F388484
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 288 | 171 | 288 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_102063163|Ga0068862_1020631631 |
| Length | 129 |
| Sequence | LLTALRRGLRKRCPHCGEGRLFSGWSQFERCATCGLVFTRNPGDTWAFTIFGDRLPIAVIIVVIYFGVMVSHPVPGMMLMAXXXXVLIWTAPNRWGAGIALHYLSRVYWPDPADPIPSSRATGAGDAEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 104 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 105 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 106 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 107 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 108 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 109 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 114 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 116 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 122 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 128 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 129 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 152 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 95.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10072767 | 3300005328 | Unclassified | 2067 |
| 2 | Ga0070676_10456817 | 3300005328 | Bacteria | 899 |
| 3 | Ga0070676_11405505 | 3300005328 | Bacteria | 535 |
| 4 | Ga0070683_101215256 | 3300005329 | Unclassified | 724 |
| 5 | Ga0068869_100465455 | 3300005334 | Bacteria | 1050 |
| 6 | Ga0070666_10580604 | 3300005335 | Unclassified | 817 |
| 7 | Ga0070666_10722646 | 3300005335 | Bacteria | 731 |
| 8 | Ga0070680_100415145 | 3300005336 | Unclassified | 1148 |
| 9 | Ga0068868_100415969 | 3300005338 | Unclassified | 1163 |
| 10 | Ga0068868_100844341 | 3300005338 | Bacteria | 829 |
| 11 | Ga0068868_100927338 | 3300005338 | Bacteria | 793 |
| 12 | Ga0070692_10405215 | 3300005345 | Unclassified | 862 |
| 13 | Ga0070668_100225371 | 3300005347 | Bacteria | 1548 |
| 14 | Ga0070668_100528241 | 3300005347 | Unclassified | 1024 |
| 15 | Ga0070669_100012355 | 3300005353 | Bacteria | 6058 |
| 16 | Ga0070669_100090166 | 3300005353 | Unclassified | 2297 |
| 17 | Ga0070675_100043661 | 3300005354 | Bacteria | 3664 |
| 18 | Ga0070671_100272063 | 3300005355 | Unclassified | 1440 |
| 19 | Ga0070673_100088987 | 3300005364 | Unclassified | 2519 |
| 20 | Ga0070673_102160780 | 3300005364 | Unclassified | 529 |
| 21 | Ga0070667_102053371 | 3300005367 | Unclassified | 538 |
| 22 | Ga0070701_10079087 | 3300005438 | Bacteria | 1776 |
| 23 | Ga0070705_100199318 | 3300005440 | Unclassified | 1371 |
| 24 | Ga0070700_100051083 | 3300005441 | Unclassified | 2573 |
| 25 | Ga0070700_100082989 | 3300005441 | Unclassified | 2073 |
| 26 | Ga0070694_100008133 | 3300005444 | Bacteria | 6407 |
| 27 | Ga0070694_100068169 | 3300005444 | Bacteria | 2444 |
| 28 | Ga0070694_100606493 | 3300005444 | Bacteria | 882 |
| 29 | Ga0070708_100566600 | 3300005445 | Unclassified | 1071 |
| 30 | Ga0070663_100508713 | 3300005455 | Bacteria | 1001 |
| 31 | Ga0070662_101284627 | 3300005457 | Bacteria | 630 |
| 32 | Ga0068867_100007610 | 3300005459 | Bacteria | 7661 |
| 33 | Ga0068867_100064540 | 3300005459 | Bacteria | 2723 |
| 34 | Ga0070707_100287685 | 3300005468 | Bacteria | 1597 |
| 35 | Ga0070707_100341944 | 3300005468 | Unclassified | 1453 |
| 36 | Ga0070707_100535761 | 3300005468 | Unclassified | 1133 |
| 37 | Ga0070698_100005676 | 3300005471 | Bacteria | 13663 |
| 38 | Ga0070698_100221213 | 3300005471 | Bacteria | 1827 |
| 39 | Ga0070698_100296941 | 3300005471 | Bacteria | 1546 |
| 40 | Ga0070699_100002788 | 3300005518 | Bacteria | 15588 |
| 41 | Ga0070699_100037985 | 3300005518 | Bacteria | 4169 |
| 42 | Ga0070699_100141728 | 3300005518 | Unclassified | 2123 |
| 43 | Ga0070697_100185587 | 3300005536 | Unclassified | 1764 |
| 44 | Ga0070697_100241014 | 3300005536 | Bacteria | 1544 |
| 45 | Ga0070697_100327532 | 3300005536 | Bacteria | 1320 |
| 46 | Ga0070686_101265909 | 3300005544 | Bacteria | 615 |
| 47 | Ga0070695_100007086 | 3300005545 | Bacteria | 6644 |
| 48 | Ga0070695_100618061 | 3300005545 | Bacteria | 852 |
| 49 | Ga0070696_100006899 | 3300005546 | Bacteria | 7580 |
| 50 | Ga0070696_100009670 | 3300005546 | Bacteria | 6449 |
| 51 | Ga0070696_100080642 | 3300005546 | Unclassified | 2304 |
| 52 | Ga0070665_100004501 | 3300005548 | Bacteria | 14627 |
| 53 | Ga0070704_100005370 | 3300005549 | Bacteria | 7464 |
| 54 | Ga0070704_100922170 | 3300005549 | Unclassified | 787 |
| 55 | Ga0070704_102244817 | 3300005549 | Bacteria | 508 |
| 56 | Ga0068855_100209188 | 3300005563 | Bacteria | 2193 |
| 57 | Ga0068854_100801590 | 3300005578 | Unclassified | 821 |
| 58 | Ga0070702_100000780 | 3300005615 | Bacteria | 12091 |
| 59 | Ga0070702_100935051 | 3300005615 | Unclassified | 681 |
| 60 | Ga0068859_101098197 | 3300005617 | Bacteria | 875 |
| 61 | Ga0068864_100142191 | 3300005618 | Bacteria | 2165 |
| 62 | Ga0068864_100688253 | 3300005618 | Bacteria | 998 |
| 63 | Ga0068864_101466556 | 3300005618 | Unclassified | 685 |
| 64 | Ga0068861_100003492 | 3300005719 | Bacteria | 10439 |
| 65 | Ga0068863_100149296 | 3300005841 | Bacteria | 2236 |
| 66 | Ga0068858_100030026 | 3300005842 | Bacteria | 5047 |
| 67 | Ga0068858_100123332 | 3300005842 | Bacteria | 2424 |
| 68 | Ga0068858_101558244 | 3300005842 | Unclassified | 652 |
| 69 | Ga0068862_100314947 | 3300005844 | Bacteria | 1443 |
| 70 | Ga0068862_102003568 | 3300005844 | Unclassified | 590 |
| 71 | Ga0068862_102063163 | 3300005844 | Bacteria | 581 |
| 72 | Ga0097621_100015543 | 3300006237 | Bacteria | 5730 |
| 73 | Ga0097621_100164356 | 3300006237 | Bacteria | 1910 |
| 74 | Ga0068871_100080035 | 3300006358 | Bacteria | 2704 |
| 75 | Ga0075428_100103167 | 3300006844 | Bacteria | 3110 |
| 76 | Ga0075433_10060175 | 3300006852 | Bacteria | 3325 |
| 77 | Ga0075434_100204223 | 3300006871 | Bacteria | 1996 |
| 78 | Ga0075434_100221475 | 3300006871 | Bacteria | 1912 |
| 79 | Ga0075429_101690117 | 3300006880 | Bacteria | 550 |
| 80 | Ga0068865_100147236 | 3300006881 | Bacteria | 1782 |
| 81 | Ga0068865_100336239 | 3300006881 | Bacteria | 1219 |
| 82 | Ga0068865_100568713 | 3300006881 | Bacteria | 954 |
| 83 | Ga0068865_101594568 | 3300006881 | Unclassified | 587 |
| 84 | Ga0097620_100520165 | 3300006931 | Unclassified | 1285 |
| 85 | Ga0097620_101098212 | 3300006931 | Bacteria | 875 |
| 86 | Ga0097620_102609748 | 3300006931 | Bacteria | 556 |
| 87 | Ga0105240_10790297 | 3300009093 | Bacteria | 1029 |
| 88 | Ga0105240_11499180 | 3300009093 | Bacteria | 707 |
| 89 | Ga0111539_12538100 | 3300009094 | Unclassified | 594 |
| 90 | Ga0105245_10018560 | 3300009098 | Bacteria | 6083 |
| 91 | Ga0114129_10011485 | 3300009147 | Bacteria | 12609 |
| 92 | Ga0114129_10069625 | 3300009147 | Bacteria | 4904 |
| 93 | Ga0114129_10248421 | 3300009147 | Bacteria | 2389 |
| 94 | Ga0114129_11761823 | 3300009147 | Bacteria | 754 |
| 95 | Ga0105243_10265757 | 3300009148 | Unclassified | 1538 |
| 96 | Ga0105242_10003950 | 3300009176 | Bacteria | 11517 |
| 97 | Ga0105242_10344997 | 3300009176 | Bacteria | 1373 |
| 98 | Ga0105242_11079842 | 3300009176 | Unclassified | 815 |
| 99 | Ga0105242_12577066 | 3300009176 | Bacteria | 557 |
| 100 | Ga0105248_10003114 | 3300009177 | Bacteria | 18368 |
| 101 | Ga0105248_10074133 | 3300009177 | Unclassified | 3825 |
| 102 | Ga0105248_10171704 | 3300009177 | Bacteria | 2444 |
| 103 | Ga0105248_11004219 | 3300009177 | Bacteria | 943 |
| 104 | Ga0105248_12744293 | 3300009177 | Unclassified | 562 |
| 105 | Ga0105237_10832393 | 3300009545 | Bacteria | 930 |
| 106 | Ga0105249_10497086 | 3300009553 | Bacteria | 1264 |
| 107 | Ga0157374_10028114 | 3300013296 | Bacteria | 5079 |
| 108 | Ga0157378_10521356 | 3300013297 | Bacteria | 1190 |
| 109 | Ga0157378_11185667 | 3300013297 | Unclassified | 803 |
| 110 | Ga0163162_11624052 | 3300013306 | Bacteria | 737 |
| 111 | Ga0157375_10164276 | 3300013308 | Bacteria | 2364 |
| 112 | Ga0157375_10475454 | 3300013308 | Bacteria | 1415 |
| 113 | Ga0157375_10601867 | 3300013308 | Bacteria | 1258 |
| 114 | Ga0157375_11712405 | 3300013308 | Bacteria | 744 |
| 115 | Ga0163163_10003026 | 3300014325 | Bacteria | 14242 |
| 116 | Ga0163163_10301989 | 3300014325 | Bacteria | 1653 |
| 117 | Ga0163163_13089385 | 3300014325 | Unclassified | 519 |
| 118 | Ga0157380_10162423 | 3300014326 | Bacteria | 1943 |
| 119 | Ga0157377_10970173 | 3300014745 | Bacteria | 641 |
| 120 | Ga0157379_10025930 | 3300014968 | Bacteria | 5213 |
| 121 | Ga0157379_10081390 | 3300014968 | Bacteria | 2901 |
| 122 | Ga0157379_10201488 | 3300014968 | Bacteria | 1800 |
| 123 | Ga0157376_10033873 | 3300014969 | Unclassified | 4118 |
| 124 | Ga0157376_10091042 | 3300014969 | Bacteria | 2641 |
| 125 | Ga0163161_11057653 | 3300017792 | Unclassified | 695 |
| 126 | Ga0207697_10077838 | 3300025315 | Unclassified | 1395 |
| 127 | Ga0207680_11079618 | 3300025903 | Unclassified | 574 |
| 128 | Ga0207685_10049073 | 3300025905 | Bacteria | 1620 |
| 129 | Ga0207645_10020856 | 3300025907 | Bacteria | 4281 |
| 130 | Ga0207645_10032440 | 3300025907 | Unclassified | 3357 |
| 131 | Ga0207645_10242297 | 3300025907 | Bacteria | 1191 |
| 132 | Ga0207660_10066876 | 3300025917 | Bacteria | 2601 |
| 133 | Ga0207662_10606590 | 3300025918 | Bacteria | 762 |
| 134 | Ga0207646_10368220 | 3300025922 | Bacteria | 1298 |
| 135 | Ga0207646_10486739 | 3300025922 | Bacteria | 1112 |
| 136 | Ga0207681_10087095 | 3300025923 | Unclassified | 2221 |
| 137 | Ga0207681_10099631 | 3300025923 | Bacteria | 2093 |
| 138 | Ga0207681_10596900 | 3300025923 | Bacteria | 912 |
| 139 | Ga0207681_10825486 | 3300025923 | Unclassified | 775 |
| 140 | Ga0207687_10020064 | 3300025927 | Bacteria | 4432 |
| 141 | Ga0207687_10253036 | 3300025927 | Bacteria | 1401 |
| 142 | Ga0207706_10030677 | 3300025933 | Bacteria | 4794 |
| 143 | Ga0207706_10055173 | 3300025933 | Bacteria | 3505 |
| 144 | Ga0207706_10498046 | 3300025933 | Bacteria | 1052 |
| 145 | Ga0207686_10009654 | 3300025934 | Bacteria | 5240 |
| 146 | Ga0207686_10020338 | 3300025934 | Unclassified | 3790 |
| 147 | Ga0207709_10032719 | 3300025935 | Bacteria | 3048 |
| 148 | Ga0207669_10229851 | 3300025937 | Bacteria | 1368 |
| 149 | Ga0207704_10006763 | 3300025938 | Bacteria | 5374 |
| 150 | Ga0207704_10226314 | 3300025938 | Bacteria | 1388 |
| 151 | Ga0207691_10594828 | 3300025940 | Unclassified | 937 |
| 152 | Ga0207711_10058287 | 3300025941 | Unclassified | 3323 |
| 153 | Ga0207711_10063389 | 3300025941 | Bacteria | 3190 |
| 154 | Ga0207711_10289533 | 3300025941 | Unclassified | 1509 |
| 155 | Ga0207711_10348117 | 3300025941 | Bacteria | 1372 |
| 156 | Ga0207711_10742118 | 3300025941 | Bacteria | 915 |
| 157 | Ga0207689_10166519 | 3300025942 | Bacteria | 1816 |
| 158 | Ga0207689_10949558 | 3300025942 | Unclassified | 725 |
| 159 | Ga0207661_11619529 | 3300025944 | Unclassified | 592 |
| 160 | Ga0207679_10360305 | 3300025945 | Bacteria | 1270 |
| 161 | Ga0207679_10389151 | 3300025945 | Bacteria | 1224 |
| 162 | Ga0207667_10510472 | 3300025949 | Bacteria | 1218 |
| 163 | Ga0207651_10625579 | 3300025960 | Bacteria | 943 |
| 164 | Ga0207712_10291106 | 3300025961 | Bacteria | 1336 |
| 165 | Ga0207712_10413953 | 3300025961 | Bacteria | 1136 |
| 166 | Ga0207640_10110302 | 3300025981 | Bacteria | 1949 |
| 167 | Ga0207658_10622570 | 3300025986 | Unclassified | 971 |
| 168 | Ga0207677_10058871 | 3300026023 | Bacteria | 2648 |
| 169 | Ga0207677_10073711 | 3300026023 | Bacteria | 2419 |
| 170 | Ga0207677_10384288 | 3300026023 | Unclassified | 1186 |
| 171 | Ga0207677_11217378 | 3300026023 | Bacteria | 690 |
| 172 | Ga0207677_11691940 | 3300026023 | Bacteria | 586 |
| 173 | Ga0207703_10020798 | 3300026035 | Bacteria | 5134 |
| 174 | Ga0207703_10048939 | 3300026035 | Bacteria | 3415 |
| 175 | Ga0207703_10254869 | 3300026035 | Bacteria | 1583 |
| 176 | Ga0207708_10023085 | 3300026075 | Bacteria | 4699 |
| 177 | Ga0207648_10006927 | 3300026089 | Bacteria | 11228 |
| 178 | Ga0207648_10061714 | 3300026089 | Bacteria | 3268 |
| 179 | Ga0207676_10034722 | 3300026095 | Bacteria | 3819 |
| 180 | Ga0207676_10521789 | 3300026095 | Bacteria | 1131 |
| 181 | Ga0207675_100005615 | 3300026118 | Bacteria | 12010 |
| 182 | Ga0207675_100334889 | 3300026118 | Bacteria | 1480 |
| 183 | Ga0207698_12082565 | 3300026142 | Bacteria | 581 |
| 184 | Ga0207698_12253005 | 3300026142 | Bacteria | 557 |
| 185 | Ga0207428_10399053 | 3300027907 | Bacteria | 1007 |
| 186 | Ga0268266_11259356 | 3300028379 | Unclassified | 715 |
| 187 | Ga0268265_10032239 | 3300028380 | Bacteria | 3794 |
| 188 | Ga0268265_10556211 | 3300028380 | Bacteria | 1090 |
| 189 | Ga0268265_10833988 | 3300028380 | Unclassified | 901 |
| 190 | Ga0268265_11292942 | 3300028380 | Unclassified | 729 |
| 191 | Ga0268265_12022035 | 3300028380 | Unclassified | 583 |
| 192 | Ga0268264_11756988 | 3300028381 | Bacteria | 630 |
| 193 | Ga0307408_100455207 | 3300031548 | Bacteria | 1111 |
| 194 | Ga0373930_0006003 | 3300034816 | Unclassified | 2038 |
| 195 | Ga0373948_0001373 | 3300034817 | Unclassified | 3352 |
| 196 | Ga0373950_0015487 | 3300034818 | Unclassified | 1294 |
| 197 | Ga0373958_0018758 | 3300034819 | Unclassified | 1257 |
| 198 | Ga0373959_0003880 | 3300034820 | Unclassified | 2393 |
| 199 | Ga0373938_0001711 | 3300034957 | Unclassified | 3508 |
| 200 | Ga0373940_0002437 | 3300035088 | Bacteria | 3616 |
| 201 | Ga0373949_0002541 | 3300035090 | Unclassified | 4641 |
| 202 | Ga0373951_0005682 | 3300035091 | Unclassified | 2887 |
| 203 | Ga0373932_0001645 | 3300035112 | Bacteria | 6122 |
| 204 | Ga0373939_0000641 | 3300035114 | Bacteria | 8701 |
| 205 | Ga0373941_0000778 | 3300035115 | Bacteria | 6524 |
| 206 | Ga0373945_0048816 | 3300035116 | Bacteria | 1552 |
| 207 | Ga0373960_0005074 | 3300035121 | Unclassified | 3033 |
| 208 | Ga0373943_0295533 | 3300035170 | Bacteria | 919 |
| 209 | Ga0373942_0009159 | 3300035207 | Unclassified | 2313 |
| 210 | Ga0373962_0007290 | 3300035242 | Unclassified | 2706 |
| 211 | Ga0373924_0201207 | 3300035410 | Bacteria | 879 |
| 212 | Ga0373931_0001890 | 3300035691 | Bacteria | 9153 |
| 213 | Ga0373935_0448293 | 3300035692 | Bacteria | 932 |
| 214 | Ga0373933_0371097 | 3300035724 | Bacteria | 931 |
| 215 | Ga0373947_0309981 | 3300035725 | Unclassified | 1054 |
| 216 | Ga0373947_0862565 | 3300035725 | Bacteria | 618 |
| 217 | Ga0373937_0112490 | 3300036401 | Bacteria | 2533 |
| 218 | Ga0373925_0274514 | 3300037068 | Bacteria | 1357 |
| 219 | Ga0439460_0013977 | 3300042461 | Bacteria | 2107 |
| 220 | Ga0451577_0879314 | 3300042876 | Unclassified | 807 |
| 221 | Ga0453684_2565115 | 3300044712 | Unclassified | 502 |
| 222 | Ga0451576_0010691 | 3300045051 | Bacteria | 10511 |
| 223 | Ga0451576_0029829 | 3300045051 | Bacteria | 5834 |
| 224 | Ga0451576_0068495 | 3300045051 | Bacteria | 3693 |
| 225 | Ga0451576_0322686 | 3300045051 | Bacteria | 1616 |
| 226 | Ga0466967_0691375 | 3300045976 | Bacteria | 1010 |
| 227 | Ga0466967_0804983 | 3300045976 | Bacteria | 933 |
| 228 | Ga0495629_0472371 | 3300046459 | Bacteria | 848 |
| 229 | Ga0495629_0520828 | 3300046459 | Bacteria | 800 |
| 230 | Ga0495580_0538879 | 3300046472 | Bacteria | 776 |
| 231 | Ga0495582_0226384 | 3300046473 | Bacteria | 1071 |
| 232 | Ga0495582_0557910 | 3300046473 | Bacteria | 663 |
| 233 | Ga0495639_0261688 | 3300046475 | Bacteria | 857 |
| 234 | Ga0495639_0481585 | 3300046475 | Unclassified | 632 |
| 235 | Ga0495594_0380935 | 3300046499 | Bacteria | 803 |
| 236 | Ga0495586_0629922 | 3300046535 | Unclassified | 620 |
| 237 | Ga0495598_0167104 | 3300046537 | Unclassified | 778 |
| 238 | Ga0495647_0426789 | 3300046681 | Unclassified | 611 |
| 239 | Ga0495658_0009839 | 3300046683 | Bacteria | 4769 |
| 240 | Ga0495658_0041975 | 3300046683 | Bacteria | 2552 |
| 241 | Ga0495658_0124454 | 3300046683 | Unclassified | 1563 |
| 242 | Ga0495669_0215090 | 3300046684 | Bacteria | 920 |
| 243 | Ga0495613_0320563 | 3300046689 | Bacteria | 1070 |
| 244 | Ga0495674_0879174 | 3300047319 | Bacteria | 693 |
| 245 | Ga0495685_075151 | 3300047447 | Bacteria | 1129 |
| 246 | Ga0496100_0026130 | 3300048903 | Bacteria | 3577 |
| 247 | Ga0496101_0031652 | 3300048904 | Bacteria | 3720 |
| 248 | Ga0496101_1001890 | 3300048904 | Bacteria | 657 |
| 249 | Ga0496104_0151728 | 3300048907 | Bacteria | 2224 |
| 250 | Ga0496106_0155615 | 3300048909 | Bacteria | 1805 |
| 251 | Ga0496106_0422561 | 3300048909 | Bacteria | 1071 |
| 252 | Ga0496106_0442563 | 3300048909 | Bacteria | 1044 |
| 253 | Ga0496112_0828003 | 3300048915 | Bacteria | 850 |
| 254 | Ga0496112_1143300 | 3300048915 | Bacteria | 696 |
| 255 | Ga0496114_0000426 | 3300048917 | Bacteria | 31103 |
| 256 | Ga0496114_0369985 | 3300048917 | Bacteria | 1268 |
| 257 | Ga0496114_0381592 | 3300048917 | Bacteria | 1248 |
| 258 | Ga0496115_0050220 | 3300048918 | Unclassified | 3341 |
| 259 | Ga0496115_0702803 | 3300048918 | Bacteria | 795 |
| 260 | Ga0501031_0684812 | 3300049568 | Bacteria | 658 |
| 261 | Ga0501046_0461992 | 3300049580 | Unclassified | 912 |
| 262 | Ga0501048_0033943 | 3300049582 | Bacteria | 3684 |
| 263 | Ga0501070_1205782 | 3300049586 | Unclassified | 581 |
| 264 | Ga0501071_0087705 | 3300049587 | Unclassified | 2283 |
| 265 | Ga0501072_0028466 | 3300049588 | Bacteria | 4363 |
| 266 | Ga0501076_0036890 | 3300049592 | Bacteria | 3832 |
| 267 | Ga0501081_0275475 | 3300049743 | Bacteria | 1231 |
| 268 | Ga0501045_0591824 | 3300049824 | Unclassified | 822 |
| 269 | nmdc:mga05p37_164724_c1 | 3300050507 | Unclassified | 2706 |
| 270 | nmdc:mga05p37_240872_c1 | 3300050507 | Bacteria | 2175 |
| 271 | nmdc:mga05p37_64865_c1 | 3300050507 | Bacteria | 4494 |
| 272 | nmdc:mga09592_418454_c1 | 3300050508 | Bacteria | 1158 |
| 273 | nmdc:mga0qj67_1118221_c1 | 3300050509 | Unclassified | 615 |
| 274 | nmdc:mga08y16_2115092_c1 | 3300050511 | Unclassified | 510 |
| 275 | nmdc:mga08y16_297575_c1 | 3300050511 | Bacteria | 1664 |
| 276 | nmdc:mga0n895_302621_c1 | 3300050512 | Bacteria | 1621 |
| 277 | nmdc:mga0n895_406075_c1 | 3300050512 | Bacteria | 1378 |
| 278 | nmdc:mga0n895_471553_c1 | 3300050512 | Bacteria | 1266 |
| 279 | nmdc:mga0n895_496649_c1 | 3300050512 | Bacteria | 1230 |
| 280 | nmdc:mga0rr50_1364099_c1 | 3300050513 | Unclassified | 601 |
| 281 | nmdc:mga08x19_216496_c1 | 3300050514 | Unclassified | 1315 |
| 282 | nmdc:mga0a205_154696_c1 | 3300050515 | Bacteria | 2192 |
| 283 | nmdc:mga0a205_18188_c1 | 3300050515 | Bacteria | 6602 |
| 284 | nmdc:mga0a205_265171_c1 | 3300050515 | Bacteria | 1595 |
| 285 | Ga0495595_0108286 | 3300053084 | Bacteria | 1346 |
| 286 | Ga0495595_0255579 | 3300053084 | Bacteria | 878 |
| 287 | Ga0495619_0022277 | 3300053085 | Unclassified | 4053 |
| 288 | Ga0501082_1396626 | 3300060353 | Unclassified | 611 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009176 | Ga0105242_11079842 | Ga0105242_110798422 | 119 |
| 2 | 3300009176 | Ga0105242_12577066 | Ga0105242_125770661 | 119 |
| 3 | 3300042461 | Ga0439460_0013977 | Ga0439460_0013977_863_1267 | 119 |
| 4 | 3300005471 | Ga0070698_100221213 | Ga0070698_1002212132 | 120 |
| 5 | 3300005844 | Ga0068862_102063163 | Ga0068862_1020631631 | 120 |
| 6 | 3300006880 | Ga0075429_101690117 | Ga0075429_1016901172 | 120 |
| 7 | 3300009177 | Ga0105248_10074133 | Ga0105248_100741334 | 120 |
| 8 | 3300014325 | Ga0163163_13089385 | Ga0163163_130893851 | 120 |
| 9 | 3300025917 | Ga0207660_10066876 | Ga0207660_100668762 | 120 |
| 10 | 3300027907 | Ga0207428_10399053 | Ga0207428_103990532 | 120 |
| 11 | 3300050511 | nmdc:mga08y16_297575_c1 | nmdc:mga08y16_297575_c1_1023_1412 | 120 |
| 12 | 3300005536 | Ga0070697_100241014 | Ga0070697_1002410142 | 121 |
| 13 | 3300006844 | Ga0075428_100103167 | Ga0075428_1001031674 | 121 |
| 14 | 3300009147 | Ga0114129_11761823 | Ga0114129_117618232 | 121 |
| 15 | 3300045976 | Ga0466967_0691375 | Ga0466967_0691375_590_1000 | 121 |
| 16 | 3300005328 | Ga0070676_10456817 | Ga0070676_104568172 | 122 |
| 17 | 3300005335 | Ga0070666_10580604 | Ga0070666_105806041 | 122 |
| 18 | 3300005338 | Ga0068868_100415969 | Ga0068868_1004159692 | 122 |
| 19 | 3300005355 | Ga0070671_100272063 | Ga0070671_1002720633 | 122 |
| 20 | 3300005364 | Ga0070673_102160780 | Ga0070673_1021607801 | 122 |
| 21 | 3300005444 | Ga0070694_100606493 | Ga0070694_1006064931 | 122 |
| 22 | 3300005445 | Ga0070708_100566600 | Ga0070708_1005666002 | 122 |
| 23 | 3300005457 | Ga0070662_101284627 | Ga0070662_1012846271 | 122 |
| 24 | 3300005468 | Ga0070707_100535761 | Ga0070707_1005357612 | 122 |
| 25 | 3300005563 | Ga0068855_100209188 | Ga0068855_1002091883 | 122 |
| 26 | 3300005842 | Ga0068858_101558244 | Ga0068858_1015582441 | 122 |
| 27 | 3300009177 | Ga0105248_11004219 | Ga0105248_110042191 | 122 |
| 28 | 3300017792 | Ga0163161_11057653 | Ga0163161_110576531 | 122 |
| 29 | 3300025903 | Ga0207680_11079618 | Ga0207680_110796182 | 122 |
| 30 | 3300025907 | Ga0207645_10242297 | Ga0207645_102422972 | 122 |
| 31 | 3300025918 | Ga0207662_10606590 | Ga0207662_106065902 | 122 |
| 32 | 3300025922 | Ga0207646_10486739 | Ga0207646_104867392 | 122 |
| 33 | 3300025923 | Ga0207681_10596900 | Ga0207681_105969002 | 122 |
| 34 | 3300025933 | Ga0207706_10055173 | Ga0207706_100551733 | 122 |
| 35 | 3300025941 | Ga0207711_10742118 | Ga0207711_107421182 | 122 |
| 36 | 3300025949 | Ga0207667_10510472 | Ga0207667_105104721 | 122 |
| 37 | 3300026023 | Ga0207677_10384288 | Ga0207677_103842882 | 122 |
| 38 | 3300028380 | Ga0268265_10556211 | Ga0268265_105562112 | 122 |
| 39 | 3300031548 | Ga0307408_100455207 | Ga0307408_1004552072 | 122 |
| 40 | 3300034816 | Ga0373930_0006003 | Ga0373930_0006003_1373_1744 | 122 |
| 41 | 3300034817 | Ga0373948_0001373 | Ga0373948_0001373_2570_2941 | 122 |
| 42 | 3300034818 | Ga0373950_0015487 | Ga0373950_0015487_741_1112 | 122 |
| 43 | 3300034819 | Ga0373958_0018758 | Ga0373958_0018758_342_713 | 122 |
| 44 | 3300034820 | Ga0373959_0003880 | Ga0373959_0003880_1874_2245 | 122 |
| 45 | 3300034957 | Ga0373938_0001711 | Ga0373938_0001711_870_1241 | 122 |
| 46 | 3300035088 | Ga0373940_0002437 | Ga0373940_0002437_2999_3370 | 122 |
| 47 | 3300035090 | Ga0373949_0002541 | Ga0373949_0002541_528_899 | 122 |
| 48 | 3300035091 | Ga0373951_0005682 | Ga0373951_0005682_1230_1601 | 122 |
| 49 | 3300035112 | Ga0373932_0001645 | Ga0373932_0001645_2097_2468 | 122 |
| 50 | 3300035114 | Ga0373939_0000641 | Ga0373939_0000641_4756_5127 | 122 |
| 51 | 3300035115 | Ga0373941_0000778 | Ga0373941_0000778_137_508 | 122 |
| 52 | 3300035121 | Ga0373960_0005074 | Ga0373960_0005074_2492_2863 | 122 |
| 53 | 3300035207 | Ga0373942_0009159 | Ga0373942_0009159_823_1194 | 122 |
| 54 | 3300035242 | Ga0373962_0007290 | Ga0373962_0007290_26_397 | 122 |
| 55 | 3300035691 | Ga0373931_0001890 | Ga0373931_0001890_6408_6779 | 122 |
| 56 | 3300045051 | Ga0451576_0010691 | Ga0451576_0010691_3848_4219 | 122 |
| 57 | 3300046684 | Ga0495669_0215090 | Ga0495669_0215090_485_865 | 122 |
| 58 | 3300048909 | Ga0496106_0155615 | Ga0496106_0155615_918_1298 | 122 |
| 59 | 3300048909 | Ga0496106_0422561 | Ga0496106_0422561_419_799 | 122 |
| 60 | 3300045051 | Ga0451576_0068495 | Ga0451576_0068495_734_1156 | 123 |
| 61 | 3300005545 | Ga0070695_100618061 | Ga0070695_1006180612 | 124 |
| 62 | 3300005618 | Ga0068864_100688253 | Ga0068864_1006882532 | 124 |
| 63 | 3300006931 | Ga0097620_102609748 | Ga0097620_1026097481 | 124 |
| 64 | 3300013297 | Ga0157378_11185667 | Ga0157378_111856672 | 124 |
| 65 | 3300025941 | Ga0207711_10058287 | Ga0207711_100582875 | 124 |
| 66 | 3300025942 | Ga0207689_10166519 | Ga0207689_101665192 | 124 |
| 67 | 3300025942 | Ga0207689_10949558 | Ga0207689_109495581 | 124 |
| 68 | 3300025945 | Ga0207679_10360305 | Ga0207679_103603052 | 124 |
| 69 | 3300025961 | Ga0207712_10291106 | Ga0207712_102911062 | 124 |
| 70 | 3300026035 | Ga0207703_10048939 | Ga0207703_100489392 | 124 |
| 71 | 3300026142 | Ga0207698_12253005 | Ga0207698_122530052 | 124 |
| 72 | 3300047447 | Ga0495685_075151 | Ga0495685_075151_174_572 | 124 |
| 73 | 3300050508 | nmdc:mga09592_418454_c1 | nmdc:mga09592_418454_c1_372_758 | 124 |
| 74 | 3300050509 | nmdc:mga0qj67_1118221_c1 | nmdc:mga0qj67_1118221_c1_103_489 | 124 |
| 75 | 3300005471 | Ga0070698_100005676 | Ga0070698_1000056764 | 125 |
| 76 | 3300005617 | Ga0068859_101098197 | Ga0068859_1010981971 | 125 |
| 77 | 3300006852 | Ga0075433_10060175 | Ga0075433_100601753 | 125 |
| 78 | 3300006871 | Ga0075434_100204223 | Ga0075434_1002042232 | 125 |
| 79 | 3300006931 | Ga0097620_101098212 | Ga0097620_1010982121 | 125 |
| 80 | 3300009147 | Ga0114129_10069625 | Ga0114129_100696254 | 125 |
| 81 | 3300050507 | nmdc:mga05p37_164724_c1 | nmdc:mga05p37_164724_c1_1455_1844 | 125 |
| 82 | 3300050512 | nmdc:mga0n895_406075_c1 | nmdc:mga0n895_406075_c1_554_967 | 125 |
| 83 | 3300050515 | nmdc:mga0a205_154696_c1 | nmdc:mga0a205_154696_c1_1418_1831 | 125 |
| 84 | 3300050515 | nmdc:mga0a205_265171_c1 | nmdc:mga0a205_265171_c1_677_1057 | 125 |
| 85 | 3300005328 | Ga0070676_11405505 | Ga0070676_114055051 | 126 |
| 86 | 3300005334 | Ga0068869_100465455 | Ga0068869_1004654552 | 126 |
| 87 | 3300005338 | Ga0068868_100844341 | Ga0068868_1008443412 | 126 |
| 88 | 3300005338 | Ga0068868_100927338 | Ga0068868_1009273382 | 126 |
| 89 | 3300005345 | Ga0070692_10405215 | Ga0070692_104052152 | 126 |
| 90 | 3300005347 | Ga0070668_100225371 | Ga0070668_1002253712 | 126 |
| 91 | 3300005444 | Ga0070694_100068169 | Ga0070694_1000681692 | 126 |
| 92 | 3300005459 | Ga0068867_100064540 | Ga0068867_1000645403 | 126 |
| 93 | 3300005468 | Ga0070707_100287685 | Ga0070707_1002876852 | 126 |
| 94 | 3300005468 | Ga0070707_100341944 | Ga0070707_1003419442 | 126 |
| 95 | 3300005518 | Ga0070699_100037985 | Ga0070699_1000379852 | 126 |
| 96 | 3300005518 | Ga0070699_100141728 | Ga0070699_1001417282 | 126 |
| 97 | 3300005544 | Ga0070686_101265909 | Ga0070686_1012659092 | 126 |
| 98 | 3300005546 | Ga0070696_100006899 | Ga0070696_1000068997 | 126 |
| 99 | 3300005548 | Ga0070665_100004501 | Ga0070665_1000045011 | 126 |
| 100 | 3300005549 | Ga0070704_100005370 | Ga0070704_1000053707 | 126 |
| 101 | 3300005549 | Ga0070704_100922170 | Ga0070704_1009221701 | 126 |
| 102 | 3300005615 | Ga0070702_100935051 | Ga0070702_1009350511 | 126 |
| 103 | 3300005618 | Ga0068864_100142191 | Ga0068864_1001421911 | 126 |
| 104 | 3300005841 | Ga0068863_100149296 | Ga0068863_1001492964 | 126 |
| 105 | 3300005842 | Ga0068858_100030026 | Ga0068858_1000300263 | 126 |
| 106 | 3300005842 | Ga0068858_100123332 | Ga0068858_1001233324 | 126 |
| 107 | 3300005844 | Ga0068862_100314947 | Ga0068862_1003149473 | 126 |
| 108 | 3300006237 | Ga0097621_100015543 | Ga0097621_1000155433 | 126 |
| 109 | 3300006237 | Ga0097621_100164356 | Ga0097621_1001643563 | 126 |
| 110 | 3300006358 | Ga0068871_100080035 | Ga0068871_1000800353 | 126 |
| 111 | 3300006871 | Ga0075434_100221475 | Ga0075434_1002214752 | 126 |
| 112 | 3300006881 | Ga0068865_100147236 | Ga0068865_1001472361 | 126 |
| 113 | 3300006881 | Ga0068865_100336239 | Ga0068865_1003362392 | 126 |
| 114 | 3300006931 | Ga0097620_100520165 | Ga0097620_1005201652 | 126 |
| 115 | 3300009093 | Ga0105240_10790297 | Ga0105240_107902971 | 126 |
| 116 | 3300009093 | Ga0105240_11499180 | Ga0105240_114991802 | 126 |
| 117 | 3300009098 | Ga0105245_10018560 | Ga0105245_100185603 | 126 |
| 118 | 3300009147 | Ga0114129_10011485 | Ga0114129_100114851 | 126 |
| 119 | 3300009176 | Ga0105242_10003950 | Ga0105242_100039508 | 126 |
| 120 | 3300009176 | Ga0105242_10344997 | Ga0105242_103449972 | 126 |
| 121 | 3300009177 | Ga0105248_10003114 | Ga0105248_100031141 | 126 |
| 122 | 3300009177 | Ga0105248_10171704 | Ga0105248_101717042 | 126 |
| 123 | 3300009177 | Ga0105248_12744293 | Ga0105248_127442931 | 126 |
| 124 | 3300009545 | Ga0105237_10832393 | Ga0105237_108323932 | 126 |
| 125 | 3300009553 | Ga0105249_10497086 | Ga0105249_104970862 | 126 |
| 126 | 3300013296 | Ga0157374_10028114 | Ga0157374_100281144 | 126 |
| 127 | 3300013306 | Ga0163162_11624052 | Ga0163162_116240522 | 126 |
| 128 | 3300013308 | Ga0157375_10164276 | Ga0157375_101642762 | 126 |
| 129 | 3300013308 | Ga0157375_10475454 | Ga0157375_104754542 | 126 |
| 130 | 3300013308 | Ga0157375_10601867 | Ga0157375_106018672 | 126 |
| 131 | 3300013308 | Ga0157375_11712405 | Ga0157375_117124052 | 126 |
| 132 | 3300014325 | Ga0163163_10301989 | Ga0163163_103019892 | 126 |
| 133 | 3300014745 | Ga0157377_10970173 | Ga0157377_109701731 | 126 |
| 134 | 3300014968 | Ga0157379_10025930 | Ga0157379_100259301 | 126 |
| 135 | 3300014968 | Ga0157379_10081390 | Ga0157379_100813903 | 126 |
| 136 | 3300014969 | Ga0157376_10033873 | Ga0157376_100338734 | 126 |
| 137 | 3300014969 | Ga0157376_10091042 | Ga0157376_100910422 | 126 |
| 138 | 3300025905 | Ga0207685_10049073 | Ga0207685_100490732 | 126 |
| 139 | 3300025922 | Ga0207646_10368220 | Ga0207646_103682202 | 126 |
| 140 | 3300025923 | Ga0207681_10825486 | Ga0207681_108254862 | 126 |
| 141 | 3300025927 | Ga0207687_10020064 | Ga0207687_100200643 | 126 |
| 142 | 3300025927 | Ga0207687_10253036 | Ga0207687_102530362 | 126 |
| 143 | 3300025934 | Ga0207686_10009654 | Ga0207686_100096544 | 126 |
| 144 | 3300025934 | Ga0207686_10020338 | Ga0207686_100203382 | 126 |
| 145 | 3300025938 | Ga0207704_10006763 | Ga0207704_100067635 | 126 |
| 146 | 3300025938 | Ga0207704_10226314 | Ga0207704_102263142 | 126 |
| 147 | 3300025941 | Ga0207711_10063389 | Ga0207711_100633892 | 126 |
| 148 | 3300025941 | Ga0207711_10348117 | Ga0207711_103481172 | 126 |
| 149 | 3300025945 | Ga0207679_10389151 | Ga0207679_103891512 | 126 |
| 150 | 3300025961 | Ga0207712_10413953 | Ga0207712_104139532 | 126 |
| 151 | 3300026023 | Ga0207677_10058871 | Ga0207677_100588713 | 126 |
| 152 | 3300026023 | Ga0207677_10073711 | Ga0207677_100737112 | 126 |
| 153 | 3300026023 | Ga0207677_11217378 | Ga0207677_112173782 | 126 |
| 154 | 3300026023 | Ga0207677_11691940 | Ga0207677_116919401 | 126 |
| 155 | 3300026035 | Ga0207703_10020798 | Ga0207703_100207983 | 126 |
| 156 | 3300026035 | Ga0207703_10254869 | Ga0207703_102548691 | 126 |
| 157 | 3300026089 | Ga0207648_10061714 | Ga0207648_100617143 | 126 |
| 158 | 3300026095 | Ga0207676_10034722 | Ga0207676_100347223 | 126 |
| 159 | 3300026095 | Ga0207676_10521789 | Ga0207676_105217892 | 126 |
| 160 | 3300026118 | Ga0207675_100334889 | Ga0207675_1003348892 | 126 |
| 161 | 3300026142 | Ga0207698_12082565 | Ga0207698_120825651 | 126 |
| 162 | 3300028380 | Ga0268265_10833988 | Ga0268265_108339882 | 126 |
| 163 | 3300028380 | Ga0268265_11292942 | Ga0268265_112929421 | 126 |
| 164 | 3300028381 | Ga0268264_11756988 | Ga0268264_117569881 | 126 |
| 165 | 3300035116 | Ga0373945_0048816 | Ga0373945_0048816_789_1178 | 126 |
| 166 | 3300035170 | Ga0373943_0295533 | Ga0373943_0295533_183_578 | 126 |
| 167 | 3300035410 | Ga0373924_0201207 | Ga0373924_0201207_345_737 | 126 |
| 168 | 3300035692 | Ga0373935_0448293 | Ga0373935_0448293_177_572 | 126 |
| 169 | 3300035724 | Ga0373933_0371097 | Ga0373933_0371097_179_574 | 126 |
| 170 | 3300035725 | Ga0373947_0309981 | Ga0373947_0309981_50_439 | 126 |
| 171 | 3300035725 | Ga0373947_0862565 | Ga0373947_0862565_183_572 | 126 |
| 172 | 3300036401 | Ga0373937_0112490 | Ga0373937_0112490_892_1281 | 126 |
| 173 | 3300037068 | Ga0373925_0274514 | Ga0373925_0274514_460_849 | 126 |
| 174 | 3300042876 | Ga0451577_0879314 | Ga0451577_0879314_103_495 | 126 |
| 175 | 3300044712 | Ga0453684_2565115 | Ga0453684_2565115_46_438 | 126 |
| 176 | 3300045051 | Ga0451576_0029829 | Ga0451576_0029829_384_776 | 126 |
| 177 | 3300046459 | Ga0495629_0472371 | Ga0495629_0472371_349_744 | 126 |
| 178 | 3300046459 | Ga0495629_0520828 | Ga0495629_0520828_275_664 | 126 |
| 179 | 3300046472 | Ga0495580_0538879 | Ga0495580_0538879_188_583 | 126 |
| 180 | 3300046473 | Ga0495582_0226384 | Ga0495582_0226384_576_971 | 126 |
| 181 | 3300046473 | Ga0495582_0557910 | Ga0495582_0557910_224_613 | 126 |
| 182 | 3300046475 | Ga0495639_0261688 | Ga0495639_0261688_50_442 | 126 |
| 183 | 3300046475 | Ga0495639_0481585 | Ga0495639_0481585_95_490 | 126 |
| 184 | 3300046499 | Ga0495594_0380935 | Ga0495594_0380935_318_713 | 126 |
| 185 | 3300046535 | Ga0495586_0629922 | Ga0495586_0629922_200_589 | 126 |
| 186 | 3300046681 | Ga0495647_0426789 | Ga0495647_0426789_185_574 | 126 |
| 187 | 3300046683 | Ga0495658_0009839 | Ga0495658_0009839_799_1188 | 126 |
| 188 | 3300046683 | Ga0495658_0041975 | Ga0495658_0041975_1373_1768 | 126 |
| 189 | 3300046683 | Ga0495658_0124454 | Ga0495658_0124454_66_455 | 126 |
| 190 | 3300046689 | Ga0495613_0320563 | Ga0495613_0320563_19_408 | 126 |
| 191 | 3300047319 | Ga0495674_0879174 | Ga0495674_0879174_111_506 | 126 |
| 192 | 3300048903 | Ga0496100_0026130 | Ga0496100_0026130_2625_3020 | 126 |
| 193 | 3300048904 | Ga0496101_0031652 | Ga0496101_0031652_3096_3491 | 126 |
| 194 | 3300048904 | Ga0496101_1001890 | Ga0496101_1001890_250_639 | 126 |
| 195 | 3300048907 | Ga0496104_0151728 | Ga0496104_0151728_1299_1682 | 126 |
| 196 | 3300048909 | Ga0496106_0442563 | Ga0496106_0442563_360_755 | 126 |
| 197 | 3300048915 | Ga0496112_0828003 | Ga0496112_0828003_95_484 | 126 |
| 198 | 3300048917 | Ga0496114_0000426 | Ga0496114_0000426_3252_3647 | 126 |
| 199 | 3300048917 | Ga0496114_0369985 | Ga0496114_0369985_844_1227 | 126 |
| 200 | 3300048917 | Ga0496114_0381592 | Ga0496114_0381592_94_483 | 126 |
| 201 | 3300048918 | Ga0496115_0050220 | Ga0496115_0050220_2847_3236 | 126 |
| 202 | 3300048918 | Ga0496115_0702803 | Ga0496115_0702803_251_646 | 126 |
| 203 | 3300049568 | Ga0501031_0684812 | Ga0501031_0684812_72_461 | 126 |
| 204 | 3300049580 | Ga0501046_0461992 | Ga0501046_0461992_410_799 | 126 |
| 205 | 3300049582 | Ga0501048_0033943 | Ga0501048_0033943_1142_1531 | 126 |
| 206 | 3300049586 | Ga0501070_1205782 | Ga0501070_1205782_74_463 | 126 |
| 207 | 3300049587 | Ga0501071_0087705 | Ga0501071_0087705_592_984 | 126 |
| 208 | 3300049588 | Ga0501072_0028466 | Ga0501072_0028466_130_519 | 126 |
| 209 | 3300049592 | Ga0501076_0036890 | Ga0501076_0036890_41_430 | 126 |
| 210 | 3300049743 | Ga0501081_0275475 | Ga0501081_0275475_34_423 | 126 |
| 211 | 3300049824 | Ga0501045_0591824 | Ga0501045_0591824_315_704 | 126 |
| 212 | 3300050507 | nmdc:mga05p37_64865_c1 | nmdc:mga05p37_64865_c1_2160_2546 | 126 |
| 213 | 3300050512 | nmdc:mga0n895_302621_c1 | nmdc:mga0n895_302621_c1_1041_1427 | 126 |
| 214 | 3300050512 | nmdc:mga0n895_496649_c1 | nmdc:mga0n895_496649_c1_317_709 | 126 |
| 215 | 3300050513 | nmdc:mga0rr50_1364099_c1 | nmdc:mga0rr50_1364099_c1_198_590 | 126 |
| 216 | 3300050514 | nmdc:mga08x19_216496_c1 | nmdc:mga08x19_216496_c1_32_424 | 126 |
| 217 | 3300050515 | nmdc:mga0a205_18188_c1 | nmdc:mga0a205_18188_c1_2564_2950 | 126 |
| 218 | 3300053084 | Ga0495595_0108286 | Ga0495595_0108286_162_551 | 126 |
| 219 | 3300053084 | Ga0495595_0255579 | Ga0495595_0255579_150_545 | 126 |
| 220 | 3300053085 | Ga0495619_0022277 | Ga0495619_0022277_1189_1578 | 126 |
| 221 | 3300060353 | Ga0501082_1396626 | Ga0501082_1396626_194_583 | 126 |
| 222 | 3300005328 | Ga0070676_10072767 | Ga0070676_100727672 | 127 |
| 223 | 3300005329 | Ga0070683_101215256 | Ga0070683_1012152562 | 127 |
| 224 | 3300005335 | Ga0070666_10722646 | Ga0070666_107226462 | 127 |
| 225 | 3300005336 | Ga0070680_100415145 | Ga0070680_1004151452 | 127 |
| 226 | 3300005347 | Ga0070668_100528241 | Ga0070668_1005282412 | 127 |
| 227 | 3300005353 | Ga0070669_100012355 | Ga0070669_1000123553 | 127 |
| 228 | 3300005353 | Ga0070669_100090166 | Ga0070669_1000901662 | 127 |
| 229 | 3300005354 | Ga0070675_100043661 | Ga0070675_1000436613 | 127 |
| 230 | 3300005364 | Ga0070673_100088987 | Ga0070673_1000889873 | 127 |
| 231 | 3300005367 | Ga0070667_102053371 | Ga0070667_1020533711 | 127 |
| 232 | 3300005438 | Ga0070701_10079087 | Ga0070701_100790872 | 127 |
| 233 | 3300005440 | Ga0070705_100199318 | Ga0070705_1001993181 | 127 |
| 234 | 3300005441 | Ga0070700_100051083 | Ga0070700_1000510832 | 127 |
| 235 | 3300005441 | Ga0070700_100082989 | Ga0070700_1000829892 | 127 |
| 236 | 3300005444 | Ga0070694_100008133 | Ga0070694_1000081335 | 127 |
| 237 | 3300005455 | Ga0070663_100508713 | Ga0070663_1005087132 | 127 |
| 238 | 3300005459 | Ga0068867_100007610 | Ga0068867_1000076106 | 127 |
| 239 | 3300005471 | Ga0070698_100296941 | Ga0070698_1002969412 | 127 |
| 240 | 3300005518 | Ga0070699_100002788 | Ga0070699_1000027885 | 127 |
| 241 | 3300005536 | Ga0070697_100185587 | Ga0070697_1001855873 | 127 |
| 242 | 3300005536 | Ga0070697_100327532 | Ga0070697_1003275322 | 127 |
| 243 | 3300005545 | Ga0070695_100007086 | Ga0070695_1000070863 | 127 |
| 244 | 3300005546 | Ga0070696_100009670 | Ga0070696_1000096706 | 127 |
| 245 | 3300005546 | Ga0070696_100080642 | Ga0070696_1000806422 | 127 |
| 246 | 3300005549 | Ga0070704_102244817 | Ga0070704_1022448171 | 127 |
| 247 | 3300005578 | Ga0068854_100801590 | Ga0068854_1008015902 | 127 |
| 248 | 3300005615 | Ga0070702_100000780 | Ga0070702_1000007805 | 127 |
| 249 | 3300005618 | Ga0068864_101466556 | Ga0068864_1014665562 | 127 |
| 250 | 3300005719 | Ga0068861_100003492 | Ga0068861_1000034921 | 127 |
| 251 | 3300005844 | Ga0068862_102003568 | Ga0068862_1020035681 | 127 |
| 252 | 3300006881 | Ga0068865_100568713 | Ga0068865_1005687131 | 127 |
| 253 | 3300006881 | Ga0068865_101594568 | Ga0068865_1015945681 | 127 |
| 254 | 3300009094 | Ga0111539_12538100 | Ga0111539_125381001 | 127 |
| 255 | 3300009147 | Ga0114129_10248421 | Ga0114129_102484212 | 127 |
| 256 | 3300009148 | Ga0105243_10265757 | Ga0105243_102657572 | 127 |
| 257 | 3300013297 | Ga0157378_10521356 | Ga0157378_105213562 | 127 |
| 258 | 3300014325 | Ga0163163_10003026 | Ga0163163_100030267 | 127 |
| 259 | 3300014326 | Ga0157380_10162423 | Ga0157380_101624232 | 127 |
| 260 | 3300014968 | Ga0157379_10201488 | Ga0157379_102014881 | 127 |
| 261 | 3300025315 | Ga0207697_10077838 | Ga0207697_100778382 | 127 |
| 262 | 3300025907 | Ga0207645_10020856 | Ga0207645_100208562 | 127 |
| 263 | 3300025907 | Ga0207645_10032440 | Ga0207645_100324402 | 127 |
| 264 | 3300025923 | Ga0207681_10087095 | Ga0207681_100870952 | 127 |
| 265 | 3300025923 | Ga0207681_10099631 | Ga0207681_100996311 | 127 |
| 266 | 3300025933 | Ga0207706_10030677 | Ga0207706_100306773 | 127 |
| 267 | 3300025933 | Ga0207706_10498046 | Ga0207706_104980462 | 127 |
| 268 | 3300025935 | Ga0207709_10032719 | Ga0207709_100327192 | 127 |
| 269 | 3300025937 | Ga0207669_10229851 | Ga0207669_102298513 | 127 |
| 270 | 3300025940 | Ga0207691_10594828 | Ga0207691_105948282 | 127 |
| 271 | 3300025941 | Ga0207711_10289533 | Ga0207711_102895332 | 127 |
| 272 | 3300025944 | Ga0207661_11619529 | Ga0207661_116195292 | 127 |
| 273 | 3300025960 | Ga0207651_10625579 | Ga0207651_106255792 | 127 |
| 274 | 3300025981 | Ga0207640_10110302 | Ga0207640_101103022 | 127 |
| 275 | 3300025986 | Ga0207658_10622570 | Ga0207658_106225701 | 127 |
| 276 | 3300026075 | Ga0207708_10023085 | Ga0207708_100230853 | 127 |
| 277 | 3300026089 | Ga0207648_10006927 | Ga0207648_100069278 | 127 |
| 278 | 3300026118 | Ga0207675_100005615 | Ga0207675_1000056153 | 127 |
| 279 | 3300028379 | Ga0268266_11259356 | Ga0268266_112593561 | 127 |
| 280 | 3300028380 | Ga0268265_10032239 | Ga0268265_100322392 | 127 |
| 281 | 3300028380 | Ga0268265_12022035 | Ga0268265_120220351 | 127 |
| 282 | 3300045051 | Ga0451576_0322686 | Ga0451576_0322686_563_973 | 127 |
| 283 | 3300045976 | Ga0466967_0804983 | Ga0466967_0804983_166_567 | 127 |
| 284 | 3300046537 | Ga0495598_0167104 | Ga0495598_0167104_78_494 | 127 |
| 285 | 3300048915 | Ga0496112_1143300 | Ga0496112_1143300_70_486 | 127 |
| 286 | 3300050507 | nmdc:mga05p37_240872_c1 | nmdc:mga05p37_240872_c1_309_722 | 127 |
| 287 | 3300050511 | nmdc:mga08y16_2115092_c1 | nmdc:mga08y16_2115092_c1_64_465 | 127 |
| 288 | 3300050512 | nmdc:mga0n895_471553_c1 | nmdc:mga0n895_471553_c1_166_576 | 127 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wnq-assembly1.cif.gz_P | e. coli atp synthase state 2a | 0.5602 | 52 | 114 |
| 6wnq-assembly1.cif.gz_S | e. coli atp synthase state 2a | 0.5477 | 52 | 114 |
| 6fkf-assembly1.cif.gz_L | chloroplast f1fo conformation 1 | 0.5471 | 50 | 119 |
| 6vm4-assembly1.cif.gz_V | chloroplast atp synthase (c2, cf1fo) | 0.5247 | 50 | 119 |
| 6voj-assembly1.cif.gz_M | chloroplast atp synthase (r3, cf1fo) | 0.5164 | 50 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fkfL01 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.553 | 50 | 118 | 1.20.20.10 |
| 6cp6O00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.5245 | 55 | 111 | 1.20.20.10 |
| 6cp6Q00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.5149 | 50 | 111 | 1.20.20.10 |
| 6fkfL01 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.4892 | 50 | 118 | 1.20.20.10 |
| af_P86050_27_132_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4832 | 51 | 115 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A843SWY8-F1-model_v4 | DUF983 domain-containing protein | 0.9797 | 2 | 125 |
GO:0016020
|
| AF-A0A843SWY8-F1-model_v4 | DUF983 domain-containing protein | 0.972 | 2 | 125 |
GO:0016020
|
| AF-A0A1Q7AKG4-F1-model_v4 | DUF983 domain-containing protein | 0.9536 | 5 | 127 |
GO:0016020
|
| AF-A0A2D7IN05-F1-model_v4 | DUF983 domain-containing protein | 0.9221 | 5 | 115 |
GO:0016020
|
| AF-A0A1Q7AKG4-F1-model_v4 | DUF983 domain-containing protein | 0.9177 | 5 | 127 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar