F388484

General Info

Members Datasets Scaffolds Average Seq Length
288 171 288 131

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_102063163|Ga0068862_1020631631
Length 129
Sequence LLTALRRGLRKRCPHCGEGRLFSGWSQFERCATCGLVFTRNPGDTWAFTIFGDRLPIAVIIVVIYFGVMVSHPVPGMMLMAXXXXVLIWTAPNRWGAGIALHYLSRVYWPDPADPIPSSRATGAGDAEP

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
104 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.86
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10072767 3300005328 Unclassified 2067
2 Ga0070676_10456817 3300005328 Bacteria 899
3 Ga0070676_11405505 3300005328 Bacteria 535
4 Ga0070683_101215256 3300005329 Unclassified 724
5 Ga0068869_100465455 3300005334 Bacteria 1050
6 Ga0070666_10580604 3300005335 Unclassified 817
7 Ga0070666_10722646 3300005335 Bacteria 731
8 Ga0070680_100415145 3300005336 Unclassified 1148
9 Ga0068868_100415969 3300005338 Unclassified 1163
10 Ga0068868_100844341 3300005338 Bacteria 829
11 Ga0068868_100927338 3300005338 Bacteria 793
12 Ga0070692_10405215 3300005345 Unclassified 862
13 Ga0070668_100225371 3300005347 Bacteria 1548
14 Ga0070668_100528241 3300005347 Unclassified 1024
15 Ga0070669_100012355 3300005353 Bacteria 6058
16 Ga0070669_100090166 3300005353 Unclassified 2297
17 Ga0070675_100043661 3300005354 Bacteria 3664
18 Ga0070671_100272063 3300005355 Unclassified 1440
19 Ga0070673_100088987 3300005364 Unclassified 2519
20 Ga0070673_102160780 3300005364 Unclassified 529
21 Ga0070667_102053371 3300005367 Unclassified 538
22 Ga0070701_10079087 3300005438 Bacteria 1776
23 Ga0070705_100199318 3300005440 Unclassified 1371
24 Ga0070700_100051083 3300005441 Unclassified 2573
25 Ga0070700_100082989 3300005441 Unclassified 2073
26 Ga0070694_100008133 3300005444 Bacteria 6407
27 Ga0070694_100068169 3300005444 Bacteria 2444
28 Ga0070694_100606493 3300005444 Bacteria 882
29 Ga0070708_100566600 3300005445 Unclassified 1071
30 Ga0070663_100508713 3300005455 Bacteria 1001
31 Ga0070662_101284627 3300005457 Bacteria 630
32 Ga0068867_100007610 3300005459 Bacteria 7661
33 Ga0068867_100064540 3300005459 Bacteria 2723
34 Ga0070707_100287685 3300005468 Bacteria 1597
35 Ga0070707_100341944 3300005468 Unclassified 1453
36 Ga0070707_100535761 3300005468 Unclassified 1133
37 Ga0070698_100005676 3300005471 Bacteria 13663
38 Ga0070698_100221213 3300005471 Bacteria 1827
39 Ga0070698_100296941 3300005471 Bacteria 1546
40 Ga0070699_100002788 3300005518 Bacteria 15588
41 Ga0070699_100037985 3300005518 Bacteria 4169
42 Ga0070699_100141728 3300005518 Unclassified 2123
43 Ga0070697_100185587 3300005536 Unclassified 1764
44 Ga0070697_100241014 3300005536 Bacteria 1544
45 Ga0070697_100327532 3300005536 Bacteria 1320
46 Ga0070686_101265909 3300005544 Bacteria 615
47 Ga0070695_100007086 3300005545 Bacteria 6644
48 Ga0070695_100618061 3300005545 Bacteria 852
49 Ga0070696_100006899 3300005546 Bacteria 7580
50 Ga0070696_100009670 3300005546 Bacteria 6449
51 Ga0070696_100080642 3300005546 Unclassified 2304
52 Ga0070665_100004501 3300005548 Bacteria 14627
53 Ga0070704_100005370 3300005549 Bacteria 7464
54 Ga0070704_100922170 3300005549 Unclassified 787
55 Ga0070704_102244817 3300005549 Bacteria 508
56 Ga0068855_100209188 3300005563 Bacteria 2193
57 Ga0068854_100801590 3300005578 Unclassified 821
58 Ga0070702_100000780 3300005615 Bacteria 12091
59 Ga0070702_100935051 3300005615 Unclassified 681
60 Ga0068859_101098197 3300005617 Bacteria 875
61 Ga0068864_100142191 3300005618 Bacteria 2165
62 Ga0068864_100688253 3300005618 Bacteria 998
63 Ga0068864_101466556 3300005618 Unclassified 685
64 Ga0068861_100003492 3300005719 Bacteria 10439
65 Ga0068863_100149296 3300005841 Bacteria 2236
66 Ga0068858_100030026 3300005842 Bacteria 5047
67 Ga0068858_100123332 3300005842 Bacteria 2424
68 Ga0068858_101558244 3300005842 Unclassified 652
69 Ga0068862_100314947 3300005844 Bacteria 1443
70 Ga0068862_102003568 3300005844 Unclassified 590
71 Ga0068862_102063163 3300005844 Bacteria 581
72 Ga0097621_100015543 3300006237 Bacteria 5730
73 Ga0097621_100164356 3300006237 Bacteria 1910
74 Ga0068871_100080035 3300006358 Bacteria 2704
75 Ga0075428_100103167 3300006844 Bacteria 3110
76 Ga0075433_10060175 3300006852 Bacteria 3325
77 Ga0075434_100204223 3300006871 Bacteria 1996
78 Ga0075434_100221475 3300006871 Bacteria 1912
79 Ga0075429_101690117 3300006880 Bacteria 550
80 Ga0068865_100147236 3300006881 Bacteria 1782
81 Ga0068865_100336239 3300006881 Bacteria 1219
82 Ga0068865_100568713 3300006881 Bacteria 954
83 Ga0068865_101594568 3300006881 Unclassified 587
84 Ga0097620_100520165 3300006931 Unclassified 1285
85 Ga0097620_101098212 3300006931 Bacteria 875
86 Ga0097620_102609748 3300006931 Bacteria 556
87 Ga0105240_10790297 3300009093 Bacteria 1029
88 Ga0105240_11499180 3300009093 Bacteria 707
89 Ga0111539_12538100 3300009094 Unclassified 594
90 Ga0105245_10018560 3300009098 Bacteria 6083
91 Ga0114129_10011485 3300009147 Bacteria 12609
92 Ga0114129_10069625 3300009147 Bacteria 4904
93 Ga0114129_10248421 3300009147 Bacteria 2389
94 Ga0114129_11761823 3300009147 Bacteria 754
95 Ga0105243_10265757 3300009148 Unclassified 1538
96 Ga0105242_10003950 3300009176 Bacteria 11517
97 Ga0105242_10344997 3300009176 Bacteria 1373
98 Ga0105242_11079842 3300009176 Unclassified 815
99 Ga0105242_12577066 3300009176 Bacteria 557
100 Ga0105248_10003114 3300009177 Bacteria 18368
101 Ga0105248_10074133 3300009177 Unclassified 3825
102 Ga0105248_10171704 3300009177 Bacteria 2444
103 Ga0105248_11004219 3300009177 Bacteria 943
104 Ga0105248_12744293 3300009177 Unclassified 562
105 Ga0105237_10832393 3300009545 Bacteria 930
106 Ga0105249_10497086 3300009553 Bacteria 1264
107 Ga0157374_10028114 3300013296 Bacteria 5079
108 Ga0157378_10521356 3300013297 Bacteria 1190
109 Ga0157378_11185667 3300013297 Unclassified 803
110 Ga0163162_11624052 3300013306 Bacteria 737
111 Ga0157375_10164276 3300013308 Bacteria 2364
112 Ga0157375_10475454 3300013308 Bacteria 1415
113 Ga0157375_10601867 3300013308 Bacteria 1258
114 Ga0157375_11712405 3300013308 Bacteria 744
115 Ga0163163_10003026 3300014325 Bacteria 14242
116 Ga0163163_10301989 3300014325 Bacteria 1653
117 Ga0163163_13089385 3300014325 Unclassified 519
118 Ga0157380_10162423 3300014326 Bacteria 1943
119 Ga0157377_10970173 3300014745 Bacteria 641
120 Ga0157379_10025930 3300014968 Bacteria 5213
121 Ga0157379_10081390 3300014968 Bacteria 2901
122 Ga0157379_10201488 3300014968 Bacteria 1800
123 Ga0157376_10033873 3300014969 Unclassified 4118
124 Ga0157376_10091042 3300014969 Bacteria 2641
125 Ga0163161_11057653 3300017792 Unclassified 695
126 Ga0207697_10077838 3300025315 Unclassified 1395
127 Ga0207680_11079618 3300025903 Unclassified 574
128 Ga0207685_10049073 3300025905 Bacteria 1620
129 Ga0207645_10020856 3300025907 Bacteria 4281
130 Ga0207645_10032440 3300025907 Unclassified 3357
131 Ga0207645_10242297 3300025907 Bacteria 1191
132 Ga0207660_10066876 3300025917 Bacteria 2601
133 Ga0207662_10606590 3300025918 Bacteria 762
134 Ga0207646_10368220 3300025922 Bacteria 1298
135 Ga0207646_10486739 3300025922 Bacteria 1112
136 Ga0207681_10087095 3300025923 Unclassified 2221
137 Ga0207681_10099631 3300025923 Bacteria 2093
138 Ga0207681_10596900 3300025923 Bacteria 912
139 Ga0207681_10825486 3300025923 Unclassified 775
140 Ga0207687_10020064 3300025927 Bacteria 4432
141 Ga0207687_10253036 3300025927 Bacteria 1401
142 Ga0207706_10030677 3300025933 Bacteria 4794
143 Ga0207706_10055173 3300025933 Bacteria 3505
144 Ga0207706_10498046 3300025933 Bacteria 1052
145 Ga0207686_10009654 3300025934 Bacteria 5240
146 Ga0207686_10020338 3300025934 Unclassified 3790
147 Ga0207709_10032719 3300025935 Bacteria 3048
148 Ga0207669_10229851 3300025937 Bacteria 1368
149 Ga0207704_10006763 3300025938 Bacteria 5374
150 Ga0207704_10226314 3300025938 Bacteria 1388
151 Ga0207691_10594828 3300025940 Unclassified 937
152 Ga0207711_10058287 3300025941 Unclassified 3323
153 Ga0207711_10063389 3300025941 Bacteria 3190
154 Ga0207711_10289533 3300025941 Unclassified 1509
155 Ga0207711_10348117 3300025941 Bacteria 1372
156 Ga0207711_10742118 3300025941 Bacteria 915
157 Ga0207689_10166519 3300025942 Bacteria 1816
158 Ga0207689_10949558 3300025942 Unclassified 725
159 Ga0207661_11619529 3300025944 Unclassified 592
160 Ga0207679_10360305 3300025945 Bacteria 1270
161 Ga0207679_10389151 3300025945 Bacteria 1224
162 Ga0207667_10510472 3300025949 Bacteria 1218
163 Ga0207651_10625579 3300025960 Bacteria 943
164 Ga0207712_10291106 3300025961 Bacteria 1336
165 Ga0207712_10413953 3300025961 Bacteria 1136
166 Ga0207640_10110302 3300025981 Bacteria 1949
167 Ga0207658_10622570 3300025986 Unclassified 971
168 Ga0207677_10058871 3300026023 Bacteria 2648
169 Ga0207677_10073711 3300026023 Bacteria 2419
170 Ga0207677_10384288 3300026023 Unclassified 1186
171 Ga0207677_11217378 3300026023 Bacteria 690
172 Ga0207677_11691940 3300026023 Bacteria 586
173 Ga0207703_10020798 3300026035 Bacteria 5134
174 Ga0207703_10048939 3300026035 Bacteria 3415
175 Ga0207703_10254869 3300026035 Bacteria 1583
176 Ga0207708_10023085 3300026075 Bacteria 4699
177 Ga0207648_10006927 3300026089 Bacteria 11228
178 Ga0207648_10061714 3300026089 Bacteria 3268
179 Ga0207676_10034722 3300026095 Bacteria 3819
180 Ga0207676_10521789 3300026095 Bacteria 1131
181 Ga0207675_100005615 3300026118 Bacteria 12010
182 Ga0207675_100334889 3300026118 Bacteria 1480
183 Ga0207698_12082565 3300026142 Bacteria 581
184 Ga0207698_12253005 3300026142 Bacteria 557
185 Ga0207428_10399053 3300027907 Bacteria 1007
186 Ga0268266_11259356 3300028379 Unclassified 715
187 Ga0268265_10032239 3300028380 Bacteria 3794
188 Ga0268265_10556211 3300028380 Bacteria 1090
189 Ga0268265_10833988 3300028380 Unclassified 901
190 Ga0268265_11292942 3300028380 Unclassified 729
191 Ga0268265_12022035 3300028380 Unclassified 583
192 Ga0268264_11756988 3300028381 Bacteria 630
193 Ga0307408_100455207 3300031548 Bacteria 1111
194 Ga0373930_0006003 3300034816 Unclassified 2038
195 Ga0373948_0001373 3300034817 Unclassified 3352
196 Ga0373950_0015487 3300034818 Unclassified 1294
197 Ga0373958_0018758 3300034819 Unclassified 1257
198 Ga0373959_0003880 3300034820 Unclassified 2393
199 Ga0373938_0001711 3300034957 Unclassified 3508
200 Ga0373940_0002437 3300035088 Bacteria 3616
201 Ga0373949_0002541 3300035090 Unclassified 4641
202 Ga0373951_0005682 3300035091 Unclassified 2887
203 Ga0373932_0001645 3300035112 Bacteria 6122
204 Ga0373939_0000641 3300035114 Bacteria 8701
205 Ga0373941_0000778 3300035115 Bacteria 6524
206 Ga0373945_0048816 3300035116 Bacteria 1552
207 Ga0373960_0005074 3300035121 Unclassified 3033
208 Ga0373943_0295533 3300035170 Bacteria 919
209 Ga0373942_0009159 3300035207 Unclassified 2313
210 Ga0373962_0007290 3300035242 Unclassified 2706
211 Ga0373924_0201207 3300035410 Bacteria 879
212 Ga0373931_0001890 3300035691 Bacteria 9153
213 Ga0373935_0448293 3300035692 Bacteria 932
214 Ga0373933_0371097 3300035724 Bacteria 931
215 Ga0373947_0309981 3300035725 Unclassified 1054
216 Ga0373947_0862565 3300035725 Bacteria 618
217 Ga0373937_0112490 3300036401 Bacteria 2533
218 Ga0373925_0274514 3300037068 Bacteria 1357
219 Ga0439460_0013977 3300042461 Bacteria 2107
220 Ga0451577_0879314 3300042876 Unclassified 807
221 Ga0453684_2565115 3300044712 Unclassified 502
222 Ga0451576_0010691 3300045051 Bacteria 10511
223 Ga0451576_0029829 3300045051 Bacteria 5834
224 Ga0451576_0068495 3300045051 Bacteria 3693
225 Ga0451576_0322686 3300045051 Bacteria 1616
226 Ga0466967_0691375 3300045976 Bacteria 1010
227 Ga0466967_0804983 3300045976 Bacteria 933
228 Ga0495629_0472371 3300046459 Bacteria 848
229 Ga0495629_0520828 3300046459 Bacteria 800
230 Ga0495580_0538879 3300046472 Bacteria 776
231 Ga0495582_0226384 3300046473 Bacteria 1071
232 Ga0495582_0557910 3300046473 Bacteria 663
233 Ga0495639_0261688 3300046475 Bacteria 857
234 Ga0495639_0481585 3300046475 Unclassified 632
235 Ga0495594_0380935 3300046499 Bacteria 803
236 Ga0495586_0629922 3300046535 Unclassified 620
237 Ga0495598_0167104 3300046537 Unclassified 778
238 Ga0495647_0426789 3300046681 Unclassified 611
239 Ga0495658_0009839 3300046683 Bacteria 4769
240 Ga0495658_0041975 3300046683 Bacteria 2552
241 Ga0495658_0124454 3300046683 Unclassified 1563
242 Ga0495669_0215090 3300046684 Bacteria 920
243 Ga0495613_0320563 3300046689 Bacteria 1070
244 Ga0495674_0879174 3300047319 Bacteria 693
245 Ga0495685_075151 3300047447 Bacteria 1129
246 Ga0496100_0026130 3300048903 Bacteria 3577
247 Ga0496101_0031652 3300048904 Bacteria 3720
248 Ga0496101_1001890 3300048904 Bacteria 657
249 Ga0496104_0151728 3300048907 Bacteria 2224
250 Ga0496106_0155615 3300048909 Bacteria 1805
251 Ga0496106_0422561 3300048909 Bacteria 1071
252 Ga0496106_0442563 3300048909 Bacteria 1044
253 Ga0496112_0828003 3300048915 Bacteria 850
254 Ga0496112_1143300 3300048915 Bacteria 696
255 Ga0496114_0000426 3300048917 Bacteria 31103
256 Ga0496114_0369985 3300048917 Bacteria 1268
257 Ga0496114_0381592 3300048917 Bacteria 1248
258 Ga0496115_0050220 3300048918 Unclassified 3341
259 Ga0496115_0702803 3300048918 Bacteria 795
260 Ga0501031_0684812 3300049568 Bacteria 658
261 Ga0501046_0461992 3300049580 Unclassified 912
262 Ga0501048_0033943 3300049582 Bacteria 3684
263 Ga0501070_1205782 3300049586 Unclassified 581
264 Ga0501071_0087705 3300049587 Unclassified 2283
265 Ga0501072_0028466 3300049588 Bacteria 4363
266 Ga0501076_0036890 3300049592 Bacteria 3832
267 Ga0501081_0275475 3300049743 Bacteria 1231
268 Ga0501045_0591824 3300049824 Unclassified 822
269 nmdc:mga05p37_164724_c1 3300050507 Unclassified 2706
270 nmdc:mga05p37_240872_c1 3300050507 Bacteria 2175
271 nmdc:mga05p37_64865_c1 3300050507 Bacteria 4494
272 nmdc:mga09592_418454_c1 3300050508 Bacteria 1158
273 nmdc:mga0qj67_1118221_c1 3300050509 Unclassified 615
274 nmdc:mga08y16_2115092_c1 3300050511 Unclassified 510
275 nmdc:mga08y16_297575_c1 3300050511 Bacteria 1664
276 nmdc:mga0n895_302621_c1 3300050512 Bacteria 1621
277 nmdc:mga0n895_406075_c1 3300050512 Bacteria 1378
278 nmdc:mga0n895_471553_c1 3300050512 Bacteria 1266
279 nmdc:mga0n895_496649_c1 3300050512 Bacteria 1230
280 nmdc:mga0rr50_1364099_c1 3300050513 Unclassified 601
281 nmdc:mga08x19_216496_c1 3300050514 Unclassified 1315
282 nmdc:mga0a205_154696_c1 3300050515 Bacteria 2192
283 nmdc:mga0a205_18188_c1 3300050515 Bacteria 6602
284 nmdc:mga0a205_265171_c1 3300050515 Bacteria 1595
285 Ga0495595_0108286 3300053084 Bacteria 1346
286 Ga0495595_0255579 3300053084 Bacteria 878
287 Ga0495619_0022277 3300053085 Unclassified 4053
288 Ga0501082_1396626 3300060353 Unclassified 611

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_11079842 Ga0105242_110798422 119
2 3300009176 Ga0105242_12577066 Ga0105242_125770661 119
3 3300042461 Ga0439460_0013977 Ga0439460_0013977_863_1267 119
4 3300005471 Ga0070698_100221213 Ga0070698_1002212132 120
5 3300005844 Ga0068862_102063163 Ga0068862_1020631631 120
6 3300006880 Ga0075429_101690117 Ga0075429_1016901172 120
7 3300009177 Ga0105248_10074133 Ga0105248_100741334 120
8 3300014325 Ga0163163_13089385 Ga0163163_130893851 120
9 3300025917 Ga0207660_10066876 Ga0207660_100668762 120
10 3300027907 Ga0207428_10399053 Ga0207428_103990532 120
11 3300050511 nmdc:mga08y16_297575_c1 nmdc:mga08y16_297575_c1_1023_1412 120
12 3300005536 Ga0070697_100241014 Ga0070697_1002410142 121
13 3300006844 Ga0075428_100103167 Ga0075428_1001031674 121
14 3300009147 Ga0114129_11761823 Ga0114129_117618232 121
15 3300045976 Ga0466967_0691375 Ga0466967_0691375_590_1000 121
16 3300005328 Ga0070676_10456817 Ga0070676_104568172 122
17 3300005335 Ga0070666_10580604 Ga0070666_105806041 122
18 3300005338 Ga0068868_100415969 Ga0068868_1004159692 122
19 3300005355 Ga0070671_100272063 Ga0070671_1002720633 122
20 3300005364 Ga0070673_102160780 Ga0070673_1021607801 122
21 3300005444 Ga0070694_100606493 Ga0070694_1006064931 122
22 3300005445 Ga0070708_100566600 Ga0070708_1005666002 122
23 3300005457 Ga0070662_101284627 Ga0070662_1012846271 122
24 3300005468 Ga0070707_100535761 Ga0070707_1005357612 122
25 3300005563 Ga0068855_100209188 Ga0068855_1002091883 122
26 3300005842 Ga0068858_101558244 Ga0068858_1015582441 122
27 3300009177 Ga0105248_11004219 Ga0105248_110042191 122
28 3300017792 Ga0163161_11057653 Ga0163161_110576531 122
29 3300025903 Ga0207680_11079618 Ga0207680_110796182 122
30 3300025907 Ga0207645_10242297 Ga0207645_102422972 122
31 3300025918 Ga0207662_10606590 Ga0207662_106065902 122
32 3300025922 Ga0207646_10486739 Ga0207646_104867392 122
33 3300025923 Ga0207681_10596900 Ga0207681_105969002 122
34 3300025933 Ga0207706_10055173 Ga0207706_100551733 122
35 3300025941 Ga0207711_10742118 Ga0207711_107421182 122
36 3300025949 Ga0207667_10510472 Ga0207667_105104721 122
37 3300026023 Ga0207677_10384288 Ga0207677_103842882 122
38 3300028380 Ga0268265_10556211 Ga0268265_105562112 122
39 3300031548 Ga0307408_100455207 Ga0307408_1004552072 122
40 3300034816 Ga0373930_0006003 Ga0373930_0006003_1373_1744 122
41 3300034817 Ga0373948_0001373 Ga0373948_0001373_2570_2941 122
42 3300034818 Ga0373950_0015487 Ga0373950_0015487_741_1112 122
43 3300034819 Ga0373958_0018758 Ga0373958_0018758_342_713 122
44 3300034820 Ga0373959_0003880 Ga0373959_0003880_1874_2245 122
45 3300034957 Ga0373938_0001711 Ga0373938_0001711_870_1241 122
46 3300035088 Ga0373940_0002437 Ga0373940_0002437_2999_3370 122
47 3300035090 Ga0373949_0002541 Ga0373949_0002541_528_899 122
48 3300035091 Ga0373951_0005682 Ga0373951_0005682_1230_1601 122
49 3300035112 Ga0373932_0001645 Ga0373932_0001645_2097_2468 122
50 3300035114 Ga0373939_0000641 Ga0373939_0000641_4756_5127 122
51 3300035115 Ga0373941_0000778 Ga0373941_0000778_137_508 122
52 3300035121 Ga0373960_0005074 Ga0373960_0005074_2492_2863 122
53 3300035207 Ga0373942_0009159 Ga0373942_0009159_823_1194 122
54 3300035242 Ga0373962_0007290 Ga0373962_0007290_26_397 122
55 3300035691 Ga0373931_0001890 Ga0373931_0001890_6408_6779 122
56 3300045051 Ga0451576_0010691 Ga0451576_0010691_3848_4219 122
57 3300046684 Ga0495669_0215090 Ga0495669_0215090_485_865 122
58 3300048909 Ga0496106_0155615 Ga0496106_0155615_918_1298 122
59 3300048909 Ga0496106_0422561 Ga0496106_0422561_419_799 122
60 3300045051 Ga0451576_0068495 Ga0451576_0068495_734_1156 123
61 3300005545 Ga0070695_100618061 Ga0070695_1006180612 124
62 3300005618 Ga0068864_100688253 Ga0068864_1006882532 124
63 3300006931 Ga0097620_102609748 Ga0097620_1026097481 124
64 3300013297 Ga0157378_11185667 Ga0157378_111856672 124
65 3300025941 Ga0207711_10058287 Ga0207711_100582875 124
66 3300025942 Ga0207689_10166519 Ga0207689_101665192 124
67 3300025942 Ga0207689_10949558 Ga0207689_109495581 124
68 3300025945 Ga0207679_10360305 Ga0207679_103603052 124
69 3300025961 Ga0207712_10291106 Ga0207712_102911062 124
70 3300026035 Ga0207703_10048939 Ga0207703_100489392 124
71 3300026142 Ga0207698_12253005 Ga0207698_122530052 124
72 3300047447 Ga0495685_075151 Ga0495685_075151_174_572 124
73 3300050508 nmdc:mga09592_418454_c1 nmdc:mga09592_418454_c1_372_758 124
74 3300050509 nmdc:mga0qj67_1118221_c1 nmdc:mga0qj67_1118221_c1_103_489 124
75 3300005471 Ga0070698_100005676 Ga0070698_1000056764 125
76 3300005617 Ga0068859_101098197 Ga0068859_1010981971 125
77 3300006852 Ga0075433_10060175 Ga0075433_100601753 125
78 3300006871 Ga0075434_100204223 Ga0075434_1002042232 125
79 3300006931 Ga0097620_101098212 Ga0097620_1010982121 125
80 3300009147 Ga0114129_10069625 Ga0114129_100696254 125
81 3300050507 nmdc:mga05p37_164724_c1 nmdc:mga05p37_164724_c1_1455_1844 125
82 3300050512 nmdc:mga0n895_406075_c1 nmdc:mga0n895_406075_c1_554_967 125
83 3300050515 nmdc:mga0a205_154696_c1 nmdc:mga0a205_154696_c1_1418_1831 125
84 3300050515 nmdc:mga0a205_265171_c1 nmdc:mga0a205_265171_c1_677_1057 125
85 3300005328 Ga0070676_11405505 Ga0070676_114055051 126
86 3300005334 Ga0068869_100465455 Ga0068869_1004654552 126
87 3300005338 Ga0068868_100844341 Ga0068868_1008443412 126
88 3300005338 Ga0068868_100927338 Ga0068868_1009273382 126
89 3300005345 Ga0070692_10405215 Ga0070692_104052152 126
90 3300005347 Ga0070668_100225371 Ga0070668_1002253712 126
91 3300005444 Ga0070694_100068169 Ga0070694_1000681692 126
92 3300005459 Ga0068867_100064540 Ga0068867_1000645403 126
93 3300005468 Ga0070707_100287685 Ga0070707_1002876852 126
94 3300005468 Ga0070707_100341944 Ga0070707_1003419442 126
95 3300005518 Ga0070699_100037985 Ga0070699_1000379852 126
96 3300005518 Ga0070699_100141728 Ga0070699_1001417282 126
97 3300005544 Ga0070686_101265909 Ga0070686_1012659092 126
98 3300005546 Ga0070696_100006899 Ga0070696_1000068997 126
99 3300005548 Ga0070665_100004501 Ga0070665_1000045011 126
100 3300005549 Ga0070704_100005370 Ga0070704_1000053707 126
101 3300005549 Ga0070704_100922170 Ga0070704_1009221701 126
102 3300005615 Ga0070702_100935051 Ga0070702_1009350511 126
103 3300005618 Ga0068864_100142191 Ga0068864_1001421911 126
104 3300005841 Ga0068863_100149296 Ga0068863_1001492964 126
105 3300005842 Ga0068858_100030026 Ga0068858_1000300263 126
106 3300005842 Ga0068858_100123332 Ga0068858_1001233324 126
107 3300005844 Ga0068862_100314947 Ga0068862_1003149473 126
108 3300006237 Ga0097621_100015543 Ga0097621_1000155433 126
109 3300006237 Ga0097621_100164356 Ga0097621_1001643563 126
110 3300006358 Ga0068871_100080035 Ga0068871_1000800353 126
111 3300006871 Ga0075434_100221475 Ga0075434_1002214752 126
112 3300006881 Ga0068865_100147236 Ga0068865_1001472361 126
113 3300006881 Ga0068865_100336239 Ga0068865_1003362392 126
114 3300006931 Ga0097620_100520165 Ga0097620_1005201652 126
115 3300009093 Ga0105240_10790297 Ga0105240_107902971 126
116 3300009093 Ga0105240_11499180 Ga0105240_114991802 126
117 3300009098 Ga0105245_10018560 Ga0105245_100185603 126
118 3300009147 Ga0114129_10011485 Ga0114129_100114851 126
119 3300009176 Ga0105242_10003950 Ga0105242_100039508 126
120 3300009176 Ga0105242_10344997 Ga0105242_103449972 126
121 3300009177 Ga0105248_10003114 Ga0105248_100031141 126
122 3300009177 Ga0105248_10171704 Ga0105248_101717042 126
123 3300009177 Ga0105248_12744293 Ga0105248_127442931 126
124 3300009545 Ga0105237_10832393 Ga0105237_108323932 126
125 3300009553 Ga0105249_10497086 Ga0105249_104970862 126
126 3300013296 Ga0157374_10028114 Ga0157374_100281144 126
127 3300013306 Ga0163162_11624052 Ga0163162_116240522 126
128 3300013308 Ga0157375_10164276 Ga0157375_101642762 126
129 3300013308 Ga0157375_10475454 Ga0157375_104754542 126
130 3300013308 Ga0157375_10601867 Ga0157375_106018672 126
131 3300013308 Ga0157375_11712405 Ga0157375_117124052 126
132 3300014325 Ga0163163_10301989 Ga0163163_103019892 126
133 3300014745 Ga0157377_10970173 Ga0157377_109701731 126
134 3300014968 Ga0157379_10025930 Ga0157379_100259301 126
135 3300014968 Ga0157379_10081390 Ga0157379_100813903 126
136 3300014969 Ga0157376_10033873 Ga0157376_100338734 126
137 3300014969 Ga0157376_10091042 Ga0157376_100910422 126
138 3300025905 Ga0207685_10049073 Ga0207685_100490732 126
139 3300025922 Ga0207646_10368220 Ga0207646_103682202 126
140 3300025923 Ga0207681_10825486 Ga0207681_108254862 126
141 3300025927 Ga0207687_10020064 Ga0207687_100200643 126
142 3300025927 Ga0207687_10253036 Ga0207687_102530362 126
143 3300025934 Ga0207686_10009654 Ga0207686_100096544 126
144 3300025934 Ga0207686_10020338 Ga0207686_100203382 126
145 3300025938 Ga0207704_10006763 Ga0207704_100067635 126
146 3300025938 Ga0207704_10226314 Ga0207704_102263142 126
147 3300025941 Ga0207711_10063389 Ga0207711_100633892 126
148 3300025941 Ga0207711_10348117 Ga0207711_103481172 126
149 3300025945 Ga0207679_10389151 Ga0207679_103891512 126
150 3300025961 Ga0207712_10413953 Ga0207712_104139532 126
151 3300026023 Ga0207677_10058871 Ga0207677_100588713 126
152 3300026023 Ga0207677_10073711 Ga0207677_100737112 126
153 3300026023 Ga0207677_11217378 Ga0207677_112173782 126
154 3300026023 Ga0207677_11691940 Ga0207677_116919401 126
155 3300026035 Ga0207703_10020798 Ga0207703_100207983 126
156 3300026035 Ga0207703_10254869 Ga0207703_102548691 126
157 3300026089 Ga0207648_10061714 Ga0207648_100617143 126
158 3300026095 Ga0207676_10034722 Ga0207676_100347223 126
159 3300026095 Ga0207676_10521789 Ga0207676_105217892 126
160 3300026118 Ga0207675_100334889 Ga0207675_1003348892 126
161 3300026142 Ga0207698_12082565 Ga0207698_120825651 126
162 3300028380 Ga0268265_10833988 Ga0268265_108339882 126
163 3300028380 Ga0268265_11292942 Ga0268265_112929421 126
164 3300028381 Ga0268264_11756988 Ga0268264_117569881 126
165 3300035116 Ga0373945_0048816 Ga0373945_0048816_789_1178 126
166 3300035170 Ga0373943_0295533 Ga0373943_0295533_183_578 126
167 3300035410 Ga0373924_0201207 Ga0373924_0201207_345_737 126
168 3300035692 Ga0373935_0448293 Ga0373935_0448293_177_572 126
169 3300035724 Ga0373933_0371097 Ga0373933_0371097_179_574 126
170 3300035725 Ga0373947_0309981 Ga0373947_0309981_50_439 126
171 3300035725 Ga0373947_0862565 Ga0373947_0862565_183_572 126
172 3300036401 Ga0373937_0112490 Ga0373937_0112490_892_1281 126
173 3300037068 Ga0373925_0274514 Ga0373925_0274514_460_849 126
174 3300042876 Ga0451577_0879314 Ga0451577_0879314_103_495 126
175 3300044712 Ga0453684_2565115 Ga0453684_2565115_46_438 126
176 3300045051 Ga0451576_0029829 Ga0451576_0029829_384_776 126
177 3300046459 Ga0495629_0472371 Ga0495629_0472371_349_744 126
178 3300046459 Ga0495629_0520828 Ga0495629_0520828_275_664 126
179 3300046472 Ga0495580_0538879 Ga0495580_0538879_188_583 126
180 3300046473 Ga0495582_0226384 Ga0495582_0226384_576_971 126
181 3300046473 Ga0495582_0557910 Ga0495582_0557910_224_613 126
182 3300046475 Ga0495639_0261688 Ga0495639_0261688_50_442 126
183 3300046475 Ga0495639_0481585 Ga0495639_0481585_95_490 126
184 3300046499 Ga0495594_0380935 Ga0495594_0380935_318_713 126
185 3300046535 Ga0495586_0629922 Ga0495586_0629922_200_589 126
186 3300046681 Ga0495647_0426789 Ga0495647_0426789_185_574 126
187 3300046683 Ga0495658_0009839 Ga0495658_0009839_799_1188 126
188 3300046683 Ga0495658_0041975 Ga0495658_0041975_1373_1768 126
189 3300046683 Ga0495658_0124454 Ga0495658_0124454_66_455 126
190 3300046689 Ga0495613_0320563 Ga0495613_0320563_19_408 126
191 3300047319 Ga0495674_0879174 Ga0495674_0879174_111_506 126
192 3300048903 Ga0496100_0026130 Ga0496100_0026130_2625_3020 126
193 3300048904 Ga0496101_0031652 Ga0496101_0031652_3096_3491 126
194 3300048904 Ga0496101_1001890 Ga0496101_1001890_250_639 126
195 3300048907 Ga0496104_0151728 Ga0496104_0151728_1299_1682 126
196 3300048909 Ga0496106_0442563 Ga0496106_0442563_360_755 126
197 3300048915 Ga0496112_0828003 Ga0496112_0828003_95_484 126
198 3300048917 Ga0496114_0000426 Ga0496114_0000426_3252_3647 126
199 3300048917 Ga0496114_0369985 Ga0496114_0369985_844_1227 126
200 3300048917 Ga0496114_0381592 Ga0496114_0381592_94_483 126
201 3300048918 Ga0496115_0050220 Ga0496115_0050220_2847_3236 126
202 3300048918 Ga0496115_0702803 Ga0496115_0702803_251_646 126
203 3300049568 Ga0501031_0684812 Ga0501031_0684812_72_461 126
204 3300049580 Ga0501046_0461992 Ga0501046_0461992_410_799 126
205 3300049582 Ga0501048_0033943 Ga0501048_0033943_1142_1531 126
206 3300049586 Ga0501070_1205782 Ga0501070_1205782_74_463 126
207 3300049587 Ga0501071_0087705 Ga0501071_0087705_592_984 126
208 3300049588 Ga0501072_0028466 Ga0501072_0028466_130_519 126
209 3300049592 Ga0501076_0036890 Ga0501076_0036890_41_430 126
210 3300049743 Ga0501081_0275475 Ga0501081_0275475_34_423 126
211 3300049824 Ga0501045_0591824 Ga0501045_0591824_315_704 126
212 3300050507 nmdc:mga05p37_64865_c1 nmdc:mga05p37_64865_c1_2160_2546 126
213 3300050512 nmdc:mga0n895_302621_c1 nmdc:mga0n895_302621_c1_1041_1427 126
214 3300050512 nmdc:mga0n895_496649_c1 nmdc:mga0n895_496649_c1_317_709 126
215 3300050513 nmdc:mga0rr50_1364099_c1 nmdc:mga0rr50_1364099_c1_198_590 126
216 3300050514 nmdc:mga08x19_216496_c1 nmdc:mga08x19_216496_c1_32_424 126
217 3300050515 nmdc:mga0a205_18188_c1 nmdc:mga0a205_18188_c1_2564_2950 126
218 3300053084 Ga0495595_0108286 Ga0495595_0108286_162_551 126
219 3300053084 Ga0495595_0255579 Ga0495595_0255579_150_545 126
220 3300053085 Ga0495619_0022277 Ga0495619_0022277_1189_1578 126
221 3300060353 Ga0501082_1396626 Ga0501082_1396626_194_583 126
222 3300005328 Ga0070676_10072767 Ga0070676_100727672 127
223 3300005329 Ga0070683_101215256 Ga0070683_1012152562 127
224 3300005335 Ga0070666_10722646 Ga0070666_107226462 127
225 3300005336 Ga0070680_100415145 Ga0070680_1004151452 127
226 3300005347 Ga0070668_100528241 Ga0070668_1005282412 127
227 3300005353 Ga0070669_100012355 Ga0070669_1000123553 127
228 3300005353 Ga0070669_100090166 Ga0070669_1000901662 127
229 3300005354 Ga0070675_100043661 Ga0070675_1000436613 127
230 3300005364 Ga0070673_100088987 Ga0070673_1000889873 127
231 3300005367 Ga0070667_102053371 Ga0070667_1020533711 127
232 3300005438 Ga0070701_10079087 Ga0070701_100790872 127
233 3300005440 Ga0070705_100199318 Ga0070705_1001993181 127
234 3300005441 Ga0070700_100051083 Ga0070700_1000510832 127
235 3300005441 Ga0070700_100082989 Ga0070700_1000829892 127
236 3300005444 Ga0070694_100008133 Ga0070694_1000081335 127
237 3300005455 Ga0070663_100508713 Ga0070663_1005087132 127
238 3300005459 Ga0068867_100007610 Ga0068867_1000076106 127
239 3300005471 Ga0070698_100296941 Ga0070698_1002969412 127
240 3300005518 Ga0070699_100002788 Ga0070699_1000027885 127
241 3300005536 Ga0070697_100185587 Ga0070697_1001855873 127
242 3300005536 Ga0070697_100327532 Ga0070697_1003275322 127
243 3300005545 Ga0070695_100007086 Ga0070695_1000070863 127
244 3300005546 Ga0070696_100009670 Ga0070696_1000096706 127
245 3300005546 Ga0070696_100080642 Ga0070696_1000806422 127
246 3300005549 Ga0070704_102244817 Ga0070704_1022448171 127
247 3300005578 Ga0068854_100801590 Ga0068854_1008015902 127
248 3300005615 Ga0070702_100000780 Ga0070702_1000007805 127
249 3300005618 Ga0068864_101466556 Ga0068864_1014665562 127
250 3300005719 Ga0068861_100003492 Ga0068861_1000034921 127
251 3300005844 Ga0068862_102003568 Ga0068862_1020035681 127
252 3300006881 Ga0068865_100568713 Ga0068865_1005687131 127
253 3300006881 Ga0068865_101594568 Ga0068865_1015945681 127
254 3300009094 Ga0111539_12538100 Ga0111539_125381001 127
255 3300009147 Ga0114129_10248421 Ga0114129_102484212 127
256 3300009148 Ga0105243_10265757 Ga0105243_102657572 127
257 3300013297 Ga0157378_10521356 Ga0157378_105213562 127
258 3300014325 Ga0163163_10003026 Ga0163163_100030267 127
259 3300014326 Ga0157380_10162423 Ga0157380_101624232 127
260 3300014968 Ga0157379_10201488 Ga0157379_102014881 127
261 3300025315 Ga0207697_10077838 Ga0207697_100778382 127
262 3300025907 Ga0207645_10020856 Ga0207645_100208562 127
263 3300025907 Ga0207645_10032440 Ga0207645_100324402 127
264 3300025923 Ga0207681_10087095 Ga0207681_100870952 127
265 3300025923 Ga0207681_10099631 Ga0207681_100996311 127
266 3300025933 Ga0207706_10030677 Ga0207706_100306773 127
267 3300025933 Ga0207706_10498046 Ga0207706_104980462 127
268 3300025935 Ga0207709_10032719 Ga0207709_100327192 127
269 3300025937 Ga0207669_10229851 Ga0207669_102298513 127
270 3300025940 Ga0207691_10594828 Ga0207691_105948282 127
271 3300025941 Ga0207711_10289533 Ga0207711_102895332 127
272 3300025944 Ga0207661_11619529 Ga0207661_116195292 127
273 3300025960 Ga0207651_10625579 Ga0207651_106255792 127
274 3300025981 Ga0207640_10110302 Ga0207640_101103022 127
275 3300025986 Ga0207658_10622570 Ga0207658_106225701 127
276 3300026075 Ga0207708_10023085 Ga0207708_100230853 127
277 3300026089 Ga0207648_10006927 Ga0207648_100069278 127
278 3300026118 Ga0207675_100005615 Ga0207675_1000056153 127
279 3300028379 Ga0268266_11259356 Ga0268266_112593561 127
280 3300028380 Ga0268265_10032239 Ga0268265_100322392 127
281 3300028380 Ga0268265_12022035 Ga0268265_120220351 127
282 3300045051 Ga0451576_0322686 Ga0451576_0322686_563_973 127
283 3300045976 Ga0466967_0804983 Ga0466967_0804983_166_567 127
284 3300046537 Ga0495598_0167104 Ga0495598_0167104_78_494 127
285 3300048915 Ga0496112_1143300 Ga0496112_1143300_70_486 127
286 3300050507 nmdc:mga05p37_240872_c1 nmdc:mga05p37_240872_c1_309_722 127
287 3300050511 nmdc:mga08y16_2115092_c1 nmdc:mga08y16_2115092_c1_64_465 127
288 3300050512 nmdc:mga0n895_471553_c1 nmdc:mga0n895_471553_c1_166_576 127

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wnq-assembly1.cif.gz_P e. coli atp synthase state 2a 0.5602 52 114
6wnq-assembly1.cif.gz_S e. coli atp synthase state 2a 0.5477 52 114
6fkf-assembly1.cif.gz_L chloroplast f1fo conformation 1 0.5471 50 119
6vm4-assembly1.cif.gz_V chloroplast atp synthase (c2, cf1fo) 0.5247 50 119
6voj-assembly1.cif.gz_M chloroplast atp synthase (r3, cf1fo) 0.5164 50 119
ID Description Score Start End Superfamily
6fkfL01 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.553 50 118 1.20.20.10
6cp6O00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5245 55 111 1.20.20.10
6cp6Q00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5149 50 111 1.20.20.10
6fkfL01 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.4892 50 118 1.20.20.10
af_P86050_27_132_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4832 51 115 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A843SWY8-F1-model_v4 DUF983 domain-containing protein 0.9797 2 125 GO:0016020
AF-A0A843SWY8-F1-model_v4 DUF983 domain-containing protein 0.972 2 125 GO:0016020
AF-A0A1Q7AKG4-F1-model_v4 DUF983 domain-containing protein 0.9536 5 127 GO:0016020
AF-A0A2D7IN05-F1-model_v4 DUF983 domain-containing protein 0.9221 5 115 GO:0016020
AF-A0A1Q7AKG4-F1-model_v4 DUF983 domain-containing protein 0.9177 5 127 GO:0016020

Feature Viewer

pLDDT pTM Quality
91.82 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map