F388367

General Info

Members Datasets Scaffolds Average Seq Length
288 179 576 142

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10078479|JGI25405J52794_100784792
Length 159
Sequence VRLALSQWARAVAILPIMNLDVELLESSFDLVAPRGDELMDIFYARLFAAAPAVRPLFEGTDLQRQKQMLLGTLVLLRKSLRNLDAIVPKLEALGARHVAYGARAEHYMVVGEVLIASLAELAGDAWSAEHELAWAAAFAVVADAMLNGAAGAEMGLAA

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
103 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
104 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
105 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
106 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 7.64
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 20.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10078479 3300003911 Unclassified 725
2 Ga0070658_11217029 3300005327 Bacteria 655
3 Ga0070683_100295560 3300005329 Bacteria 1540
4 Ga0070683_100613665 3300005329 Bacteria 1041
5 Ga0068868_100092648 3300005338 Bacteria 2436
6 Ga0070691_10681950 3300005341 Unclassified 615
7 Ga0070675_101263637 3300005354 Unclassified 680
8 Ga0070674_100137341 3300005356 Bacteria 1830
9 Ga0070674_100473409 3300005356 Bacteria 1038
10 Ga0070674_100859025 3300005356 Bacteria 788
11 Ga0070659_100098191 3300005366 Bacteria 2355
12 Ga0070714_100707817 3300005435 Bacteria 972
13 Ga0070705_101801666 3300005440 Unclassified 519
14 Ga0070700_100138739 3300005441 Bacteria 1650
15 Ga0070700_100651615 3300005441 Bacteria 831
16 Ga0070694_101551375 3300005444 Bacteria 561
17 Ga0070708_100575539 3300005445 Bacteria 1062
18 Ga0070706_101895342 3300005467 Bacteria 541
19 Ga0070707_101360870 3300005468 Unclassified 676
20 Ga0070698_100234282 3300005471 Bacteria 1769
21 Ga0070698_100391907 3300005471 Bacteria 1322
22 Ga0070699_100360964 3300005518 Bacteria 1310
23 Ga0070684_100111909 3300005535 Bacteria 2449
24 Ga0070684_100217356 3300005535 Bacteria 1743
25 Ga0070684_100425813 3300005535 Bacteria 1226
26 Ga0068853_101541623 3300005539 Bacteria 644
27 Ga0070672_100686522 3300005543 Bacteria 896
28 Ga0070696_100657521 3300005546 Bacteria 850
29 Ga0070664_100075339 3300005564 Bacteria 2898
30 Ga0070664_101570725 3300005564 Bacteria 623
31 Ga0068856_100579826 3300005614 Bacteria 1143
32 Ga0068861_100603566 3300005719 Bacteria 1008
33 Ga0068858_100905299 3300005842 Bacteria 863
34 Ga0081455_10003616 3300005937 Bacteria 17722
35 Ga0081455_10004689 3300005937 Bacteria 15213
36 Ga0081455_10009052 3300005937 Bacteria 10277
37 Ga0081455_10017209 3300005937 Bacteria 6939
38 Ga0081455_10027440 3300005937 Bacteria 5217
39 Ga0081455_10091898 3300005937 Bacteria 2457
40 Ga0081455_10455413 3300005937 Bacteria 873
41 Ga0081455_10480804 3300005937 Bacteria 840
42 Ga0081455_10543084 3300005937 Bacteria 770
43 Ga0081538_10066061 3300005981 Bacteria 2031
44 Ga0081539_10039593 3300005985 Bacteria 2778
45 Ga0075365_11277105 3300006038 Unclassified 516
46 Ga0075432_10466340 3300006058 Bacteria 557
47 Ga0075428_100156525 3300006844 Unclassified 2475
48 Ga0075430_100019403 3300006846 Bacteria 5782
49 Ga0075430_100079726 3300006846 Bacteria 2743
50 Ga0075431_100072754 3300006847 Unclassified 3547
51 Ga0075433_10108346 3300006852 Bacteria 2464
52 Ga0075433_10759747 3300006852 Unclassified 848
53 Ga0075434_101412764 3300006871 Bacteria 706
54 Ga0075429_100279863 3300006880 Bacteria 1461
55 Ga0075435_100262023 3300007076 Bacteria 1473
56 Ga0111539_10060273 3300009094 Bacteria 4497
57 Ga0105245_10124615 3300009098 Bacteria 2410
58 Ga0114129_10313372 3300009147 Bacteria 2088
59 Ga0114129_10597383 3300009147 Bacteria 1430
60 Ga0114129_10914540 3300009147 Bacteria 1111
61 Ga0114129_10967421 3300009147 Bacteria 1074
62 Ga0114129_12032672 3300009147 Unclassified 694
63 Ga0105243_10611039 3300009148 Bacteria 1051
64 Ga0105243_10715916 3300009148 Bacteria 977
65 Ga0105242_10165963 3300009176 Bacteria 1937
66 Ga0105242_12097932 3300009176 Unclassified 609
67 Ga0105248_12176015 3300009177 Bacteria 631
68 Ga0105249_10784350 3300009553 Bacteria 1016
69 Ga0105249_11120092 3300009553 Bacteria 857
70 Ga0105249_11973678 3300009553 Bacteria 656
71 Ga0105239_10992219 3300010375 Bacteria 965
72 Ga0105246_10123914 3300011119 Bacteria 1920
73 Ga0105246_12544626 3300011119 Bacteria 504
74 Ga0157327_1047835 3300012512 Bacteria 598
75 Ga0163162_10596207 3300013306 Unclassified 1231
76 Ga0157375_11052691 3300013308 Bacteria 951
77 Ga0157375_13062537 3300013308 Unclassified 558
78 Ga0163163_10325352 3300014325 Bacteria 1591
79 Ga0157380_10237249 3300014326 Bacteria 1642
80 Ga0182008_10150605 3300014497 Bacteria 1167
81 Ga0157377_10278037 3300014745 Bacteria 1096
82 Ga0157376_11080351 3300014969 Unclassified 828
83 Ga0157376_12847699 3300014969 Bacteria 523
84 Ga0206353_10695286 3300020082 Bacteria 665
85 Ga0207642_10349605 3300025899 Bacteria 872
86 Ga0207646_10891872 3300025922 Unclassified 789
87 Ga0207681_10637723 3300025923 Bacteria 883
88 Ga0207650_10530705 3300025925 Unclassified 985
89 Ga0207650_10543532 3300025925 Bacteria 974
90 Ga0207687_10621928 3300025927 Bacteria 912
91 Ga0207687_10674544 3300025927 Bacteria 876
92 Ga0207690_10074381 3300025932 Bacteria 2353
93 Ga0207686_10444548 3300025934 Unclassified 996
94 Ga0207709_10218565 3300025935 Bacteria 1373
95 Ga0207709_10424940 3300025935 Bacteria 1021
96 Ga0207704_11827715 3300025938 Bacteria 522
97 Ga0207665_10451098 3300025939 Bacteria 987
98 Ga0207691_10041625 3300025940 Bacteria 4240
99 Ga0207691_10672115 3300025940 Bacteria 874
100 Ga0207661_10536358 3300025944 Bacteria 1071
101 Ga0207661_10609292 3300025944 Bacteria 1003
102 Ga0207679_10439929 3300025945 Bacteria 1154
103 Ga0207712_11711700 3300025961 Bacteria 564
104 Ga0207640_10081513 3300025981 Bacteria 2213
105 Ga0207677_11076167 3300026023 Unclassified 732
106 Ga0207639_11136168 3300026041 Unclassified 733
107 Ga0207708_10005276 3300026075 Bacteria 9517
108 Ga0207708_10268306 3300026075 Bacteria 1380
109 Ga0207702_12016832 3300026078 Bacteria 567
110 Ga0207641_11547880 3300026088 Bacteria 665
111 Ga0207676_11144040 3300026095 Unclassified 770
112 Ga0207675_100043473 3300026118 Bacteria 4195
113 Ga0268265_10502606 3300028380 Bacteria 1143
114 Ga0307405_10091918 3300031731 Bacteria 2012
115 Ga0307413_10287539 3300031824 Bacteria 1240
116 Ga0307410_11049529 3300031852 Unclassified 704
117 Ga0307410_11884690 3300031852 Unclassified 532
118 Ga0307409_100029572 3300031995 Bacteria 3923
119 Ga0307409_100331257 3300031995 Bacteria 1429
120 Ga0307409_101881358 3300031995 Unclassified 628
121 Ga0307416_100066198 3300032002 Bacteria 2974
122 Ga0307416_100104458 3300032002 Bacteria 2477
123 Ga0307416_100164855 3300032002 Bacteria 2054
124 Ga0307416_100208527 3300032002 Bacteria 1862
125 Ga0307416_100642288 3300032002 Bacteria 1145
126 Ga0307416_102701761 3300032002 Unclassified 593
127 Ga0307414_10586440 3300032004 Bacteria 998
128 Ga0307415_100018095 3300032126 Bacteria 4245
129 Ga0307415_100067984 3300032126 Bacteria 2492
130 Ga0307415_100828612 3300032126 Unclassified 847
131 Ga0307415_101269443 3300032126 Bacteria 696
132 Ga0307415_101850923 3300032126 Unclassified 585
133 Ga0373934_0042082 3300035086 Bacteria 1804
134 Ga0373923_0249884 3300035111 Unclassified 830
135 Ga0373957_0102820 3300035120 Unclassified 1145
136 Ga0373955_0589158 3300035172 Bacteria 681
137 Ga0373955_0793125 3300035172 Unclassified 582
138 Ga0373924_0113903 3300035410 Unclassified 1170
139 Ga0373931_0136618 3300035691 Unclassified 1416
140 Ga0373933_0293125 3300035724 Unclassified 1052
141 Ga0373947_0886557 3300035725 Unclassified 609
142 Ga0373937_0001466 3300036401 Bacteria 19736
143 Ga0373937_1940824 3300036401 Bacteria 535
144 Ga0395899_0031841 3300037312 Bacteria 3962
145 Ga0395899_0035002 3300037312 Bacteria 3771
146 Ga0395900_0003359 3300037418 Bacteria 17292
147 Ga0395900_0034299 3300037418 Bacteria 5224
148 Ga0395900_0270903 3300037418 Bacteria 1692
149 Ga0395898_0024682 3300037466 Bacteria 6063
150 Ga0395898_0029022 3300037466 Bacteria 5543
151 Ga0395898_0036987 3300037466 Bacteria 4844
152 Ga0395898_0206601 3300037466 Bacteria 1874
153 Ga0395898_0254397 3300037466 Unclassified 1675
154 Ga0395898_0528541 3300037466 Bacteria 1121
155 Ga0395898_1224663 3300037466 Bacteria 681
156 Ga0395905_0016552 3300037471 Bacteria 7010
157 Ga0395905_0024781 3300037471 Bacteria 5661
158 Ga0395905_0027808 3300037471 Bacteria 5332
159 Ga0395905_0095723 3300037471 Bacteria 2787
160 Ga0395905_0608154 3300037471 Bacteria 995
161 Ga0395905_1590912 3300037471 Bacteria 558
162 Ga0395905_1803506 3300037471 Unclassified 517
163 Ga0395901_0021606 3300038443 Bacteria 6593
164 Ga0395901_0082028 3300038443 Bacteria 3368
165 Ga0395901_0174806 3300038443 Bacteria 2252
166 Ga0395901_0243130 3300038443 Bacteria 1877
167 Ga0395901_0247155 3300038443 Bacteria 1859
168 Ga0395901_0410103 3300038443 Bacteria 1391
169 Ga0395901_0428170 3300038443 Bacteria 1356
170 Ga0395901_0510229 3300038443 Unclassified 1223
171 Ga0395901_0511942 3300038443 Bacteria 1221
172 Ga0395901_1352802 3300038443 Bacteria 672
173 Ga0451807_1195874 3300041486 Bacteria 631
174 Ga0451853_0787961 3300041512 Bacteria 790
175 Ga0439455_0085013 3300042012 Bacteria 863
176 Ga0450902_032032 3300042137 Bacteria 886
177 Ga0439458_0230232 3300042157 Unclassified 512
178 Ga0439444_0044857 3300042437 Unclassified 881
179 Ga0450893_0056915 3300042532 Unclassified 741
180 Ga0439440_0166387 3300042993 Bacteria 639
181 Ga0466963_0316935 3300044694 Bacteria 1097
182 Ga0466960_0027055 3300044901 Bacteria 2612
183 Ga0466960_0369038 3300044901 Bacteria 822
184 Ga0451576_0228875 3300045051 Bacteria 1941
185 Ga0451576_0541037 3300045051 Bacteria 1224
186 Ga0451576_2208136 3300045051 Unclassified 565
187 Ga0466967_1532509 3300045976 Unclassified 664
188 Ga0466967_1801005 3300045976 Bacteria 609
189 Ga0495592_0042005 3300046454 Bacteria 3425
190 Ga0495603_0872223 3300046455 Unclassified 512
191 Ga0495641_0499000 3300046461 Unclassified 555
192 Ga0495651_0002150 3300046462 Bacteria 15252
193 Ga0495653_0007487 3300046463 Bacteria 8929
194 Ga0495653_0410409 3300046463 Bacteria 859
195 Ga0495664_0278111 3300046477 Unclassified 1011
196 Ga0495596_0034437 3300046500 Bacteria 2011
197 Ga0495596_0258621 3300046500 Bacteria 676
198 Ga0495608_0000959 3300046511 Bacteria 20350
199 Ga0495608_0234281 3300046511 Bacteria 1149
200 Ga0495620_0239795 3300046515 Bacteria 692
201 Ga0495628_0015348 3300046516 Bacteria 6397
202 Ga0495630_0104892 3300046517 Bacteria 2140
203 Ga0495630_0129057 3300046517 Bacteria 1920
204 Ga0495631_0183623 3300046518 Bacteria 896
205 Ga0495631_0282485 3300046518 Bacteria 707
206 Ga0495644_0047386 3300046523 Bacteria 1615
207 Ga0495663_0038343 3300046525 Bacteria 1448
208 Ga0495652_0020809 3300046529 Bacteria 5830
209 Ga0495640_0006242 3300046533 Bacteria 9435
210 Ga0495587_0014027 3300046536 Bacteria 5032
211 Ga0495587_0407188 3300046536 Bacteria 756
212 Ga0495645_0106338 3300046543 Bacteria 1990
213 Ga0495645_0705256 3300046543 Unclassified 612
214 Ga0495667_0002326 3300046559 Bacteria 12741
215 Ga0495635_0003367 3300046663 Bacteria 11047
216 Ga0495657_0006648 3300046675 Bacteria 9029
217 Ga0495623_0091032 3300046679 Bacteria 1872
218 Ga0495646_0040569 3300046680 Bacteria 2866
219 Ga0495646_0673368 3300046680 Bacteria 522
220 Ga0495658_0721286 3300046683 Unclassified 639
221 Ga0495669_0343662 3300046684 Unclassified 721
222 Ga0495669_0563621 3300046684 Bacteria 554
223 Ga0495613_0097966 3300046689 Bacteria 2119
224 Ga0495613_0877732 3300046689 Bacteria 582
225 Ga0495600_0008539 3300046809 Bacteria 6299
226 Ga0495604_0001824 3300047317 Bacteria 17345
227 Ga0495674_0013658 3300047319 Bacteria 7630
228 Ga0495680_0001371 3300047322 Bacteria 26421
229 Ga0495680_0527549 3300047322 Bacteria 798
230 Ga0495675_0294845 3300047444 Unclassified 964
231 Ga0495684_0001670 3300047471 Bacteria 17829
232 Ga0495684_0261552 3300047471 Bacteria 1255
233 Ga0495602_0008205 3300048088 Bacteria 10907
234 Ga0496104_0566203 3300048907 Bacteria 1047
235 Ga0496105_0242988 3300048908 Bacteria 1460
236 Ga0496108_0306405 3300048911 Bacteria 1384
237 Ga0496108_0339324 3300048911 Bacteria 1311
238 Ga0496108_0676120 3300048911 Bacteria 896
239 Ga0496109_0338681 3300048912 Bacteria 1420
240 Ga0496109_0608815 3300048912 Bacteria 1029
241 Ga0496109_1320538 3300048912 Unclassified 657
242 Ga0496109_1659700 3300048912 Unclassified 573
243 Ga0496110_0107232 3300048913 Bacteria 2507
244 Ga0496110_0151827 3300048913 Bacteria 2098
245 Ga0496110_0273535 3300048913 Bacteria 1538
246 Ga0496110_0504438 3300048913 Bacteria 1101
247 Ga0496110_0661607 3300048913 Unclassified 945
248 Ga0496111_0026155 3300048914 Bacteria 4120
249 Ga0496111_0037250 3300048914 Bacteria 3481
250 Ga0496111_0162214 3300048914 Unclassified 1660
251 Ga0496111_1098348 3300048914 Bacteria 567
252 Ga0496112_0268996 3300048915 Bacteria 1653
253 Ga0496113_0172518 3300048916 Bacteria 1713
254 Ga0496115_0369448 3300048918 Bacteria 1168
255 Ga0501031_0205810 3300049568 Unclassified 1283
256 Ga0501036_0024581 3300049572 Bacteria 5080
257 Ga0501037_0170941 3300049573 Bacteria 1545
258 Ga0501038_0175665 3300049574 Bacteria 1731
259 Ga0501040_0549535 3300049576 Unclassified 833
260 Ga0501041_0051749 3300049577 Bacteria 2503
261 Ga0501041_0811187 3300049577 Bacteria 600
262 Ga0501042_0088907 3300049578 Bacteria 2216
263 Ga0501048_0019334 3300049582 Bacteria 4999
264 Ga0501072_0054439 3300049588 Bacteria 3152
265 Ga0501074_1281345 3300049590 Bacteria 514
266 Ga0501077_0359769 3300049593 Bacteria 929
267 Ga0501079_0191473 3300049741 Bacteria 1596
268 Ga0501081_0066646 3300049743 Bacteria 2504
269 Ga0501035_0671863 3300049822 Bacteria 838
270 Ga0501045_0324052 3300049824 Bacteria 1146
271 nmdc:mga05p37_23592_c1 3300050507 Bacteria 7466
272 nmdc:mga05p37_565492_c1 3300050507 Unclassified 1291
273 nmdc:mga05p37_704897_c1 3300050507 Bacteria 1120
274 nmdc:mga05p37_753311_c1 3300050507 Bacteria 1073
275 nmdc:mga0qj67_32127_c1 3300050509 Bacteria 4093
276 nmdc:mga0qj67_42011_c1 3300050509 Bacteria 3599
277 nmdc:mga06r32_62631_c1 3300050510 Unclassified 3584
278 nmdc:mga08y16_44773_c1 3300050511 Bacteria 4638
279 nmdc:mga0rr50_323959_c1 3300050513 Bacteria 1292
280 nmdc:mga0a205_159111_c1 3300050515 Bacteria 2156
281 nmdc:mga0a205_516276_c1 3300050515 Unclassified 1051
282 Ga0495601_0556964 3300053077 Unclassified 737
283 Ga0495601_0786334 3300053077 Unclassified 604
284 Ga0495655_0278304 3300053083 Bacteria 570
285 Ga0495595_0001139 3300053084 Bacteria 10300
286 Ga0495595_0318295 3300053084 Bacteria 783
287 Ga0500568_0287223 3300053139 Bacteria 597
288 Ga0501084_0010737 3300054114 Bacteria 7581
289 JGI25405J52794_10078479
290 Ga0070658_11217029
291 Ga0070683_100295560
292 Ga0070683_100613665
293 Ga0068868_100092648
294 Ga0070691_10681950
295 Ga0070675_101263637
296 Ga0070674_100137341
297 Ga0070674_100473409
298 Ga0070674_100859025
299 Ga0070659_100098191
300 Ga0070714_100707817
301 Ga0070705_101801666
302 Ga0070700_100138739
303 Ga0070700_100651615
304 Ga0070694_101551375
305 Ga0070708_100575539
306 Ga0070706_101895342
307 Ga0070707_101360870
308 Ga0070698_100234282
309 Ga0070698_100391907
310 Ga0070699_100360964
311 Ga0070684_100111909
312 Ga0070684_100217356
313 Ga0070684_100425813
314 Ga0068853_101541623
315 Ga0070672_100686522
316 Ga0070696_100657521
317 Ga0070664_100075339
318 Ga0070664_101570725
319 Ga0068856_100579826
320 Ga0068861_100603566
321 Ga0068858_100905299
322 Ga0081455_10003616
323 Ga0081455_10004689
324 Ga0081455_10009052
325 Ga0081455_10017209
326 Ga0081455_10027440
327 Ga0081455_10091898
328 Ga0081455_10455413
329 Ga0081455_10480804
330 Ga0081455_10543084
331 Ga0081538_10066061
332 Ga0081539_10039593
333 Ga0075365_11277105
334 Ga0075432_10466340
335 Ga0075428_100156525
336 Ga0075430_100019403
337 Ga0075430_100079726
338 Ga0075431_100072754
339 Ga0075433_10108346
340 Ga0075433_10759747
341 Ga0075434_101412764
342 Ga0075429_100279863
343 Ga0075435_100262023
344 Ga0111539_10060273
345 Ga0105245_10124615
346 Ga0114129_10313372
347 Ga0114129_10597383
348 Ga0114129_10914540
349 Ga0114129_10967421
350 Ga0114129_12032672
351 Ga0105243_10611039
352 Ga0105243_10715916
353 Ga0105242_10165963
354 Ga0105242_12097932
355 Ga0105248_12176015
356 Ga0105249_10784350
357 Ga0105249_11120092
358 Ga0105249_11973678
359 Ga0105239_10992219
360 Ga0105246_10123914
361 Ga0105246_12544626
362 Ga0157327_1047835
363 Ga0163162_10596207
364 Ga0157375_11052691
365 Ga0157375_13062537
366 Ga0163163_10325352
367 Ga0157380_10237249
368 Ga0182008_10150605
369 Ga0157377_10278037
370 Ga0157376_11080351
371 Ga0157376_12847699
372 Ga0206353_10695286
373 Ga0207642_10349605
374 Ga0207646_10891872
375 Ga0207681_10637723
376 Ga0207650_10530705
377 Ga0207650_10543532
378 Ga0207687_10621928
379 Ga0207687_10674544
380 Ga0207690_10074381
381 Ga0207686_10444548
382 Ga0207709_10218565
383 Ga0207709_10424940
384 Ga0207704_11827715
385 Ga0207665_10451098
386 Ga0207691_10041625
387 Ga0207691_10672115
388 Ga0207661_10536358
389 Ga0207661_10609292
390 Ga0207679_10439929
391 Ga0207712_11711700
392 Ga0207640_10081513
393 Ga0207677_11076167
394 Ga0207639_11136168
395 Ga0207708_10005276
396 Ga0207708_10268306
397 Ga0207702_12016832
398 Ga0207641_11547880
399 Ga0207676_11144040
400 Ga0207675_100043473
401 Ga0268265_10502606
402 Ga0307405_10091918
403 Ga0307413_10287539
404 Ga0307410_11049529
405 Ga0307410_11884690
406 Ga0307409_100029572
407 Ga0307409_100331257
408 Ga0307409_101881358
409 Ga0307416_100066198
410 Ga0307416_100104458
411 Ga0307416_100164855
412 Ga0307416_100208527
413 Ga0307416_100642288
414 Ga0307416_102701761
415 Ga0307414_10586440
416 Ga0307415_100018095
417 Ga0307415_100067984
418 Ga0307415_100828612
419 Ga0307415_101269443
420 Ga0307415_101850923
421 Ga0373934_0042082
422 Ga0373923_0249884
423 Ga0373957_0102820
424 Ga0373955_0589158
425 Ga0373955_0793125
426 Ga0373924_0113903
427 Ga0373931_0136618
428 Ga0373933_0293125
429 Ga0373947_0886557
430 Ga0373937_0001466
431 Ga0373937_1940824
432 Ga0395899_0031841
433 Ga0395899_0035002
434 Ga0395900_0003359
435 Ga0395900_0034299
436 Ga0395900_0270903
437 Ga0395898_0024682
438 Ga0395898_0029022
439 Ga0395898_0036987
440 Ga0395898_0206601
441 Ga0395898_0254397
442 Ga0395898_0528541
443 Ga0395898_1224663
444 Ga0395905_0016552
445 Ga0395905_0024781
446 Ga0395905_0027808
447 Ga0395905_0095723
448 Ga0395905_0608154
449 Ga0395905_1590912
450 Ga0395905_1803506
451 Ga0395901_0021606
452 Ga0395901_0082028
453 Ga0395901_0174806
454 Ga0395901_0243130
455 Ga0395901_0247155
456 Ga0395901_0410103
457 Ga0395901_0428170
458 Ga0395901_0510229
459 Ga0395901_0511942
460 Ga0395901_1352802
461 Ga0451807_1195874
462 Ga0451853_0787961
463 Ga0439455_0085013
464 Ga0450902_032032
465 Ga0439458_0230232
466 Ga0439444_0044857
467 Ga0450893_0056915
468 Ga0439440_0166387
469 Ga0466963_0316935
470 Ga0466960_0027055
471 Ga0466960_0369038
472 Ga0451576_0228875
473 Ga0451576_0541037
474 Ga0451576_2208136
475 Ga0466967_1532509
476 Ga0466967_1801005
477 Ga0495592_0042005
478 Ga0495603_0872223
479 Ga0495641_0499000
480 Ga0495651_0002150
481 Ga0495653_0007487
482 Ga0495653_0410409
483 Ga0495664_0278111
484 Ga0495596_0034437
485 Ga0495596_0258621
486 Ga0495608_0000959
487 Ga0495608_0234281
488 Ga0495620_0239795
489 Ga0495628_0015348
490 Ga0495630_0104892
491 Ga0495630_0129057
492 Ga0495631_0183623
493 Ga0495631_0282485
494 Ga0495644_0047386
495 Ga0495663_0038343
496 Ga0495652_0020809
497 Ga0495640_0006242
498 Ga0495587_0014027
499 Ga0495587_0407188
500 Ga0495645_0106338
501 Ga0495645_0705256
502 Ga0495667_0002326
503 Ga0495635_0003367
504 Ga0495657_0006648
505 Ga0495623_0091032
506 Ga0495646_0040569
507 Ga0495646_0673368
508 Ga0495658_0721286
509 Ga0495669_0343662
510 Ga0495669_0563621
511 Ga0495613_0097966
512 Ga0495613_0877732
513 Ga0495600_0008539
514 Ga0495604_0001824
515 Ga0495674_0013658
516 Ga0495680_0001371
517 Ga0495680_0527549
518 Ga0495675_0294845
519 Ga0495684_0001670
520 Ga0495684_0261552
521 Ga0495602_0008205
522 Ga0496104_0566203
523 Ga0496105_0242988
524 Ga0496108_0306405
525 Ga0496108_0339324
526 Ga0496108_0676120
527 Ga0496109_0338681
528 Ga0496109_0608815
529 Ga0496109_1320538
530 Ga0496109_1659700
531 Ga0496110_0107232
532 Ga0496110_0151827
533 Ga0496110_0273535
534 Ga0496110_0504438
535 Ga0496110_0661607
536 Ga0496111_0026155
537 Ga0496111_0037250
538 Ga0496111_0162214
539 Ga0496111_1098348
540 Ga0496112_0268996
541 Ga0496113_0172518
542 Ga0496115_0369448
543 Ga0501031_0205810
544 Ga0501036_0024581
545 Ga0501037_0170941
546 Ga0501038_0175665
547 Ga0501040_0549535
548 Ga0501041_0051749
549 Ga0501041_0811187
550 Ga0501042_0088907
551 Ga0501048_0019334
552 Ga0501072_0054439
553 Ga0501074_1281345
554 Ga0501077_0359769
555 Ga0501079_0191473
556 Ga0501081_0066646
557 Ga0501035_0671863
558 Ga0501045_0324052
559 nmdc:mga05p37_23592_c1
560 nmdc:mga05p37_565492_c1
561 nmdc:mga05p37_704897_c1
562 nmdc:mga05p37_753311_c1
563 nmdc:mga0qj67_32127_c1
564 nmdc:mga0qj67_42011_c1
565 nmdc:mga06r32_62631_c1
566 nmdc:mga08y16_44773_c1
567 nmdc:mga0rr50_323959_c1
568 nmdc:mga0a205_159111_c1
569 nmdc:mga0a205_516276_c1
570 Ga0495601_0556964
571 Ga0495601_0786334
572 Ga0495655_0278304
573 Ga0495595_0001139
574 Ga0495595_0318295
575 Ga0500568_0287223
576 Ga0501084_0010737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00042

Globin

Globin

41

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s1i-assembly1.cif.gz_A crystal structure of oxygen-bound hell's gate globin i 0.9663 22 146
5eys-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant f106w at ambient pressure 0.9483 22 149
4o2g-assembly1.cif.gz_A crystal structure of carbomonoxy murine neuroglobin mutant v140w 0.9482 22 149
5o1k-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant v140w under 20 bar xenon pressure 0.9473 22 149
4mu5-assembly1.cif.gz_A crystal structure of murine neuroglobin mutant m144w 0.9457 22 149
ID Description Score Start End Superfamily
3s1iA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9663 22 146 1.10.490.10
3ubvG00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9638 22 146 1.10.490.10
3ubcG00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9626 22 146 1.10.490.10
3ubvA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9579 22 146 1.10.490.10
af_Q90YJ2_3_150_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9527 21 149 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A660LIH7-F1-model_v4 Hemoglobin-like flavoprotein 0.9926 20 159 GO:0005344
GO:0008941
GO:0019825
GO:0020037
GO:0046210
GO:0071500
GO:0071949
AF-A0A538D7N6-F1-model_v4 Flavohemoprotein 0.9869 20 153 GO:0005344
GO:0008941
GO:0019825
GO:0020037
GO:0046210
GO:0071500
GO:0071949
AF-A0A660LIH7-F1-model_v4 Hemoglobin-like flavoprotein 0.9856 20 159 GO:0005344
GO:0008941
GO:0019825
GO:0020037
GO:0046210
GO:0071500
GO:0071949
AF-A0A3C1Z1T2-F1-model_v4 PAS domain S-box protein 0.9811 20 155 GO:0004888
GO:0006935
GO:0007165
GO:0016020
GO:0019825
GO:0020037
AF-A0A3D4VD88-F1-model_v4 Hemin receptor 0.9799 22 158 GO:0005344
GO:0008941
GO:0019825
GO:0020037
GO:0046210
GO:0071500
GO:0071949

Map