F388285

General Info

Members Datasets Scaffolds Average Seq Length
287 219 574 207

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0924555|Ga0501082_0924555_43_675
Length 196
Sequence LEHKKTYYKKEWETKKGTLIIEGPVPSETLSKYHFHEGLVAFRPANEQKKALVSIAALPEGRIIIARDGDTVIGYATFLYPDPLERWSEEKMDNLLELGAIEVAAPYRGMAVGKQLLIVAEYYWHWDLKGTGLNVWEYRKIMEKMMNAGGLVWFATDDPEICSHPANCLMVRIGKRVDQASIEKFDRLRFRNRFMY

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
43 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
46 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
47 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
58 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
59 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
60 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
61 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
62 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
63 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
76 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
79 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
80 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
81 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
82 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
83 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
84 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
85 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
88 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
89 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
90 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
91 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
92 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
93 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
94 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
95 2554235283 Bacillus safensis VK Isolate Rhizosphere
96 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
97 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
98 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
99 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
100 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
101 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
102 2643221729 Bacillus sp. Root11 Isolate Unclassified
103 2643221730 Bacillus sp. Root131 Isolate Unclassified
104 2643221731 Bacillus sp. Root147 Isolate Unclassified
105 2643221732 Bacillus sp. Root239 Isolate Unclassified
106 2643221735 Bacillus sp. Root920 Isolate Unclassified
107 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
108 2671180694 Paenibacillus sp. A3 Isolate Unclassified
109 2684622632 Bacillus cereus 905 Isolate Unclassified
110 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
111 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
112 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
113 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
114 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
115 2738541358 Bacillus sp. OV752 Isolate Unclassified
116 2738543006 Bacillus sp. OK077 Isolate Unclassified
117 2738543010 Bacillus sp. YR335 Isolate Unclassified
118 2738543017 Bacillus sp. OV186 Isolate Unclassified
119 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
120 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
121 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
122 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
123 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
124 2811994870 Bacillus sp. JB4 Isolate Unclassified
125 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
126 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
127 2818991459 Paenibacillus sp. 597 Isolate Unclassified
128 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
129 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
130 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
131 2842882022 Bacillus sp. R-71893 Isolate Unclassified
132 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
133 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
134 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
135 2857472729 Cohnella sp. R-74144 Isolate Unclassified
136 2857586860 Bacillus sp. R-71935 Isolate Unclassified
137 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
138 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
139 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
140 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
141 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
142 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
143 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
144 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
145 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
146 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
147 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
148 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
149 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
150 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
151 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
152 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
153 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
154 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
155 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
156 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
157 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
158 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
159 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
160 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
161 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
162 2919720352 Priestia megaterium 4340 Isolate Unclassified
163 2919726948 Bacillus pumilus 4489 Isolate Unclassified
164 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
165 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
166 2929004312 Priestia megaterium 1104 Isolate Unclassified
167 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
168 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
169 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
170 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
171 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
172 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
173 2938917290 Bacillus sp. CR71 Isolate Unclassified
174 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
175 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
176 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
177 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
178 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
179 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
180 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
181 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
182 2965761152 Bacillus sp. COPE52 Isolate Unclassified
183 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
184 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
185 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
186 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
187 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
188 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
189 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
190 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
191 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
192 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
193 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
194 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
195 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
196 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
197 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
198 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
199 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
200 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
201 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
202 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
203 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
204 8022792930 Bacillus sp. Xin Isolate Rhizosphere
205 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
206 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
207 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
208 8023438354 Bacillus sp. BH2 Isolate Unclassified
209 8023444577 Bacillus sp. BH32 Isolate Unclassified
210 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
211 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
212 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
213 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
214 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
215 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
216 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
217 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
218 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
219 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 51.92
Metatranscriptomes 1.74
Isolates 46.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 17.77
Nodule 0.7
Rhizoplane 8.01
Rhizosphere 38.68
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0924555 3300060353 Bacteria 763
2 JGI25159J45721_1002941 3300002987 Bacteria 6205
3 JGI25159J45721_1008210 3300002987 Bacteria 2895
4 JGI25151J46595_10000731 3300003187 Bacteria 27264
5 JGI25151J46595_10003780 3300003187 Bacteria 8213
6 JGI25151J46595_10003800 3300003187 Bacteria 8185
7 JGI25151J46595_10007592 3300003187 Bacteria 5293
8 JGI25151J46595_10018634 3300003187 Bacteria 2973
9 JGI25151J46595_10021671 3300003187 Bacteria 2683
10 JGI25151J46595_10027036 3300003187 Bacteria 2307
11 JGI25151J46595_10041962 3300003187 Bacteria 1655
12 JGI25151J46595_10086950 3300003187 Bacteria 884
13 rootH1_10001445 3300003316 Bacteria 56583
14 rootL2_10013974 3300003322 Bacteria 148551
15 rootH1_10081199 3300003323 Bacteria 4315
16 JGI25160J50197_1051538 3300003354 Bacteria 870
17 Ga0006562J51391_1000165 3300003578 Bacteria 5580
18 Ga0006562J51391_1000166 3300003578 Bacteria 3001
19 Ga0006562J51391_1005137 3300003578 Bacteria 2790
20 Ga0055538_1000284 3300003751 Bacteria 25884
21 Ga0055538_1000316 3300003751 Bacteria 22997
22 Ga0055532_1000100 3300003758 Bacteria 92894
23 Ga0055532_1000481 3300003758 Bacteria 17850
24 Ga0055532_1003250 3300003758 Bacteria 2883
25 Ga0055535_1001459 3300003761 Bacteria 11921
26 Ga0055536_1008501 3300003781 Bacteria 4401
27 Ga0055541_1000212 3300003841 Bacteria 24534
28 Ga0055541_1012227 3300003841 Unclassified 1236
29 Ga0055541_1013508 3300003841 Bacteria 1140
30 Ga0070671_100012395 3300005355 Bacteria 6865
31 Ga0105251_10033700 3300009011 Bacteria 2539
32 Ga0105250_10101511 3300009092 Bacteria 1174
33 Ga0105250_10108551 3300009092 Bacteria 1135
34 Ga0105250_10150265 3300009092 Bacteria 969
35 Ga0105250_10150266 3300009092 Bacteria 969
36 Ga0105247_10012604 3300009101 Bacteria 5076
37 Ga0105243_10001025 3300009148 Bacteria 25775
38 Ga0105242_10004530 3300009176 Bacteria 10786
39 Ga0105249_10569439 3300009553 Bacteria 1185
40 Ga0105239_10074534 3300010375 Bacteria 3731
41 Ga0105246_10000909 3300011119 Bacteria 16953
42 Ga0157378_10015476 3300013297 Bacteria 6682
43 Ga0209784_100183 3300025224 Bacteria 50174
44 Ga0209784_101828 3300025224 Bacteria 2481
45 Ga0209566_100054 3300025225 Bacteria 221422
46 Ga0209566_100587 3300025225 Bacteria 23195
47 Ga0209566_100681 3300025225 Bacteria 19953
48 Ga0209147_100045 3300025229 Bacteria 299264
49 Ga0209147_100058 3300025229 Bacteria 252750
50 Ga0209147_102150 3300025229 Bacteria 5419
51 Ga0209258_101910 3300025242 Bacteria 6155
52 Ga0209673_1023957 3300025273 Bacteria 2063
53 Ga0209130_1004799 3300025284 Bacteria 4966
54 Ga0209130_1009638 3300025284 Bacteria 2732
55 Ga0209130_1012125 3300025284 Bacteria 2273
56 Ga0209675_1019501 3300025291 Bacteria 1864
57 Ga0209675_1021614 3300025291 Bacteria 1712
58 Ga0209676_1000663 3300025292 Bacteria 49326
59 Ga0209676_1028723 3300025292 Bacteria 1726
60 Ga0209025_1000001 3300025294 Bacteria 1888151
61 Ga0209025_1000273 3300025294 Bacteria 119753
62 Ga0209025_1000347 3300025294 Bacteria 100528
63 Ga0209025_1002464 3300025294 Bacteria 19538
64 Ga0209025_1003307 3300025294 Bacteria 15506
65 Ga0209025_1005658 3300025294 Bacteria 10066
66 Ga0209025_1006698 3300025294 Bacteria 8843
67 Ga0209025_1013941 3300025294 Bacteria 5002
68 Ga0209025_1015078 3300025294 Bacteria 4691
69 Ga0209025_1028909 3300025294 Bacteria 2699
70 Ga0209025_1088607 3300025294 Bacteria 1020
71 Ga0207426_1073092 3300025302 Bacteria 950
72 Ga0207696_1020512 3300025711 Bacteria 2131
73 Ga0207655_1007626 3300025728 Bacteria 6990
74 Ga0207655_1020351 3300025728 Bacteria 3415
75 Ga0207713_1001085 3300025735 Bacteria 23381
76 Ga0207713_1052227 3300025735 Bacteria 1620
77 Ga0207713_1082706 3300025735 Bacteria 1150
78 Ga0207659_10139286 3300025926 Bacteria 1882
79 Ga0207644_10176595 3300025931 Bacteria 1671
80 Ga0207686_10401373 3300025934 Bacteria 1044
81 Ga0207709_10051421 3300025935 Bacteria 2526
82 Ga0207712_10966002 3300025961 Bacteria 755
83 Ga0237817_10167 3300030083 Bacteria 18907
84 Ga0237819_00266 3300038705 Bacteria 19073
85 Ga0237819_01016 3300038705 Bacteria 8425
86 Ga0439436_0040029 3300041404 Bacteria 1344
87 Ga0439438_099064 3300041405 Bacteria 708
88 Ga0439439_0000159 3300041406 Bacteria 9979
89 Ga0439433_0033405 3300041999 Bacteria 1182
90 Ga0439449_0000010 3300042007 Bacteria 58004
91 Ga0439449_0061106 3300042007 Bacteria 1390
92 Ga0439462_0000603 3300042015 Bacteria 7170
93 Ga0439462_0010367 3300042015 Bacteria 2360
94 Ga0466969_0000115 3300044656 Bacteria 42292
95 Ga0466966_0122559 3300044684 Bacteria 1596
96 Ga0466961_0252740 3300044693 Bacteria 1082
97 Ga0466968_0014041 3300044735 Bacteria 3159
98 Ga0466959_0005283 3300045049 Bacteria 8825
99 Ga0466967_0000101 3300045976 Bacteria 31089
100 Ga0495603_0054236 3300046455 Bacteria 2376
101 Ga0495603_0344462 3300046455 Bacteria 855
102 Ga0495584_0058189 3300046491 Bacteria 1944
103 Ga0495585_0004179 3300046492 Bacteria 9428
104 Ga0495661_0237409 3300046665 Bacteria 937
105 Ga0495676_0045290 3300047321 Bacteria 3582
106 Ga0495676_0085345 3300047321 Bacteria 2379
107 Ga0495683_0191214 3300047323 Bacteria 928
108 Ga0496100_0023966 3300048903 Bacteria 3715
109 Ga0496101_0001813 3300048904 Bacteria 12871
110 Ga0496102_0010719 3300048905 Bacteria 7897
111 Ga0496102_0343025 3300048905 Bacteria 1406
112 Ga0496102_0454397 3300048905 Bacteria 1202
113 Ga0496103_0022217 3300048906 Bacteria 3819
114 Ga0496104_0001243 3300048907 Bacteria 21946
115 Ga0496104_0117025 3300048907 Bacteria 2558
116 Ga0496105_0000266 3300048908 Bacteria 34749
117 Ga0496105_0813322 3300048908 Bacteria 710
118 Ga0496106_0001528 3300048909 Bacteria 17394
119 Ga0496107_0000213 3300048910 Bacteria 30470
120 Ga0496108_0000809 3300048911 Bacteria 24294
121 Ga0496108_0090043 3300048911 Bacteria 2608
122 Ga0496109_0000475 3300048912 Bacteria 34137
123 Ga0496110_0001048 3300048913 Bacteria 19508
124 Ga0496110_0001968 3300048913 Bacteria 15269
125 Ga0496110_0125917 3300048913 Bacteria 2311
126 Ga0496111_0006732 3300048914 Bacteria 7482
127 Ga0496111_0010429 3300048914 Bacteria 6234
128 Ga0496112_0002950 3300048915 Bacteria 13877
129 Ga0496113_0032700 3300048916 Bacteria 3780
130 Ga0496116_0008680 3300048919 Bacteria 8782
131 Ga0496116_0012500 3300048919 Bacteria 6931
132 Ga0496116_0093125 3300048919 Bacteria 1825
133 Ga0496116_0120369 3300048919 Bacteria 1521
134 Ga0496116_0198230 3300048919 Bacteria 1054
135 Ga0496117_0011639 3300048920 Bacteria 7860
136 Ga0496119_0011353 3300048922 Bacteria 7389
137 Ga0496121_0062855 3300048924 Bacteria 3038
138 Ga0496122_0086196 3300048925 Bacteria 2163
139 Ga0496122_0097456 3300048925 Bacteria 1979
140 Ga0496122_0129231 3300048925 Bacteria 1609
141 Ga0496123_0002717 3300048926 Bacteria 21261
142 Ga0496123_0031619 3300048926 Bacteria 3848
143 Ga0496124_0000620 3300048927 Bacteria 59508
144 Ga0496124_0015956 3300048927 Bacteria 7170
145 Ga0496124_0406646 3300048927 Bacteria 943
146 Ga0496124_0450840 3300048927 Bacteria 877
147 Ga0496125_0001772 3300048928 Bacteria 29886
148 Ga0496125_0033117 3300048928 Bacteria 4579
149 Ga0496125_0077445 3300048928 Bacteria 2563
150 Ga0496126_0010599 3300048929 Bacteria 9642
151 Ga0501306_018698 3300049127 Bacteria 950
152 Ga0501309_019286 3300049129 Bacteria 948
153 Ga0501208_000691 3300049655 Bacteria 2798
154 Ga0501217_005911 3300049661 Bacteria 2577
155 2511178682 2510917027 Bacteria 5287437
156 2512637624 2512564013 Bacteria 6286191
157 2512734742 2512564039 Bacteria 8739048
158 2524186470 2524023129 Bacteria 6762600
159 2550900916 2548877040 Bacteria 7507281
160 2553396468 2551306519 Bacteria 5465154
161 2555469926 2554235283 Bacteria 3683090
162 2563927059 2563366752 Bacteria 4961801
163 2571533568 2571042143 Bacteria 6986194
164 2595090783 2593339131 Bacteria 5116855
165 2595321194 2593339198 Bacteria 7267884
166 2643738122 2643221543 Bacteria 6628015
167 2644422953 2643221676 Bacteria 8119172
168 2644706359 2643221729 Bacteria 6621700
169 2644713040 2643221730 Bacteria 6523787
170 2644715504 2643221731 Bacteria 5623886
171 2644726808 2643221732 Bacteria 5756404
172 2644741513 2643221735 Bacteria 3676263
173 2672337395 2671180330 Bacteria 5521719
174 2673820865 2671180694 Bacteria 7506943
175 2685152640 2684622632 Bacteria 5380049
176 2686997936 2684623153 Bacteria 3878815
177 2698320535 2695420987 Bacteria 6152737
178 2705996557 2703719227 Bacteria 5631989
179 2721507795 2718218445 Bacteria 5113413
180 2728532496 2728368933 Bacteria 7044283
181 2739157581 2738541358 Bacteria 5932299
182 2739209673 2738543006 Bacteria 5904091
183 2739229847 2738543010 Bacteria 5583595
184 2739270647 2738543017 Bacteria 4271950
185 2745167307 2744054657 Bacteria 5016802
186 2757568639 2757320391 Bacteria 4746095
187 2777763632 2775507177 Bacteria 4384303
188 2777835845 2775507192 Bacteria 4622234
189 2793184570 2791355222 Bacteria 5898266
190 2812317132 2811994870 Bacteria 3776934
191 2817620299 2816332336 Bacteria 5207640
192 2819581544 2818991443 Bacteria 6598732
193 2819670337 2818991459 Bacteria 8736032
194 2819708972 2818991465 Bacteria 5388835
195 2819724211 2818991468 Bacteria 3723169
196 2823529095 2823526263 Bacteria 3765752
197 2842884790 2842882022 Bacteria 6158489
198 2857457132 2857453340 Bacteria 8090534
199 2857464539 2857460504 Bacteria 5194327
200 2857469682 2857465823 Bacteria 6772595
201 2857473122 2857472729 Bacteria 6568124
202 2857589201 2857586860 Bacteria 4354574
203 2857594931 2857591370 Bacteria 6569758
204 2857610520 2857609550 Bacteria 3753890
205 2864737536 2864733723 Bacteria 6770668
206 2865000128 2864997549 Bacteria 5139696
207 2865004190 2865002811 Bacteria 6333767
208 2885527533 2885526491 Bacteria 7164189
209 2888582698 2888578766 Bacteria 6743310
210 2889046726 2889042446 Bacteria 7618936
211 2889055096 2889049205 Bacteria 7524325
212 2889296291 2889295896 Bacteria 4704906
213 2898909472 2898907183 Bacteria 4067722
214 2904114881 2904113452 Bacteria 7796941
215 2904163307 2904162308 Bacteria 7086713
216 2904493547 2904490793 Bacteria 7046938
217 2904524180 2904524088 Bacteria 5887454
218 2904760236 2904755435 Bacteria 7986759
219 2907205698 2907202186 Bacteria 6632024
220 2908667699 2908665501 Bacteria 3678115
221 2915602913 2915597211 Bacteria 6475886
222 2915610356 2915606848 Bacteria 6032732
223 2919095493 2919093281 Bacteria 3660974
224 2919147243 2919143609 Bacteria 6219228
225 2919162712 2919160200 Bacteria 6929020
226 2919427292 2919425241 Bacteria 8055701
227 2919519148 2919517244 Bacteria 5858162
228 2919723515 2919720352 Bacteria 5986006
229 2919728799 2919726948 Bacteria 3696050
230 2925332503 2925326138 Bacteria 9652120
231 2928095958 2928093941 Bacteria 5965005
232 2929006672 2929004312 Bacteria 5678476
233 2929187971 2929183550 Bacteria 6377511
234 2929210473 2929206907 Bacteria 5918291
235 2929238341 2929233124 Bacteria 5948380
236 2931390174 2931384279 Bacteria 7299545
237 2936342152 2936340661 Bacteria 5139038
238 2938649817 2938649242 Bacteria 7118381
239 2938922536 2938917290 Bacteria 5914775
240 2939679805 2939679117 Bacteria 6921672
241 2945997597 2945991243 Bacteria 7008369
242 2946053811 2946053406 Bacteria 6978655
243 2947431423 2947426588 Bacteria 5357194
244 2954773362 2954773129 Bacteria 3741715
245 2960319576 2960319331 Bacteria 5502575
246 2960381213 2960375949 Bacteria 5361395
247 2964379383 2964375228 Bacteria 4909004
248 2965765833 2965761152 Bacteria 5806513
249 2968561229 2968558590 Bacteria 6956864
250 2971417174 2971410472 Bacteria 8311090
251 2979088327 2979083700 Bacteria 5894929
252 2980125652 2980125574 Bacteria 5567337
253 2980187116 2980182181 Bacteria 9454109
254 2981288035 2981284811 Bacteria 4641497
255 2981292251 2981289755 Bacteria 4641509
256 2981983654 2981980479 Bacteria 4641628
257 2981988308 2981985349 Bacteria 4641497
258 2984529233 2984527788 Bacteria 5288478
259 2984535339 2984532647 Bacteria 5288506
260 2988229379 2988225383 Bacteria 7221625
261 2996639026 2996632988 Bacteria 6921523
262 3001268770 3001267043 Bacteria 4823521
263 3001274234 3001272096 Bacteria 4729684
264 3001897462 3001892409 Bacteria 6328293
265 3006971819 3006969106 Bacteria 4739423
266 3006982211 3006978542 Bacteria 5328100
267 3006984204 3006984091 Bacteria 4207523
268 8002322271 8002317523 Bacteria 8051857
269 8022624588 8022621104 Bacteria 5241040
270 8022797939 8022792930 Bacteria 5693794
271 8022898494 8022893055 Bacteria 5300455
272 8022917645 8022914991 Bacteria 5584517
273 8022950146 8022948649 Bacteria 5366783
274 8023443643 8023438354 Bacteria 5779374
275 8023445534 8023444577 Bacteria 5661597
276 8046997724 8046991243 Bacteria 8497463
277 8054467929 8054465665 Bacteria 7323556
278 8054795812 8054795415 Bacteria 9785225
279 8055634966 8055632911 Bacteria 5283357
280 8056539881 8056533031 Bacteria 8964429
281 8057473847 8057473075 Bacteria 5892720
282 8057476297 8057473075 Bacteria 5892720
283 8057587085 8057582654 Bacteria 5218944
284 8057635803 8057632132 Bacteria 4726859
285 8057737701 8057733483 Bacteria 6578323
286 8057739154 8057733483 Bacteria 6578323
287 8057980378 8057977335 Bacteria 5694872
288 Ga0501082_0924555
289 JGI25159J45721_1002941
290 JGI25159J45721_1008210
291 JGI25151J46595_10000731
292 JGI25151J46595_10003780
293 JGI25151J46595_10003800
294 JGI25151J46595_10007592
295 JGI25151J46595_10018634
296 JGI25151J46595_10021671
297 JGI25151J46595_10027036
298 JGI25151J46595_10041962
299 JGI25151J46595_10086950
300 rootH1_10001445
301 rootL2_10013974
302 rootH1_10081199
303 JGI25160J50197_1051538
304 Ga0006562J51391_1000165
305 Ga0006562J51391_1000166
306 Ga0006562J51391_1005137
307 Ga0055538_1000284
308 Ga0055538_1000316
309 Ga0055532_1000100
310 Ga0055532_1000481
311 Ga0055532_1003250
312 Ga0055535_1001459
313 Ga0055536_1008501
314 Ga0055541_1000212
315 Ga0055541_1012227
316 Ga0055541_1013508
317 Ga0070671_100012395
318 Ga0105251_10033700
319 Ga0105250_10101511
320 Ga0105250_10108551
321 Ga0105250_10150265
322 Ga0105250_10150266
323 Ga0105247_10012604
324 Ga0105243_10001025
325 Ga0105242_10004530
326 Ga0105249_10569439
327 Ga0105239_10074534
328 Ga0105246_10000909
329 Ga0157378_10015476
330 Ga0209784_100183
331 Ga0209784_101828
332 Ga0209566_100054
333 Ga0209566_100587
334 Ga0209566_100681
335 Ga0209147_100045
336 Ga0209147_100058
337 Ga0209147_102150
338 Ga0209258_101910
339 Ga0209673_1023957
340 Ga0209130_1004799
341 Ga0209130_1009638
342 Ga0209130_1012125
343 Ga0209675_1019501
344 Ga0209675_1021614
345 Ga0209676_1000663
346 Ga0209676_1028723
347 Ga0209025_1000001
348 Ga0209025_1000273
349 Ga0209025_1000347
350 Ga0209025_1002464
351 Ga0209025_1003307
352 Ga0209025_1005658
353 Ga0209025_1006698
354 Ga0209025_1013941
355 Ga0209025_1015078
356 Ga0209025_1028909
357 Ga0209025_1088607
358 Ga0207426_1073092
359 Ga0207696_1020512
360 Ga0207655_1007626
361 Ga0207655_1020351
362 Ga0207713_1001085
363 Ga0207713_1052227
364 Ga0207713_1082706
365 Ga0207659_10139286
366 Ga0207644_10176595
367 Ga0207686_10401373
368 Ga0207709_10051421
369 Ga0207712_10966002
370 Ga0237817_10167
371 Ga0237819_00266
372 Ga0237819_01016
373 Ga0439436_0040029
374 Ga0439438_099064
375 Ga0439439_0000159
376 Ga0439433_0033405
377 Ga0439449_0000010
378 Ga0439449_0061106
379 Ga0439462_0000603
380 Ga0439462_0010367
381 Ga0466969_0000115
382 Ga0466966_0122559
383 Ga0466961_0252740
384 Ga0466968_0014041
385 Ga0466959_0005283
386 Ga0466967_0000101
387 Ga0495603_0054236
388 Ga0495603_0344462
389 Ga0495584_0058189
390 Ga0495585_0004179
391 Ga0495661_0237409
392 Ga0495676_0045290
393 Ga0495676_0085345
394 Ga0495683_0191214
395 Ga0496100_0023966
396 Ga0496101_0001813
397 Ga0496102_0010719
398 Ga0496102_0343025
399 Ga0496102_0454397
400 Ga0496103_0022217
401 Ga0496104_0001243
402 Ga0496104_0117025
403 Ga0496105_0000266
404 Ga0496105_0813322
405 Ga0496106_0001528
406 Ga0496107_0000213
407 Ga0496108_0000809
408 Ga0496108_0090043
409 Ga0496109_0000475
410 Ga0496110_0001048
411 Ga0496110_0001968
412 Ga0496110_0125917
413 Ga0496111_0006732
414 Ga0496111_0010429
415 Ga0496112_0002950
416 Ga0496113_0032700
417 Ga0496116_0008680
418 Ga0496116_0012500
419 Ga0496116_0093125
420 Ga0496116_0120369
421 Ga0496116_0198230
422 Ga0496117_0011639
423 Ga0496119_0011353
424 Ga0496121_0062855
425 Ga0496122_0086196
426 Ga0496122_0097456
427 Ga0496122_0129231
428 Ga0496123_0002717
429 Ga0496123_0031619
430 Ga0496124_0000620
431 Ga0496124_0015956
432 Ga0496124_0406646
433 Ga0496124_0450840
434 Ga0496125_0001772
435 Ga0496125_0033117
436 Ga0496125_0077445
437 Ga0496126_0010599
438 Ga0501306_018698
439 Ga0501309_019286
440 Ga0501208_000691
441 Ga0501217_005911
442 2511178682
443 2512637624
444 2512734742
445 2524186470
446 2550900916
447 2553396468
448 2555469926
449 2563927059
450 2571533568
451 2595090783
452 2595321194
453 2643738122
454 2644422953
455 2644706359
456 2644713040
457 2644715504
458 2644726808
459 2644741513
460 2672337395
461 2673820865
462 2685152640
463 2686997936
464 2698320535
465 2705996557
466 2721507795
467 2728532496
468 2739157581
469 2739209673
470 2739229847
471 2739270647
472 2745167307
473 2757568639
474 2777763632
475 2777835845
476 2793184570
477 2812317132
478 2817620299
479 2819581544
480 2819670337
481 2819708972
482 2819724211
483 2823529095
484 2842884790
485 2857457132
486 2857464539
487 2857469682
488 2857473122
489 2857589201
490 2857594931
491 2857610520
492 2864737536
493 2865000128
494 2865004190
495 2885527533
496 2888582698
497 2889046726
498 2889055096
499 2889296291
500 2898909472
501 2904114881
502 2904163307
503 2904493547
504 2904524180
505 2904760236
506 2907205698
507 2908667699
508 2915602913
509 2915610356
510 2919095493
511 2919147243
512 2919162712
513 2919427292
514 2919519148
515 2919723515
516 2919728799
517 2925332503
518 2928095958
519 2929006672
520 2929187971
521 2929210473
522 2929238341
523 2931390174
524 2936342152
525 2938649817
526 2938922536
527 2939679805
528 2945997597
529 2946053811
530 2947431423
531 2954773362
532 2960319576
533 2960381213
534 2964379383
535 2965765833
536 2968561229
537 2971417174
538 2979088327
539 2980125652
540 2980187116
541 2981288035
542 2981292251
543 2981983654
544 2981988308
545 2984529233
546 2984535339
547 2988229379
548 2996639026
549 3001268770
550 3001274234
551 3001897462
552 3006971819
553 3006982211
554 3006984204
555 8002322271
556 8022624588
557 8022797939
558 8022898494
559 8022917645
560 8022950146
561 8023443643
562 8023445534
563 8046997724
564 8054467929
565 8054795812
566 8055634966
567 8056539881
568 8057473847
569 8057476297
570 8057587085
571 8057635803
572 8057737701
573 8057739154
574 8057980378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

32

159

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q04-assembly1.cif.gz_A crystal structure of acetoin utilization protein (zp_00540088.1) from exiguobacterium sibiricum 255-15 at 2.33 a resolution 0.9554 4 210
2q04-assembly1.cif.gz_A crystal structure of acetoin utilization protein (zp_00540088.1) from exiguobacterium sibiricum 255-15 at 2.33 a resolution 0.9378 4 210
2aj6-assembly1.cif.gz_A crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 a resolution 0.758 45 122
4crz-assembly1.cif.gz_B direct visualisation of strain-induced protein prost-translational modification 0.7221 61 184
5z6n-assembly1.cif.gz_A crystal structure of escherichia coli elaa 0.6927 46 186
ID Description Score Start End Superfamily
2q04E00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9553 4 208 3.40.630.30
2q04E00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.937 4 208 3.40.630.30
af_A0A1D6G8A0_124_211_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7974 61 120 3.40.630.30
2aj6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.765 45 122 3.40.630.30
af_Q9C776_322_467_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7467 61 122 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7V6Q715-F1-model_v4 GNAT family N-acetyltransferase 0.9879 1 129 GO:0016747
AF-A0A5S9MJ11-F1-model_v4 N-acetyltransferase domain-containing protein 0.9744 1 117
AF-A0A7V6Q715-F1-model_v4 GNAT family N-acetyltransferase 0.973 1 129 GO:0016747
AF-A0A0N1KHC5-F1-model_v4 deleted 0.9713 1 146
AF-A0A521CLR2-F1-model_v4 Acetoin utilization protein AcuA 0.9686 1 210 GO:0016747
GO:0019152
GO:0045150

Map