F388541

General Info

Members Datasets Scaffolds Average Seq Length
288 172 576 185

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10002378|Ga0111539_100023789
Length 196
Sequence MVRPQRNRLTLKDRVKPPVRVLLVGINPGVRSATIGHHFAGYSNRFWKLLFESRLVPEQLSPEDDGRLPEWGYGITNLIPRCTPGIDTLTPGEYAAGARRLRRKVRRWRPEIVAFLGVSLFRAVFPRSGSRGKSRPILLGLQPERFEGAQVFVLPNPSGRNAHYTYDAMLKAFKSLRRRRPKPPDQAALRLRGNPR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.12
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 28.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10002378 3300009094 Bacteria 24984
2 Ga0065704_10146756 3300005289 Bacteria 1464
3 Ga0065715_10102582 3300005293 Bacteria 3098
4 Ga0065715_10234448 3300005293 Bacteria 1211
5 Ga0065707_10004169 3300005295 Bacteria 3569
6 Ga0065707_10086081 3300005295 Bacteria 5679
7 Ga0070676_10038575 3300005328 Bacteria 2759
8 Ga0070690_100078847 3300005330 Unclassified 2152
9 Ga0070677_10139664 3300005333 Unclassified 1116
10 Ga0068869_100025397 3300005334 Bacteria 4114
11 Ga0070666_10032834 3300005335 Bacteria 3431
12 Ga0070680_100866347 3300005336 Bacteria 779
13 Ga0068868_100104504 3300005338 Bacteria 2296
14 Ga0070660_100173564 3300005339 Bacteria 1742
15 Ga0070660_100477135 3300005339 Bacteria 1036
16 Ga0070689_100023451 3300005340 Bacteria 4619
17 Ga0070689_100095139 3300005340 Bacteria 2353
18 Ga0070689_101099356 3300005340 Bacteria 710
19 Ga0070691_10012638 3300005341 Bacteria 3867
20 Ga0070687_100036040 3300005343 Bacteria 2461
21 Ga0070687_100172107 3300005343 Unclassified 1290
22 Ga0070661_100186683 3300005344 Bacteria 1580
23 Ga0070692_10103848 3300005345 Unclassified 1562
24 Ga0070692_10304109 3300005345 Unclassified 975
25 Ga0070668_100331427 3300005347 Unclassified 1284
26 Ga0070669_100037873 3300005353 Bacteria 3499
27 Ga0070669_100146270 3300005353 Bacteria 1826
28 Ga0070669_100393701 3300005353 Bacteria 1132
29 Ga0070675_100839915 3300005354 Bacteria 840
30 Ga0070671_100043414 3300005355 Bacteria 3735
31 Ga0070671_100130690 3300005355 Unclassified 2115
32 Ga0070674_100164632 3300005356 Unclassified 1685
33 Ga0070674_100404006 3300005356 Bacteria 1117
34 Ga0070673_100037064 3300005364 Bacteria 3712
35 Ga0070673_100269578 3300005364 Unclassified 1489
36 Ga0070673_100275134 3300005364 Unclassified 1475
37 Ga0070688_100023142 3300005365 Bacteria 3651
38 Ga0070688_100036936 3300005365 Bacteria 2974
39 Ga0070688_100058086 3300005365 Bacteria 2435
40 Ga0070688_100089674 3300005365 Bacteria 2007
41 Ga0070659_100056286 3300005366 Bacteria 3101
42 Ga0070659_100188970 3300005366 Bacteria 1692
43 Ga0070659_100277499 3300005366 Unclassified 1394
44 Ga0070667_100125033 3300005367 Unclassified 2241
45 Ga0070703_10248702 3300005406 Unclassified 720
46 Ga0070701_10022114 3300005438 Bacteria 3045
47 Ga0070705_100327333 3300005440 Unclassified 1109
48 Ga0070705_100594660 3300005440 Unclassified 855
49 Ga0070694_100160358 3300005444 Bacteria 1650
50 Ga0070662_100338181 3300005457 Unclassified 1231
51 Ga0070662_100823585 3300005457 Bacteria 790
52 Ga0070681_10168853 3300005458 Bacteria 2110
53 Ga0068867_100137593 3300005459 Unclassified 1906
54 Ga0068867_100148374 3300005459 Bacteria 1840
55 Ga0068867_100765869 3300005459 Bacteria 858
56 Ga0070685_10230273 3300005466 Bacteria 1218
57 Ga0070707_100057954 3300005468 Bacteria 3716
58 Ga0070698_101546174 3300005471 Bacteria 615
59 Ga0070699_100142782 3300005518 Unclassified 2115
60 Ga0070679_100029907 3300005530 Bacteria 5375
61 Ga0068853_100260115 3300005539 Unclassified 1595
62 Ga0070672_100175374 3300005543 Unclassified 1784
63 Ga0070686_100107505 3300005544 Unclassified 1895
64 Ga0070695_100762551 3300005545 Unclassified 772
65 Ga0070696_100189558 3300005546 Unclassified 1530
66 Ga0070696_100401297 3300005546 Bacteria 1073
67 Ga0070693_100074618 3300005547 Bacteria 2007
68 Ga0070665_100024903 3300005548 Bacteria 6031
69 Ga0070665_100241444 3300005548 Bacteria 1807
70 Ga0070664_100168640 3300005564 Bacteria 1941
71 Ga0070664_100341516 3300005564 Unclassified 1360
72 Ga0068857_100623409 3300005577 Bacteria 1021
73 Ga0068856_100940678 3300005614 Unclassified 883
74 Ga0070702_100059304 3300005615 Bacteria 2220
75 Ga0070702_100291411 3300005615 Bacteria 1125
76 Ga0068859_100213453 3300005617 Bacteria 2017
77 Ga0068859_100266935 3300005617 Bacteria 1803
78 Ga0068859_100280375 3300005617 Bacteria 1759
79 Ga0068859_100553433 3300005617 Bacteria 1245
80 Ga0068866_10115964 3300005718 Unclassified 1502
81 Ga0068861_100143978 3300005719 Bacteria 1949
82 Ga0068861_100677888 3300005719 Bacteria 955
83 Ga0068861_101074857 3300005719 Bacteria 772
84 Ga0068863_100096971 3300005841 Unclassified 2799
85 Ga0068863_100558695 3300005841 Bacteria 1130
86 Ga0068858_100002111 3300005842 Bacteria 20193
87 Ga0068858_100079236 3300005842 Bacteria 3053
88 Ga0068860_100099425 3300005843 Bacteria 2774
89 Ga0068860_100373489 3300005843 Bacteria 1407
90 Ga0068862_100005263 3300005844 Bacteria 10851
91 Ga0068862_100053317 3300005844 Bacteria 3462
92 Ga0068862_100783777 3300005844 Unclassified 930
93 Ga0081455_10072348 3300005937 Unclassified 2854
94 Ga0070717_10592139 3300006028 Bacteria 1006
95 Ga0075432_10189333 3300006058 Bacteria 809
96 Ga0070716_100103209 3300006173 Unclassified 1752
97 Ga0068871_100878463 3300006358 Bacteria 830
98 Ga0075428_100270251 3300006844 Unclassified 1829
99 Ga0075431_100093604 3300006847 Bacteria 3101
100 Ga0075433_10009633 3300006852 Bacteria 7730
101 Ga0075433_10329609 3300006852 Bacteria 1350
102 Ga0075434_100566008 3300006871 Bacteria 1156
103 Ga0075429_100426348 3300006880 Bacteria 1162
104 Ga0075436_100013737 3300006914 Bacteria 5546
105 Ga0075436_100129876 3300006914 Bacteria 1766
106 Ga0075436_100161424 3300006914 Bacteria 1580
107 Ga0075436_100538966 3300006914 Unclassified 856
108 Ga0097620_100213439 3300006931 Bacteria 2017
109 Ga0097620_100266937 3300006931 Bacteria 1803
110 Ga0097620_100280368 3300006931 Bacteria 1759
111 Ga0097620_100553483 3300006931 Bacteria 1245
112 Ga0075435_100006683 3300007076 Bacteria 8178
113 Ga0075435_100452035 3300007076 Unclassified 1108
114 Ga0105240_10240473 3300009093 Bacteria 2099
115 Ga0105240_10436746 3300009093 Bacteria 1468
116 Ga0111539_10000002 3300009094 Bacteria 983359
117 Ga0111539_10077371 3300009094 Bacteria 3915
118 Ga0111539_10600518 3300009094 Bacteria 1282
119 Ga0105245_10186996 3300009098 Bacteria 1982
120 Ga0105245_10325000 3300009098 Bacteria 1517
121 Ga0105247_10012487 3300009101 Bacteria 5102
122 Ga0114129_10000493 3300009147 Bacteria 47834
123 Ga0114129_10004070 3300009147 Bacteria 20644
124 Ga0114129_10030348 3300009147 Bacteria 7650
125 Ga0114129_10731943 3300009147 Bacteria 1268
126 Ga0105243_10092106 3300009148 Bacteria 2498
127 Ga0105241_10162638 3300009174 Unclassified 1836
128 Ga0105242_10020520 3300009176 Bacteria 5181
129 Ga0105248_10022656 3300009177 Bacteria 6971
130 Ga0105248_10109890 3300009177 Bacteria 3108
131 Ga0105248_10114847 3300009177 Bacteria 3037
132 Ga0105248_10316438 3300009177 Bacteria 1758
133 Ga0105238_10130882 3300009551 Bacteria 2487
134 Ga0105249_10262255 3300009553 Unclassified 1717
135 Ga0105249_10674427 3300009553 Unclassified 1092
136 Ga0105246_10567082 3300011119 Unclassified 975
137 Ga0157370_10056753 3300013104 Bacteria 3726
138 Ga0157369_10363366 3300013105 Unclassified 1503
139 Ga0157369_10440870 3300013105 Bacteria 1349
140 Ga0157369_10882944 3300013105 Bacteria 917
141 Ga0157378_10111239 3300013297 Bacteria 2511
142 Ga0163162_10430160 3300013306 Unclassified 1452
143 Ga0157372_10352810 3300013307 Bacteria 1714
144 Ga0157372_11246044 3300013307 Bacteria 859
145 Ga0157375_10131315 3300013308 Bacteria 2624
146 Ga0157375_10561621 3300013308 Bacteria 1302
147 Ga0157380_10002539 3300014326 Bacteria 12321
148 Ga0157380_10153819 3300014326 Unclassified 1991
149 Ga0157380_10910122 3300014326 Bacteria 906
150 Ga0157380_10989242 3300014326 Unclassified 874
151 Ga0157377_10227719 3300014745 Unclassified 1197
152 Ga0157377_10284669 3300014745 Unclassified 1085
153 Ga0157379_10006254 3300014968 Bacteria 10252
154 Ga0157379_10012974 3300014968 Bacteria 7291
155 Ga0163161_10310368 3300017792 Bacteria 1244
156 Ga0207697_10014270 3300025315 Bacteria 3297
157 Ga0207697_10072391 3300025315 Unclassified 1445
158 Ga0207682_10095986 3300025893 Unclassified 1291
159 Ga0207642_10160413 3300025899 Unclassified 1207
160 Ga0207710_10043340 3300025900 Bacteria 2001
161 Ga0207688_10022067 3300025901 Bacteria 3483
162 Ga0207645_10004910 3300025907 Bacteria 9806
163 Ga0207654_10517035 3300025911 Unclassified 845
164 Ga0207695_10233241 3300025913 Bacteria 1744
165 Ga0207662_10001717 3300025918 Bacteria 10727
166 Ga0207662_10072140 3300025918 Bacteria 2092
167 Ga0207657_10570139 3300025919 Bacteria 884
168 Ga0207649_10506297 3300025920 Unclassified 919
169 Ga0207649_10693348 3300025920 Bacteria 789
170 Ga0207652_10056022 3300025921 Bacteria 3393
171 Ga0207646_10051146 3300025922 Bacteria 3697
172 Ga0207681_10091538 3300025923 Bacteria 2173
173 Ga0207681_10154246 3300025923 Unclassified 1724
174 Ga0207694_10084869 3300025924 Bacteria 2491
175 Ga0207659_10274737 3300025926 Bacteria 1375
176 Ga0207659_10686598 3300025926 Bacteria 876
177 Ga0207644_10124824 3300025931 Bacteria 1963
178 Ga0207644_10157608 3300025931 Unclassified 1762
179 Ga0207690_10760695 3300025932 Unclassified 799
180 Ga0207706_10118154 3300025933 Unclassified 2332
181 Ga0207706_10777819 3300025933 Bacteria 814
182 Ga0207686_10585353 3300025934 Bacteria 876
183 Ga0207709_10152491 3300025935 Bacteria 1602
184 Ga0207670_10063359 3300025936 Bacteria 2530
185 Ga0207670_10287408 3300025936 Bacteria 1284
186 Ga0207669_10100795 3300025937 Bacteria 1909
187 Ga0207669_10630862 3300025937 Unclassified 874
188 Ga0207691_10065893 3300025940 Bacteria 3278
189 Ga0207691_10113959 3300025940 Bacteria 2402
190 Ga0207711_10049587 3300025941 Bacteria 3594
191 Ga0207711_10058630 3300025941 Bacteria 3314
192 Ga0207711_10597990 3300025941 Bacteria 1029
193 Ga0207689_10003739 3300025942 Bacteria 13870
194 Ga0207679_10176955 3300025945 Bacteria 1762
195 Ga0207679_10210400 3300025945 Bacteria 1630
196 Ga0207651_10026255 3300025960 Bacteria 3634
197 Ga0207712_10238362 3300025961 Unclassified 1464
198 Ga0207712_10405317 3300025961 Unclassified 1147
199 Ga0207668_10206653 3300025972 Bacteria 1568
200 Ga0207668_10525840 3300025972 Unclassified 1021
201 Ga0207703_10002626 3300026035 Bacteria 15510
202 Ga0207703_10378985 3300026035 Bacteria 1308
203 Ga0207708_10024885 3300026075 Bacteria 4530
204 Ga0207708_10428353 3300026075 Unclassified 1098
205 Ga0207708_10751283 3300026075 Unclassified 837
206 Ga0207641_10000605 3300026088 Bacteria 39451
207 Ga0207648_10053912 3300026089 Bacteria 3514
208 Ga0207648_10211156 3300026089 Bacteria 1723
209 Ga0207648_10566970 3300026089 Bacteria 1044
210 Ga0207648_10598816 3300026089 Unclassified 1016
211 Ga0207675_100147714 3300026118 Unclassified 2236
212 Ga0207675_100283786 3300026118 Bacteria 1609
213 Ga0207675_100494244 3300026118 Bacteria 1217
214 Ga0207675_100940608 3300026118 Bacteria 881
215 Ga0207683_10067613 3300026121 Bacteria 3153
216 Ga0207698_10028342 3300026142 Bacteria 3992
217 Ga0207428_10000004 3300027907 Bacteria 727800
218 Ga0207428_10059717 3300027907 Bacteria 3022
219 Ga0268266_10159602 3300028379 Bacteria 2039
220 Ga0268266_10271915 3300028379 Bacteria 1573
221 Ga0268265_10097796 3300028380 Bacteria 2362
222 Ga0268265_10439931 3300028380 Bacteria 1215
223 Ga0268264_10099769 3300028381 Bacteria 2520
224 Ga0268264_10324311 3300028381 Bacteria 1457
225 Ga0268264_10525336 3300028381 Bacteria 1158
226 Ga0307408_100430715 3300031548 Bacteria 1140
227 Ga0307409_100606891 3300031995 Unclassified 1082
228 Ga0307416_100321319 3300032002 Unclassified 1550
229 Ga0307416_102399392 3300032002 Bacteria 627
230 Ga0373958_0022403 3300034819 Bacteria 1180
231 Ga0373959_0059776 3300034820 Bacteria 841
232 Ga0373949_0049388 3300035090 Bacteria 1056
233 Ga0373932_0068997 3300035112 Bacteria 1092
234 Ga0373936_0020709 3300035113 Unclassified 2556
235 Ga0373939_0044085 3300035114 Bacteria 1357
236 Ga0373941_0035077 3300035115 Unclassified 1517
237 Ga0373941_0053110 3300035115 Bacteria 1295
238 Ga0373941_0093346 3300035115 Bacteria 1036
239 Ga0373942_0092579 3300035207 Bacteria 913
240 Ga0373931_0713792 3300035691 Bacteria 663
241 Ga0436365_1191083 3300039437 Bacteria 1529
242 Ga0451853_2701131 3300041512 Unclassified 695
243 Ga0466963_0314422 3300044694 Bacteria 1102
244 Ga0495628_0057456 3300046516 Bacteria 3061
245 Ga0495586_0132222 3300046535 Unclassified 1397
246 Ga0495656_0544756 3300046615 Unclassified 618
247 Ga0495647_0106256 3300046681 Bacteria 1167
248 Ga0495614_0160162 3300048089 Bacteria 1007
249 Ga0496101_0411432 3300048904 Bacteria 1066
250 Ga0496102_0980080 3300048905 Bacteria 766
251 Ga0496106_0089829 3300048909 Bacteria 2370
252 Ga0496107_0025591 3300048910 Unclassified 4179
253 Ga0496109_0473480 3300048912 Bacteria 1183
254 Ga0496109_0749892 3300048912 Unclassified 914
255 Ga0496110_0441376 3300048913 Bacteria 1186
256 Ga0496112_0297362 3300048915 Unclassified 1560
257 Ga0496113_0304674 3300048916 Unclassified 1276
258 Ga0501034_0028012 3300049571 Bacteria 5730
259 Ga0501047_0415678 3300049581 Unclassified 1177
260 Ga0501076_0501012 3300049592 Bacteria 1001
261 Ga0501083_0019392 3300049744 Bacteria 4739
262 nmdc:mga05p37_1708065_c1 3300050507 Bacteria 613
263 nmdc:mga05p37_49809_c1 3300050507 Bacteria 5152
264 nmdc:mga05p37_61128_c1 3300050507 Bacteria 4638
265 nmdc:mga05p37_76752_c1 3300050507 Bacteria 4113
266 nmdc:mga05p37_826_c1 3300050507 Bacteria 34745
267 nmdc:mga09592_340533_c1 3300050508 Bacteria 1298
268 nmdc:mga0qj67_707829_c1 3300050509 Unclassified 801
269 nmdc:mga06r32_111888_c1 3300050510 Unclassified 2687
270 nmdc:mga08y16_1015215_c1 3300050511 Bacteria 809
271 nmdc:mga08y16_1196450_c1 3300050511 Bacteria 731
272 nmdc:mga08y16_177972_c1 3300050511 Bacteria 2209
273 nmdc:mga08y16_29679_c1 3300050511 Bacteria 5759
274 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
275 nmdc:mga08y16_329263_c1 3300050511 Unclassified 1571
276 nmdc:mga08y16_9083_c1 3300050511 Bacteria 10435
277 nmdc:mga0n895_1354910_c1 3300050512 Unclassified 681
278 nmdc:mga0n895_17420_c1 3300050512 Bacteria 6619
279 nmdc:mga0n895_337937_c1 3300050512 Unclassified 1526
280 nmdc:mga0n895_468365_c1 3300050512 Bacteria 1271
281 nmdc:mga0n895_848901_c1 3300050512 Unclassified 901
282 nmdc:mga08x19_21007_c1 3300050514 Bacteria 4027
283 nmdc:mga08x19_459221_c1 3300050514 Unclassified 897
284 nmdc:mga08x19_542461_c1 3300050514 Bacteria 823
285 nmdc:mga08x19_713735_c1 3300050514 Bacteria 712
286 nmdc:mga0a205_211100_c1 3300050515 Unclassified 1829
287 nmdc:mga0a205_37376_c1 3300050515 Unclassified 1429
288 Ga0501082_1267734 3300060353 Bacteria 644
289 Ga0111539_10002378
290 Ga0065704_10146756
291 Ga0065715_10102582
292 Ga0065715_10234448
293 Ga0065707_10004169
294 Ga0065707_10086081
295 Ga0070676_10038575
296 Ga0070690_100078847
297 Ga0070677_10139664
298 Ga0068869_100025397
299 Ga0070666_10032834
300 Ga0070680_100866347
301 Ga0068868_100104504
302 Ga0070660_100173564
303 Ga0070660_100477135
304 Ga0070689_100023451
305 Ga0070689_100095139
306 Ga0070689_101099356
307 Ga0070691_10012638
308 Ga0070687_100036040
309 Ga0070687_100172107
310 Ga0070661_100186683
311 Ga0070692_10103848
312 Ga0070692_10304109
313 Ga0070668_100331427
314 Ga0070669_100037873
315 Ga0070669_100146270
316 Ga0070669_100393701
317 Ga0070675_100839915
318 Ga0070671_100043414
319 Ga0070671_100130690
320 Ga0070674_100164632
321 Ga0070674_100404006
322 Ga0070673_100037064
323 Ga0070673_100269578
324 Ga0070673_100275134
325 Ga0070688_100023142
326 Ga0070688_100036936
327 Ga0070688_100058086
328 Ga0070688_100089674
329 Ga0070659_100056286
330 Ga0070659_100188970
331 Ga0070659_100277499
332 Ga0070667_100125033
333 Ga0070703_10248702
334 Ga0070701_10022114
335 Ga0070705_100327333
336 Ga0070705_100594660
337 Ga0070694_100160358
338 Ga0070662_100338181
339 Ga0070662_100823585
340 Ga0070681_10168853
341 Ga0068867_100137593
342 Ga0068867_100148374
343 Ga0068867_100765869
344 Ga0070685_10230273
345 Ga0070707_100057954
346 Ga0070698_101546174
347 Ga0070699_100142782
348 Ga0070679_100029907
349 Ga0068853_100260115
350 Ga0070672_100175374
351 Ga0070686_100107505
352 Ga0070695_100762551
353 Ga0070696_100189558
354 Ga0070696_100401297
355 Ga0070693_100074618
356 Ga0070665_100024903
357 Ga0070665_100241444
358 Ga0070664_100168640
359 Ga0070664_100341516
360 Ga0068857_100623409
361 Ga0068856_100940678
362 Ga0070702_100059304
363 Ga0070702_100291411
364 Ga0068859_100213453
365 Ga0068859_100266935
366 Ga0068859_100280375
367 Ga0068859_100553433
368 Ga0068866_10115964
369 Ga0068861_100143978
370 Ga0068861_100677888
371 Ga0068861_101074857
372 Ga0068863_100096971
373 Ga0068863_100558695
374 Ga0068858_100002111
375 Ga0068858_100079236
376 Ga0068860_100099425
377 Ga0068860_100373489
378 Ga0068862_100005263
379 Ga0068862_100053317
380 Ga0068862_100783777
381 Ga0081455_10072348
382 Ga0070717_10592139
383 Ga0075432_10189333
384 Ga0070716_100103209
385 Ga0068871_100878463
386 Ga0075428_100270251
387 Ga0075431_100093604
388 Ga0075433_10009633
389 Ga0075433_10329609
390 Ga0075434_100566008
391 Ga0075429_100426348
392 Ga0075436_100013737
393 Ga0075436_100129876
394 Ga0075436_100161424
395 Ga0075436_100538966
396 Ga0097620_100213439
397 Ga0097620_100266937
398 Ga0097620_100280368
399 Ga0097620_100553483
400 Ga0075435_100006683
401 Ga0075435_100452035
402 Ga0105240_10240473
403 Ga0105240_10436746
404 Ga0111539_10000002
405 Ga0111539_10077371
406 Ga0111539_10600518
407 Ga0105245_10186996
408 Ga0105245_10325000
409 Ga0105247_10012487
410 Ga0114129_10000493
411 Ga0114129_10004070
412 Ga0114129_10030348
413 Ga0114129_10731943
414 Ga0105243_10092106
415 Ga0105241_10162638
416 Ga0105242_10020520
417 Ga0105248_10022656
418 Ga0105248_10109890
419 Ga0105248_10114847
420 Ga0105248_10316438
421 Ga0105238_10130882
422 Ga0105249_10262255
423 Ga0105249_10674427
424 Ga0105246_10567082
425 Ga0157370_10056753
426 Ga0157369_10363366
427 Ga0157369_10440870
428 Ga0157369_10882944
429 Ga0157378_10111239
430 Ga0163162_10430160
431 Ga0157372_10352810
432 Ga0157372_11246044
433 Ga0157375_10131315
434 Ga0157375_10561621
435 Ga0157380_10002539
436 Ga0157380_10153819
437 Ga0157380_10910122
438 Ga0157380_10989242
439 Ga0157377_10227719
440 Ga0157377_10284669
441 Ga0157379_10006254
442 Ga0157379_10012974
443 Ga0163161_10310368
444 Ga0207697_10014270
445 Ga0207697_10072391
446 Ga0207682_10095986
447 Ga0207642_10160413
448 Ga0207710_10043340
449 Ga0207688_10022067
450 Ga0207645_10004910
451 Ga0207654_10517035
452 Ga0207695_10233241
453 Ga0207662_10001717
454 Ga0207662_10072140
455 Ga0207657_10570139
456 Ga0207649_10506297
457 Ga0207649_10693348
458 Ga0207652_10056022
459 Ga0207646_10051146
460 Ga0207681_10091538
461 Ga0207681_10154246
462 Ga0207694_10084869
463 Ga0207659_10274737
464 Ga0207659_10686598
465 Ga0207644_10124824
466 Ga0207644_10157608
467 Ga0207690_10760695
468 Ga0207706_10118154
469 Ga0207706_10777819
470 Ga0207686_10585353
471 Ga0207709_10152491
472 Ga0207670_10063359
473 Ga0207670_10287408
474 Ga0207669_10100795
475 Ga0207669_10630862
476 Ga0207691_10065893
477 Ga0207691_10113959
478 Ga0207711_10049587
479 Ga0207711_10058630
480 Ga0207711_10597990
481 Ga0207689_10003739
482 Ga0207679_10176955
483 Ga0207679_10210400
484 Ga0207651_10026255
485 Ga0207712_10238362
486 Ga0207712_10405317
487 Ga0207668_10206653
488 Ga0207668_10525840
489 Ga0207703_10002626
490 Ga0207703_10378985
491 Ga0207708_10024885
492 Ga0207708_10428353
493 Ga0207708_10751283
494 Ga0207641_10000605
495 Ga0207648_10053912
496 Ga0207648_10211156
497 Ga0207648_10566970
498 Ga0207648_10598816
499 Ga0207675_100147714
500 Ga0207675_100283786
501 Ga0207675_100494244
502 Ga0207675_100940608
503 Ga0207683_10067613
504 Ga0207698_10028342
505 Ga0207428_10000004
506 Ga0207428_10059717
507 Ga0268266_10159602
508 Ga0268266_10271915
509 Ga0268265_10097796
510 Ga0268265_10439931
511 Ga0268264_10099769
512 Ga0268264_10324311
513 Ga0268264_10525336
514 Ga0307408_100430715
515 Ga0307409_100606891
516 Ga0307416_100321319
517 Ga0307416_102399392
518 Ga0373958_0022403
519 Ga0373959_0059776
520 Ga0373949_0049388
521 Ga0373932_0068997
522 Ga0373936_0020709
523 Ga0373939_0044085
524 Ga0373941_0035077
525 Ga0373941_0053110
526 Ga0373941_0093346
527 Ga0373942_0092579
528 Ga0373931_0713792
529 Ga0436365_1191083
530 Ga0451853_2701131
531 Ga0466963_0314422
532 Ga0495628_0057456
533 Ga0495586_0132222
534 Ga0495656_0544756
535 Ga0495647_0106256
536 Ga0495614_0160162
537 Ga0496101_0411432
538 Ga0496102_0980080
539 Ga0496106_0089829
540 Ga0496107_0025591
541 Ga0496109_0473480
542 Ga0496109_0749892
543 Ga0496110_0441376
544 Ga0496112_0297362
545 Ga0496113_0304674
546 Ga0501034_0028012
547 Ga0501047_0415678
548 Ga0501076_0501012
549 Ga0501083_0019392
550 nmdc:mga05p37_1708065_c1
551 nmdc:mga05p37_49809_c1
552 nmdc:mga05p37_61128_c1
553 nmdc:mga05p37_76752_c1
554 nmdc:mga05p37_826_c1
555 nmdc:mga09592_340533_c1
556 nmdc:mga0qj67_707829_c1
557 nmdc:mga06r32_111888_c1
558 nmdc:mga08y16_1015215_c1
559 nmdc:mga08y16_1196450_c1
560 nmdc:mga08y16_177972_c1
561 nmdc:mga08y16_29679_c1
562 nmdc:mga08y16_2_c1
563 nmdc:mga08y16_329263_c1
564 nmdc:mga08y16_9083_c1
565 nmdc:mga0n895_1354910_c1
566 nmdc:mga0n895_17420_c1
567 nmdc:mga0n895_337937_c1
568 nmdc:mga0n895_468365_c1
569 nmdc:mga0n895_848901_c1
570 nmdc:mga08x19_21007_c1
571 nmdc:mga08x19_459221_c1
572 nmdc:mga08x19_542461_c1
573 nmdc:mga08x19_713735_c1
574 nmdc:mga0a205_211100_c1
575 nmdc:mga0a205_37376_c1
576 Ga0501082_1267734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

13

177

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9382 3 166
1wyw-assembly1.cif.gz_A crystal structure of sumo1-conjugated thymine dna glycosylase 0.9329 2 164
5cys-assembly1.cif.gz_A structure of the enzyme-product complex resulting from tdg action on a gcac mismatch 0.9229 2 169
6u15-assembly1.cif.gz_A human thymine dna glycosylase n140a mutant bound to dna with 2'-f-5-carboxyl-dc substrate analog 0.9215 2 169
3uo7-assembly1.cif.gz_A crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.9204 3 169
ID Description Score Start End Superfamily
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.938 2 164 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9259 3 170 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9171 4 166 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9161 2 169 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9104 3 170 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A3N5P5H0-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9933 2 166 GO:0004844
GO:0006285
GO:0008263
AF-A0A2V8CBW6-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9928 11 168 GO:0004844
GO:0006285
GO:0008263
AF-A0A1Q7BF41-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.989 2 167 GO:0004844
GO:0006285
GO:0008263
AF-A0A2V8BCA9-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9875 1 166 GO:0004844
GO:0006285
GO:0008263
AF-A0A533YNA3-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9875 2 170 GO:0004844
GO:0006285
GO:0008263

Map