254 Ga0436363_0902343 3300039450 Bacteria 7804
255 Ga0436362_0910852 3300039453 Bacteria 2612
256 Ga0466966_0118896 3300044684 Unclassified 1624
257 Ga0466963_0197335 3300044694 Bacteria 1407
258 Ga0451576_0324658 3300045051 Unclassified 1611
259 Ga0466967_0051868 3300045976 Unclassified 3597
260 Ga0466967_0055758 3300045976 Unclassified 3482
261 Ga0466967_0417844 3300045976 Unclassified 1307
262 Ga0495580_0001785 3300046472 Bacteria 18925
263 Ga0495582_0002120 3300046473 Bacteria 11105
264 Ga0495664_0021192 3300046477 Unclassified 3754
265 Ga0495628_0047024 3300046516 Bacteria 3426
266 Ga0495630_0215547 3300046517 Unclassified 1465
267 Ga0495665_0026094 3300046531 Unclassified 3138
268 Ga0495635_0393440 3300046663 Bacteria 921
269 Ga0495599_0159434 3300046678 Unclassified 1395
270 Ga0495613_0097055 3300046689 Unclassified 2131
271 Ga0495624_0038599 3300046690 Bacteria 3068
272 Ga0495674_0007116 3300047319 Bacteria 10706
273 Ga0495674_0011733 3300047319 Bacteria 8265
274 Ga0495675_0083435 3300047444 Unclassified 2011
275 Ga0495602_0444213 3300048088 Bacteria 916
276 Ga0496112_0372786 3300048915 Bacteria 1369
277 Ga0496115_0033660 3300048918 Bacteria 4047
278 nmdc:mga0n895_64083_c1 3300050512 Bacteria 3635
279 nmdc:mga0n895_73271_c1 3300050512 Bacteria 3400
280 nmdc:mga0rr50_13894_c1 3300050513 Bacteria 5261
281 nmdc:mga0rr50_287452_c1 3300050513 Unclassified 1373
282 nmdc:mga0rr50_31441_c1 3300050513 Bacteria 3769
283 nmdc:mga08x19_129922_c1 3300050514 Bacteria 1693
284 nmdc:mga08x19_14650_c1 3300050514 Bacteria 4760
285 nmdc:mga08x19_1560_c1 3300050514 Bacteria 14229
286 nmdc:mga08x19_244063_c1 3300050514 Bacteria 1239
287 nmdc:mga08x19_246171_c1 3300050514 Bacteria 1233
288 nmdc:mga0a205_50283_c1 3300050515 Bacteria 4024
289 Ga0157372_10743826
290 Ga0070683_100065391
291 Ga0070683_100345040
292 Ga0068868_100009249
293 Ga0070709_10000323
294 Ga0070709_10006659
295 Ga0070709_10012513
296 Ga0070709_10186969
297 Ga0070714_100000184
298 Ga0070714_100093233
299 Ga0070714_100268950
300 Ga0070714_100367175
301 Ga0070713_100000034
302 Ga0070713_100001589
303 Ga0070713_100003476
304 Ga0070713_100004652
305 Ga0070713_100070133
306 Ga0070713_100258330
307 Ga0070713_100339512
308 Ga0070710_10002286
309 Ga0070710_10008522
310 Ga0070711_100004093
311 Ga0070711_100015813
312 Ga0070711_100195707
313 Ga0070708_100000389
314 Ga0070708_100003036
315 Ga0070708_100005019
316 Ga0070708_100008949
317 Ga0070708_100108466
318 Ga0070681_10001433
319 Ga0070681_10058116
320 Ga0070681_10126117
321 Ga0068867_100039841
322 Ga0070706_100001566
323 Ga0070706_100016921
324 Ga0070706_100017394
325 Ga0070706_100042052
326 Ga0070707_100000557
327 Ga0070707_100001808
328 Ga0070707_100036114
329 Ga0070707_100317372
330 Ga0070698_100000012
331 Ga0070698_100006255
332 Ga0070698_100164191
333 Ga0070698_100188759
334 Ga0070699_100000340
335 Ga0070699_100007021
336 Ga0070699_100096789
337 Ga0070699_100446391
338 Ga0070679_100197616
339 Ga0070679_100475657
340 Ga0070684_100046238
341 Ga0070697_100001429
342 Ga0070697_100003414
343 Ga0070697_100006102
344 Ga0070697_100036343
345 Ga0070693_100034152
346 Ga0068855_100000457
347 Ga0068855_100057879
348 Ga0070664_100021794
349 Ga0068856_100007075
350 Ga0068856_100031864
351 Ga0068856_100274511
352 Ga0068859_100001698
353 Ga0068866_10001638
354 Ga0068863_100030341
355 Ga0068858_100039327
356 Ga0068860_100022282
357 Ga0070717_10000698
358 Ga0070717_10002213
359 Ga0070717_10014544
360 Ga0070717_10030621
361 Ga0070717_10032855
362 Ga0070717_10049805
363 Ga0070717_10049973
364 Ga0070717_10068464
365 Ga0070717_10069921
366 Ga0070717_10160140
367 Ga0070717_10270554
368 Ga0070717_10691082
369 Ga0070715_10031008
370 Ga0070716_100012367
371 Ga0070716_100024939
372 Ga0070716_100091496
373 Ga0070712_100000020
374 Ga0070712_100021288
375 Ga0070712_100041153
376 Ga0070712_100056085
377 Ga0070712_100063906
378 Ga0097621_100000413
379 Ga0097621_100557680
380 Ga0068871_100000150
381 Ga0075434_100046142
382 Ga0075434_100067725
383 Ga0068865_100329266
384 Ga0075436_100013877
385 Ga0075436_100014592
386 Ga0075436_100101142
387 Ga0075436_100154491
388 Ga0075436_100318229
389 Ga0097620_100001699
390 Ga0075435_100018821
391 Ga0075435_100043148
392 Ga0099794_10060332
393 Ga0099794_10071345
394 Ga0099795_10035776
395 Ga0105240_10000983
396 Ga0105240_10014948
397 Ga0105240_10058505
398 Ga0105243_10281087
399 Ga0105241_10059524
400 Ga0105241_10093532
401 Ga0105248_10001154
402 Ga0105248_10380602
403 Ga0105237_10112862
404 Ga0105237_10411590
405 Ga0099796_10139581
406 Ga0105246_10092453
407 Ga0157373_10061409
408 Ga0157373_10153748
409 Ga0157371_10024020
410 Ga0157371_10087180
411 Ga0157369_10004684
412 Ga0157374_10005652
413 Ga0157374_10005979
414 Ga0157378_10005493
415 Ga0157372_10013770
416 Ga0157372_10028784
417 Ga0157372_10040487
418 Ga0157376_10023574
419 Ga0182005_1022205
420 Ga0213874_10011690
421 Ga0213875_10080251
422 Ga0224569_101750
423 Ga0224572_1001634
424 Ga0224572_1006392
425 Ga0228598_1001584
426 Ga0207692_10010369
427 Ga0207692_10046549
428 Ga0207692_10193184
429 Ga0207685_10017000
430 Ga0207699_10000574
431 Ga0207699_10024517
432 Ga0207699_10161652
433 Ga0207699_10496829
434 Ga0207684_10000311
435 Ga0207684_10000745
436 Ga0207684_10021517
437 Ga0207684_10166256
438 Ga0207707_10010580
439 Ga0207707_10111400
440 Ga0207695_10020972
441 Ga0207695_10096087
442 Ga0207693_10000080
443 Ga0207693_10001045
444 Ga0207693_10006488
445 Ga0207693_10077309
446 Ga0207693_10285014
447 Ga0207663_10003095
448 Ga0207663_10018319
449 Ga0207663_10029157
450 Ga0207657_10224734
451 Ga0207652_10022368
452 Ga0207652_10266126
453 Ga0207646_10000287
454 Ga0207646_10000565
455 Ga0207646_10078714
456 Ga0207646_10319517
457 Ga0207700_10000304
458 Ga0207700_10002525
459 Ga0207700_10003397
460 Ga0207700_10004500
461 Ga0207700_10179198
462 Ga0207664_10000236
463 Ga0207664_10244650
464 Ga0207706_10050327
465 Ga0207709_10176871
466 Ga0207704_10255273
467 Ga0207704_10292812
468 Ga0207665_10002361
469 Ga0207665_10038538
470 Ga0207665_10112016
471 Ga0207711_10134645
472 Ga0207711_10262045
473 Ga0207689_10035883
474 Ga0207661_10004604
475 Ga0207661_10046558
476 Ga0207661_10056468
477 Ga0207661_10238215
478 Ga0207679_10051681
479 Ga0207667_10007222
480 Ga0207640_10004363
481 Ga0207677_10010321
482 Ga0207703_10035330
483 Ga0207703_10078448
484 Ga0207702_10001513
485 Ga0207702_10003790
486 Ga0207702_10012673
487 Ga0207702_10150707
488 Ga0207641_10022440
489 Ga0207648_10056043
490 Ga0207676_10595123
491 Ga0207674_10007566
492 Ga0265356_1005029
493 Ga0265356_1005172
494 Ga0268264_10072526
495 Ga0265338_10000762
496 Ga0265338_10137423
497 Ga0265762_1000039
498 Ga0265762_1000163
499 Ga0265762_1010947
500 Ga0265762_1012999
501 Ga0265760_10001773
502 Ga0265760_10003230
503 Ga0265760_10010485
504 Ga0265325_10087784
505 Ga0265339_10018216
506 Ga0265316_10011697
507 Ga0265316_10102250
508 Ga0316212_1001822
509 Ga0373926_0014720
510 Ga0373934_0012201
511 Ga0373923_0048685
512 Ga0373936_0003438
513 Ga0373957_0065555
514 Ga0373943_0000008
515 Ga0373946_0005828
516 Ga0373946_0018525
517 Ga0373955_0056409
518 Ga0373955_0085071
519 Ga0373924_0079410
520 Ga0373924_0103958
521 Ga0373935_0016776
522 Ga0373935_0039748
523 Ga0373935_0041683
524 Ga0373927_0002364
525 Ga0373927_0030546
526 Ga0373927_0342549
527 Ga0373947_0000210
528 Ga0373947_0079976
529 Ga0373937_0085504
530 Ga0373937_0135606
531 Ga0373937_0149638
532 Ga0373925_0002144
533 Ga0373925_0036766
534 Ga0395905_0010932
535 Ga0395905_0323248
536 Ga0395905_0543799
537 Ga0436364_0432523
538 Ga0395901_0273662
539 Ga0436365_0998202
540 Ga0436360_1072846
541 Ga0436363_0418720
542 Ga0436363_0902343
543 Ga0436362_0910852
544 Ga0466966_0118896
545 Ga0466963_0197335
546 Ga0451576_0324658
547 Ga0466967_0051868
548 Ga0466967_0055758
549 Ga0466967_0417844
550 Ga0495580_0001785
551 Ga0495582_0002120
552 Ga0495664_0021192
553 Ga0495628_0047024
554 Ga0495630_0215547
555 Ga0495665_0026094
556 Ga0495635_0393440
557 Ga0495599_0159434
558 Ga0495613_0097055
559 Ga0495624_0038599
560 Ga0495674_0007116
561 Ga0495674_0011733
562 Ga0495675_0083435
563 Ga0495602_0444213
564 Ga0496112_0372786
565 Ga0496115_0033660
566 nmdc:mga0n895_64083_c1
567 nmdc:mga0n895_73271_c1
568 nmdc:mga0rr50_13894_c1
569 nmdc:mga0rr50_287452_c1
570 nmdc:mga0rr50_31441_c1
571 nmdc:mga08x19_129922_c1
572 nmdc:mga08x19_14650_c1
573 nmdc:mga08x19_1560_c1
574 nmdc:mga08x19_244063_c1
575 nmdc:mga08x19_246171_c1
576 nmdc:mga0a205_50283_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

199

0.92

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

250

297

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9356 5 255
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9355 5 257
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9328 8 257
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9319 5 257
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9303 5 260
ID Description Score Start End Superfamily
af_P0AAG0_1_323_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9637 5 257 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 5 260 3.40.50.300
af_Q2FZR1_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9541 5 260 3.40.50.300
af_P33916_3_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9537 5 257 3.40.50.300
af_Q2G1F8_1_274_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 5 261 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E7WFK6-F1-model_v4 ABC transporter ATP-binding protein 0.9708 4 257 GO:0005524
GO:0005886
GO:0016887
AF-A0A487A363-F1-model_v4 deleted 0.9698 7 256
AF-A0A3D2X4T8-F1-model_v4 ABC transporter ATP-binding protein 0.9685 1 254 GO:0005524
GO:0016887
AF-A0A485BXS7-F1-model_v4 Glutathione import ATP-binding protein GsiA (EC 3.6.3.-) 0.9669 5 257 GO:0005524
GO:0016887
GO:0055085
AF-S9SH09-F1-model_v4 Oligopeptide/dipeptide uptake family ABC transporter, ATP-binding protein 0.9661 5 254 GO:0005524
GO:0005886
GO:0016887

Map