F388128

General Info

Members Datasets Scaffolds Average Seq Length
287 210 232 535

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0000579|Ga0439436_0000579_5383_7095
Length 570
Sequence MAEWQTRLFKAPSPTSISDTFLLSRLPPKEVTHNVRRNSGEFTMARFNSKSTRARPTSRVTSTGRVLRTHQGGRGQERDERSELFLLSIANFVAQKTFYESAEDRDDRFAALVRRLAVTDPEWTAGLLGWLRGEGNLRTASLVGAAEYVKARLDAGVTHGPTNRQVIDSVLRRPDEPGELLAYWTSRYGRALPKPVKRGVADAVRRLYHPKSLLKYDTASKGYRFGDILNLVHAAPDPDKPWQGDLFQYALDRRHHPDTAVVPKSLPVLAAHRDLMALRPAKRRKVVTGSGGAQRLADAGITWEALAGWLQGPMDKAAWEAVIPSMGAMALVRNLRNFDEAGVSDEVAARVAAKISDPAEVARSRQFPFRYLAAYRHAPSLRWAYPLEQALGHSLANVPALPGRTLVLVDRSGSMFYSRLTDRSSLTYADAAAIFGAALALRAADADLVEFGTTSRRVPYRKGESVLKILERFGDLGGTDTTEAVRKHYRKHDRVLIVTDEQATYSHYGDPTAQVPAHVPVYTWNLAGHRAGHGPSGTANRHTFGGLSDAAFRMVPLLEAARDADWPWSR

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221578 Streptomyces sp. Root63 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221714 Streptomyces sp. Root264 Isolate Unclassified
11 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
12 2687453737 Frankia sp. BMG5.36 Isolate Nodule
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
15 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
16 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
17 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
18 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
19 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
20 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
21 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
22 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
23 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
24 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
25 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
26 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
27 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
28 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
29 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
30 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
31 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
32 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
33 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
34 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
35 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
36 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
37 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
38 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
39 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
40 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
41 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
42 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
43 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
90 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
99 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
100 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
101 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
102 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
103 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
104 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
105 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
106 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
107 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
190 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
191 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
203 8002775197 Frankia nepalensis CN7 Isolate Nodule
204 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
205 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
206 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
207 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
208 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
209 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
210 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.84
Metatranscriptomes 0
Isolates 19.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 2.79
Rhizoplane 0.7
Rhizosphere 80.49
Stem 0
Stem Tuber 0
Unclassified 14.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10007091 3300003316 Bacteria 25135
2 rootH2_10036518 3300003320 Bacteria 24238
3 rootL2_10115563 3300003322 Bacteria 9434
4 Ga0070709_10000040 3300005434 Bacteria 106468
5 Ga0070663_100036344 3300005455 Bacteria 3422
6 Ga0068854_100053950 3300005578 Bacteria 2889
7 Ga0068856_100000039 3300005614 Bacteria 115516
8 Ga0099826_10032052 3300006948 Bacteria 3793
9 Ga0105248_10000018 3300009177 Bacteria 294894
10 Ga0182008_10000189 3300014497 Bacteria 48770
11 Ga0182007_10000326 3300015262 Bacteria 30192
12 Ga0182007_10000846 3300015262 Bacteria 16969
13 Ga0183367_1007 3300015688 Bacteria 498079
14 Ga0209758_1009949 3300025297 Bacteria 5789
15 Ga0207647_10005219 3300025904 Bacteria 9562
16 Ga0207699_10000050 3300025906 Bacteria 106509
17 Ga0207695_10001228 3300025913 Bacteria 43892
18 Ga0207671_10000066 3300025914 Bacteria 163801
19 Ga0207694_10001378 3300025924 Bacteria 20921
20 Ga0207711_10000620 3300025941 Bacteria 35686
21 Ga0207667_10098651 3300025949 Bacteria 3014
22 Ga0207640_10096834 3300025981 Bacteria 2058
23 Ga0207639_10025511 3300026041 Bacteria 4286
24 Ga0207678_10047165 3300026067 Bacteria 3726
25 Ga0207702_10000069 3300026078 Bacteria 115538
26 Ga0268266_10148820 3300028379 Bacteria 2108
27 Ga0307517_10005429 3300028786 Bacteria 19210
28 Ga0307515_10000046 3300028794 Bacteria 293319
29 Ga0307515_10013237 3300028794 Bacteria 15431
30 Ga0307515_10032530 3300028794 Bacteria 8635
31 Ga0307511_10001377 3300030521 Bacteria 25716
32 Ga0307512_10008768 3300030522 Bacteria 9819
33 Ga0307512_10019962 3300030522 Bacteria 6086
34 Ga0307509_10007327 3300031507 Bacteria 14472
35 Ga0307509_10022846 3300031507 Bacteria 7037
36 Ga0307509_10104552 3300031507 Bacteria 2856
37 Ga0307408_100001006 3300031548 Bacteria 21743
38 Ga0307508_10041696 3300031616 Bacteria 4119
39 Ga0307514_10002565 3300031649 Bacteria 18686
40 Ga0307516_10003136 3300031730 Bacteria 21507
41 Ga0307405_10000249 3300031731 Bacteria 19642
42 Ga0307518_10029391 3300031838 Bacteria 3977
43 Ga0307406_10019361 3300031901 Bacteria 3993
44 Ga0307412_10000407 3300031911 Bacteria 26245
45 Ga0307416_100000291 3300032002 Bacteria 26243
46 Ga0307411_10027296 3300032005 Bacteria 3452
47 Ga0307507_10000110 3300033179 Bacteria 135506
48 Ga0307507_10079897 3300033179 Bacteria 2887
49 Ga0307510_10019245 3300033180 Bacteria 8011
50 Ga0307510_10106637 3300033180 Bacteria 2564
51 Ga0395898_0036698 3300037466 Bacteria 4866
52 Ga0395901_0071328 3300038443 Bacteria 3620
53 Ga0439436_0000174 3300041404 Bacteria 15175
54 Ga0439436_0000579 3300041404 Bacteria 9677
55 Ga0439439_0000071 3300041406 Bacteria 13048
56 Ga0439447_001677 3300041407 Bacteria 8135
57 Ga0439465_0000063 3300041413 Bacteria 23120
58 Ga0451853_1547220 3300041512 Bacteria 2605
59 Ga0451853_2199356 3300041512 Bacteria 4472
60 Ga0451853_3632939 3300041512 Bacteria 2953
61 Ga0439433_0000048 3300041999 Bacteria 15173
62 Ga0439449_0000117 3300042007 Bacteria 26060
63 Ga0439452_009316 3300042010 Bacteria 2897
64 Ga0439457_000001 3300042014 Bacteria 70821
65 Ga0439457_001053 3300042014 Bacteria 8332
66 Ga0439462_0000039 3300042015 Bacteria 18482
67 Ga0450920_003984 3300042122 Bacteria 2581
68 Ga0450894_000001 3300042131 Bacteria 45805
69 Ga0450895_000001 3300042132 Bacteria 31335
70 Ga0450896_000006 3300042133 Bacteria 12083
71 Ga0450898_000111 3300042134 Bacteria 7768
72 Ga0450899_001839 3300042135 Bacteria 2352
73 Ga0450903_004180 3300042138 Bacteria 2470
74 Ga0450906_000017 3300042145 Bacteria 32321
75 Ga0450906_005885 3300042145 Bacteria 2500
76 Ga0439458_0004727 3300042157 Bacteria 3101
77 Ga0450908_000011 3300042184 Bacteria 45804
78 Ga0466969_0000409 3300044656 Bacteria 23642
79 Ga0466969_0034652 3300044656 Bacteria 2557
80 Ga0466972_0000942 3300044658 Bacteria 13997
81 Ga0466966_0000034 3300044684 Bacteria 101851
82 Ga0466966_0029415 3300044684 Bacteria 3574
83 Ga0466961_0000205 3300044693 Bacteria 39653
84 Ga0466961_0074371 3300044693 Bacteria 2154
85 Ga0466971_0000010 3300044719 Bacteria 101548
86 Ga0466968_0023830 3300044735 Bacteria 2497
87 Ga0466970_0007855 3300044765 Bacteria 5355
88 Ga0466959_0000032 3300045049 Bacteria 111179
89 Ga0466959_0021550 3300045049 Bacteria 4754
90 Ga0466959_0054078 3300045049 Bacteria 2934
91 Ga0495592_0000130 3300046454 Bacteria 66637
92 Ga0495592_0085481 3300046454 Bacteria 2274
93 Ga0495603_0001145 3300046455 Bacteria 15483
94 Ga0495603_0002972 3300046455 Bacteria 10022
95 Ga0495603_0060018 3300046455 Bacteria 2247
96 Ga0495629_0000237 3300046459 Bacteria 48132
97 Ga0495629_0000860 3300046459 Bacteria 24534
98 Ga0495629_0005747 3300046459 Bacteria 9260
99 Ga0495629_0012434 3300046459 Bacteria 6165
100 Ga0495629_0072942 3300046459 Bacteria 2397
101 Ga0495651_0009607 3300046462 Bacteria 7432
102 Ga0495651_0016588 3300046462 Bacteria 5704
103 Ga0495653_0018309 3300046463 Bacteria 5691
104 Ga0495580_0016916 3300046472 Bacteria 5465
105 Ga0495639_0000730 3300046475 Bacteria 15054
106 Ga0495662_0000514 3300046476 Bacteria 17652
107 Ga0495662_0004989 3300046476 Bacteria 6648
108 Ga0495664_0000028 3300046477 Bacteria 96712
109 Ga0495664_0000457 3300046477 Bacteria 20087
110 Ga0495594_0001272 3300046499 Bacteria 13167
111 Ga0495594_0047588 3300046499 Bacteria 2355
112 Ga0495583_0035023 3300046506 Bacteria 2400
113 Ga0495606_0005633 3300046507 Bacteria 11878
114 Ga0495608_0013891 3300046511 Bacteria 5590
115 Ga0495618_0080423 3300046514 Bacteria 2079
116 Ga0495620_0013804 3300046515 Bacteria 4128
117 Ga0495628_0003892 3300046516 Bacteria 13307
118 Ga0495628_0032411 3300046516 Bacteria 4218
119 Ga0495628_0048047 3300046516 Bacteria 3383
120 Ga0495630_0021336 3300046517 Bacteria 4782
121 Ga0495643_0002420 3300046522 Bacteria 14838
122 Ga0495643_0003668 3300046522 Bacteria 11140
123 Ga0495666_0002302 3300046526 Bacteria 9522
124 Ga0495652_0000639 3300046529 Bacteria 40668
125 Ga0495652_0006586 3300046529 Bacteria 10788
126 Ga0495652_0017221 3300046529 Bacteria 6452
127 Ga0495652_0022167 3300046529 Bacteria 5639
128 Ga0495665_0004479 3300046531 Bacteria 7538
129 Ga0495640_0001564 3300046533 Bacteria 18015
130 Ga0495586_0000013 3300046535 Bacteria 134639
131 Ga0495586_0000019 3300046535 Bacteria 110060
132 Ga0495586_0001709 3300046535 Bacteria 12008
133 Ga0495586_0012128 3300046535 Bacteria 4576
134 Ga0495587_0030719 3300046536 Bacteria 3257
135 Ga0495597_0017166 3300046542 Bacteria 3411
136 Ga0495645_0015106 3300046543 Bacteria 5488
137 Ga0495645_0021955 3300046543 Bacteria 4616
138 Ga0495668_0019992 3300046616 Bacteria 3851
139 Ga0495668_0046100 3300046616 Bacteria 2422
140 Ga0495634_0000983 3300046642 Bacteria 26856
141 Ga0495634_0027802 3300046642 Bacteria 3932
142 Ga0495634_0032651 3300046642 Bacteria 3579
143 Ga0495625_0008618 3300046660 Bacteria 8679
144 Ga0495635_0000049 3300046663 Bacteria 78071
145 Ga0495635_0040085 3300046663 Bacteria 3237
146 Ga0495635_0043578 3300046663 Bacteria 3096
147 Ga0495588_0004493 3300046674 Bacteria 6165
148 Ga0495588_0004930 3300046674 Bacteria 5921
149 Ga0495657_0001644 3300046675 Bacteria 19203
150 Ga0495657_0005147 3300046675 Bacteria 10360
151 Ga0495657_0012842 3300046675 Bacteria 6207
152 Ga0495657_0049414 3300046675 Bacteria 2833
153 Ga0495599_0014235 3300046678 Bacteria 4924
154 Ga0495599_0073382 3300046678 Bacteria 2136
155 Ga0495646_0008517 3300046680 Bacteria 6514
156 Ga0495646_0017710 3300046680 Bacteria 4516
157 Ga0495646_0065410 3300046680 Bacteria 2153
158 Ga0495647_0001610 3300046681 Bacteria 6974
159 Ga0495658_0004878 3300046683 Bacteria 6581
160 Ga0495613_0000540 3300046689 Bacteria 31392
161 Ga0495613_0000631 3300046689 Bacteria 28031
162 Ga0495613_0003828 3300046689 Bacteria 11264
163 Ga0495613_0005662 3300046689 Bacteria 9362
164 Ga0495613_0005717 3300046689 Bacteria 9323
165 Ga0495613_0017394 3300046689 Bacteria 5356
166 Ga0495624_0000046 3300046690 Bacteria 78036
167 Ga0495589_0004608 3300046794 Bacteria 7328
168 Ga0495589_0012228 3300046794 Bacteria 4452
169 Ga0495600_0006117 3300046809 Bacteria 7290
170 Ga0495600_0019967 3300046809 Bacteria 4282
171 Ga0495581_0000002 3300047315 Bacteria 93443
172 Ga0495604_0001981 3300047317 Bacteria 16523
173 Ga0495604_0002524 3300047317 Bacteria 14596
174 Ga0495604_0003562 3300047317 Bacteria 12426
175 Ga0495636_0023997 3300047318 Bacteria 2472
176 Ga0495674_0119531 3300047319 Bacteria 2227
177 Ga0495676_0000044 3300047321 Bacteria 102585
178 Ga0495676_0001491 3300047321 Bacteria 20239
179 Ga0495676_0007409 3300047321 Bacteria 10069
180 Ga0495680_0040336 3300047322 Bacteria 3720
181 Ga0495687_008777 3300047443 Bacteria 5735
182 Ga0495675_0007688 3300047444 Bacteria 6648
183 Ga0495675_0041505 3300047444 Bacteria 2932
184 Ga0495685_000542 3300047447 Bacteria 11689
185 Ga0495685_002925 3300047447 Bacteria 5403
186 Ga0495685_023443 3300047447 Bacteria 2125
187 Ga0495681_0001783 3300047470 Bacteria 15860
188 Ga0495684_0016827 3300047471 Bacteria 5634
189 Ga0495593_0000625 3300047673 Bacteria 20222
190 Ga0495593_0075634 3300047673 Bacteria 1745
191 Ga0495602_0018272 3300048088 Bacteria 7007
192 Ga0495614_0000111 3300048089 Bacteria 27925
193 Ga0496109_0041067 3300048912 Bacteria 4191
194 Ga0496115_0012986 3300048918 Bacteria 6284
195 Ga0496117_0031321 3300048920 Bacteria 4063
196 Ga0496118_0007188 3300048921 Bacteria 11903
197 Ga0501031_0004365 3300049568 Bacteria 9155
198 Ga0501032_0003504 3300049569 Bacteria 11990
199 Ga0501032_0086852 3300049569 Bacteria 2078
200 Ga0501034_0006911 3300049571 Bacteria 12127
201 Ga0501034_0100516 3300049571 Bacteria 2886
202 Ga0501034_0168351 3300049571 Bacteria 2159
203 Ga0501037_0001309 3300049573 Bacteria 18318
204 Ga0501038_0004870 3300049574 Bacteria 12471
205 Ga0501041_0019749 3300049577 Bacteria 4025
206 Ga0501043_0010099 3300049579 Bacteria 7400
207 Ga0501046_0040180 3300049580 Bacteria 3739
208 Ga0501047_0001611 3300049581 Bacteria 22008
209 Ga0501047_0014874 3300049581 Bacteria 7407
210 Ga0501048_0025372 3300049582 Bacteria 4319
211 Ga0501068_0005494 3300049584 Bacteria 6943
212 Ga0501071_0000111 3300049587 Bacteria 32014
213 Ga0501072_0026414 3300049588 Bacteria 4527
214 Ga0501076_0003674 3300049592 Bacteria 10787
215 Ga0501077_0117991 3300049593 Bacteria 1682
216 Ga0501206_000090 3300049653 Bacteria 9284
217 Ga0501227_000117 3300049665 Bacteria 13749
218 Ga0501247_000028 3300049677 Bacteria 8815
219 Ga0501079_0122719 3300049741 Bacteria 2020
220 Ga0501083_0017450 3300049744 Bacteria 5003
221 Ga0501035_0001503 3300049822 Bacteria 23863
222 Ga0501035_0096441 3300049822 Bacteria 2598
223 Ga0501044_0002149 3300049823 Bacteria 22604
224 Ga0501044_0007492 3300049823 Bacteria 12005
225 Ga0501044_0111047 3300049823 Bacteria 2750
226 nmdc:mga03n38_8649_c1 3300050490 Bacteria 3664
227 nmdc:mga06z11_882_c1 3300050494 Bacteria 10953
228 Ga0495601_0001018 3300053077 Bacteria 15322
229 Ga0501082_0008367 3300060353 Bacteria 8923
230 Ga0466962_0000015 3300061719 Bacteria 101747
231 Ga0466962_0013225 3300061719 Bacteria 3968
232 Ga0530510_0130148 3300061734 Bacteria 1851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10001228 Ga0207695_1000122836 472
2 3300025914 Ga0207671_10000066 Ga0207671_1000006694 472
3 3300025924 Ga0207694_10001378 Ga0207694_1000137817 472
4 3300025904 Ga0207647_10005219 Ga0207647_100052194 478
5 3300046663 Ga0495635_0043578 Ga0495635_0043578_1626_3077 482
6 3300005455 Ga0070663_100036344 Ga0070663_1000363441 487
7 3300005578 Ga0068854_100053950 Ga0068854_1000539502 487
8 3300025949 Ga0207667_10098651 Ga0207667_100986513 487
9 3300025981 Ga0207640_10096834 Ga0207640_100968341 487
10 3300026067 Ga0207678_10047165 Ga0207678_100471655 487
11 3300028379 Ga0268266_10148820 Ga0268266_101488201 487
12 3300045049 Ga0466959_0021550 Ga0466959_0021550_1375_2973 488
13 3300061719 Ga0466962_0013225 Ga0466962_0013225_598_2196 488
14 3300031616 Ga0307508_10041696 Ga0307508_100416963 489
15 3300028794 Ga0307515_10032530 Ga0307515_100325306 490
16 iso_pu_bacteria 2508501039 2508674192 494
17 iso_pu_bacteria 2675902999 2676198742 494
18 iso_pu_bacteria 2687453737 2689960025 494
19 iso_pu_bacteria 2773857921 2774843320 494
20 iso_pu_bacteria 2837268691 2837271440 494
21 iso_pu_bacteria 8001781756 8001783739 494
22 iso_pu_bacteria 8001781756 8001784859 494
23 iso_pu_bacteria 8002775197 8002779307 494
24 iso_pu_bacteria 2861520306 2861521559 495
25 iso_pu_bacteria 2751185734 2753072623 497
26 3300009177 Ga0105248_10000018 Ga0105248_10000018186 498
27 3300025941 Ga0207711_10000620 Ga0207711_1000062023 498
28 3300048920 Ga0496117_0031321 Ga0496117_0031321_2169_3770 498
29 3300048921 Ga0496118_0007188 Ga0496118_0007188_2218_3819 498
30 3300046535 Ga0495586_0000013 Ga0495586_0000013_107968_109560 501
31 3300046616 Ga0495668_0046100 Ga0495668_0046100_29_1639 501
32 3300049581 Ga0501047_0014874 Ga0501047_0014874_2203_3807 501
33 3300049593 Ga0501077_0117991 Ga0501077_0117991_55_1623 501
34 3300049823 Ga0501044_0111047 Ga0501044_0111047_711_2363 501
35 3300044656 Ga0466969_0000409 Ga0466969_0000409_1856_3520 502
36 3300044684 Ga0466966_0000034 Ga0466966_0000034_90241_91905 502
37 3300044693 Ga0466961_0000205 Ga0466961_0000205_36118_37782 502
38 3300044719 Ga0466971_0000010 Ga0466971_0000010_20154_21818 502
39 3300046459 Ga0495629_0072942 Ga0495629_0072942_746_2338 502
40 3300049568 Ga0501031_0004365 Ga0501031_0004365_1246_2859 502
41 3300049569 Ga0501032_0003504 Ga0501032_0003504_1921_3534 502
42 3300049571 Ga0501034_0006911 Ga0501034_0006911_2097_3710 502
43 3300049573 Ga0501037_0001309 Ga0501037_0001309_872_2485 502
44 3300049577 Ga0501041_0019749 Ga0501041_0019749_268_1881 502
45 3300049579 Ga0501043_0010099 Ga0501043_0010099_755_2368 502
46 3300049580 Ga0501046_0040180 Ga0501046_0040180_1871_3484 502
47 3300049581 Ga0501047_0001611 Ga0501047_0001611_1873_3486 502
48 3300049582 Ga0501048_0025372 Ga0501048_0025372_2344_3957 502
49 3300049584 Ga0501068_0005494 Ga0501068_0005494_1525_3138 502
50 3300049587 Ga0501071_0000111 Ga0501071_0000111_3299_4912 502
51 3300049588 Ga0501072_0026414 Ga0501072_0026414_1954_3567 502
52 3300049592 Ga0501076_0003674 Ga0501076_0003674_756_2369 502
53 3300049741 Ga0501079_0122719 Ga0501079_0122719_13_1626 502
54 3300049744 Ga0501083_0017450 Ga0501083_0017450_2521_4134 502
55 3300049822 Ga0501035_0001503 Ga0501035_0001503_17504_19117 502
56 3300049823 Ga0501044_0002149 Ga0501044_0002149_3147_4760 502
57 3300060353 Ga0501082_0008367 Ga0501082_0008367_4894_6507 502
58 3300061719 Ga0466962_0000015 Ga0466962_0000015_95672_97336 502
59 3300061734 Ga0530510_0130148 Ga0530510_0130148_214_1827 502
60 3300005614 Ga0068856_100000039 Ga0068856_100000039118 503
61 3300026078 Ga0207702_10000069 Ga0207702_10000069148 503
62 3300015262 Ga0182007_10000846 Ga0182007_100008462 504
63 3300046454 Ga0495592_0085481 Ga0495592_0085481_641_2239 504
64 3300046462 Ga0495651_0016588 Ga0495651_0016588_1916_3514 505
65 3300046507 Ga0495606_0005633 Ga0495606_0005633_4047_5582 505
66 3300046516 Ga0495628_0003892 Ga0495628_0003892_4539_6137 505
67 3300046529 Ga0495652_0000639 Ga0495652_0000639_18716_20314 505
68 3300046809 Ga0495600_0006117 Ga0495600_0006117_3811_5409 505
69 3300047317 Ga0495604_0003562 Ga0495604_0003562_1680_3278 505
70 3300045049 Ga0466959_0000032 Ga0466959_0000032_47054_48772 506
71 3300031548 Ga0307408_100001006 Ga0307408_10000100639 507
72 3300031731 Ga0307405_10000249 Ga0307405_1000024915 507
73 3300031901 Ga0307406_10019361 Ga0307406_100193611 507
74 3300031911 Ga0307412_10000407 Ga0307412_1000040715 507
75 3300032002 Ga0307416_100000291 Ga0307416_10000029115 507
76 3300032005 Ga0307411_10027296 Ga0307411_100272965 507
77 3300033179 Ga0307507_10000110 Ga0307507_10000110140 507
78 3300046535 Ga0495586_0000019 Ga0495586_0000019_16071_17660 507
79 3300048918 Ga0496115_0012986 Ga0496115_0012986_1854_3482 507
80 3300049653 Ga0501206_000090 Ga0501206_000090_7447_9102 507
81 3300049665 Ga0501227_000117 Ga0501227_000117_4855_6510 507
82 3300049677 Ga0501247_000028 Ga0501247_000028_191_1846 507
83 3300005434 Ga0070709_10000040 Ga0070709_10000040200 508
84 3300025906 Ga0207699_10000050 Ga0207699_10000050125 508
85 3300041404 Ga0439436_0000174 Ga0439436_0000174_6794_8458 508
86 3300041406 Ga0439439_0000071 Ga0439439_0000071_6791_8455 508
87 3300041407 Ga0439447_001677 Ga0439447_001677_181_1845 508
88 3300041413 Ga0439465_0000063 Ga0439465_0000063_14720_16384 508
89 3300041999 Ga0439433_0000048 Ga0439433_0000048_6792_8456 508
90 3300042007 Ga0439449_0000117 Ga0439449_0000117_6754_8418 508
91 3300042010 Ga0439452_009316 Ga0439452_009316_464_2128 508
92 3300042014 Ga0439457_000001 Ga0439457_000001_33075_34739 508
93 3300042015 Ga0439462_0000039 Ga0439462_0000039_10015_11679 508
94 iso_pu_bacteria 2643221578 2643903748 508
95 iso_pu_bacteria 2643221673 2644409911 508
96 iso_pu_bacteria 2997451912 2997452634 508
97 3300046462 Ga0495651_0009607 Ga0495651_0009607_415_2043 509
98 3300046463 Ga0495653_0018309 Ga0495653_0018309_3720_5348 509
99 3300046472 Ga0495580_0016916 Ga0495580_0016916_2667_4295 509
100 3300046476 Ga0495662_0004989 Ga0495662_0004989_2893_4521 509
101 3300046511 Ga0495608_0013891 Ga0495608_0013891_2295_3923 509
102 3300046516 Ga0495628_0032411 Ga0495628_0032411_639_2267 509
103 3300046517 Ga0495630_0021336 Ga0495630_0021336_1793_3421 509
104 3300046526 Ga0495666_0002302 Ga0495666_0002302_5219_6847 509
105 3300046529 Ga0495652_0022167 Ga0495652_0022167_2210_3838 509
106 3300046531 Ga0495665_0004479 Ga0495665_0004479_32_1660 509
107 3300046533 Ga0495640_0001564 Ga0495640_0001564_2386_4014 509
108 3300046535 Ga0495586_0001709 Ga0495586_0001709_10001_11629 509
109 3300046536 Ga0495587_0030719 Ga0495587_0030719_1215_2843 509
110 3300046642 Ga0495634_0027802 Ga0495634_0027802_1218_2846 509
111 3300046675 Ga0495657_0012842 Ga0495657_0012842_2564_4192 509
112 3300046678 Ga0495599_0014235 Ga0495599_0014235_2210_3838 509
113 3300046680 Ga0495646_0008517 Ga0495646_0008517_3364_4992 509
114 3300046689 Ga0495613_0003828 Ga0495613_0003828_1218_2846 509
115 3300046809 Ga0495600_0019967 Ga0495600_0019967_1087_2715 509
116 3300047317 Ga0495604_0002524 Ga0495604_0002524_8890_10518 509
117 3300047444 Ga0495675_0007688 Ga0495675_0007688_1796_3424 509
118 3300047471 Ga0495684_0016827 Ga0495684_0016827_1952_3580 509
119 3300048088 Ga0495602_0018272 Ga0495602_0018272_3584_5212 509
120 3300053077 Ga0495601_0001018 Ga0495601_0001018_1387_3015 509
121 iso_pu_bacteria 2918501144 2918503600 509
122 iso_pu_bacteria 2643221578 2643897143 510
123 iso_pu_bacteria 2643221673 2644408287 510
124 iso_pu_bacteria 2946045630 2946051602 510
125 3300003322 rootL2_10115563 rootL2_101155635 511
126 3300046543 Ga0495645_0015106 Ga0495645_0015106_2836_4455 511
127 3300047444 Ga0495675_0041505 Ga0495675_0041505_169_1788 511
128 iso_pu_bacteria 2862290372 2862291531 511
129 3300014497 Ga0182008_10000189 Ga0182008_1000018970 512
130 3300015262 Ga0182007_10000326 Ga0182007_1000032630 512
131 3300042122 Ga0450920_003984 Ga0450920_003984_201_1829 512
132 3300042131 Ga0450894_000001 Ga0450894_000001_2805_4433 512
133 3300042132 Ga0450895_000001 Ga0450895_000001_2805_4433 512
134 3300042133 Ga0450896_000006 Ga0450896_000006_4605_6233 512
135 3300042145 Ga0450906_000017 Ga0450906_000017_3752_5380 512
136 3300042184 Ga0450908_000011 Ga0450908_000011_41372_43000 512
137 3300044656 Ga0466969_0034652 Ga0466969_0034652_647_2266 512
138 3300044658 Ga0466972_0000942 Ga0466972_0000942_1547_3166 512
139 3300044684 Ga0466966_0029415 Ga0466966_0029415_1360_2979 512
140 3300044693 Ga0466961_0074371 Ga0466961_0074371_369_1988 512
141 3300044735 Ga0466968_0023830 Ga0466968_0023830_241_1860 512
142 3300045049 Ga0466959_0054078 Ga0466959_0054078_88_1707 512
143 3300046454 Ga0495592_0000130 Ga0495592_0000130_8454_10127 512
144 3300046477 Ga0495664_0000028 Ga0495664_0000028_18474_20147 512
145 3300046522 Ga0495643_0002420 Ga0495643_0002420_5533_7191 512
146 3300047318 Ga0495636_0023997 Ga0495636_0023997_556_2214 512
147 3300047447 Ga0495685_000542 Ga0495685_000542_3324_4982 512
148 iso_pu_bacteria 2547132111 2547410987 512
149 iso_pu_bacteria 2582581314 2585317738 512
150 iso_pu_bacteria 2616644814 2616694016 512
151 iso_pu_bacteria 2616644941 2616899201 512
152 iso_pu_bacteria 2643221647 2644270862 512
153 iso_pu_bacteria 2643221678 2644435528 512
154 iso_pu_bacteria 2784132148 2784587160 512
155 iso_pu_bacteria 2784746763 2785345220 512
156 iso_pu_bacteria 2808606359 2808848150 512
157 iso_pu_bacteria 2808606375 2808918908 512
158 iso_pu_bacteria 2811994917 2812481932 512
159 iso_pu_bacteria 2862281513 2862288978 512
160 iso_pu_bacteria 2862382967 2862391215 512
161 iso_pu_bacteria 2863404153 2863406477 512
162 iso_pu_bacteria 2912715099 2912721896 512
163 iso_pu_bacteria 2919468124 2919475300 512
164 iso_pu_bacteria 2935390628 2935396013 512
165 iso_pu_bacteria 2946064051 2946066057 512
166 iso_pu_bacteria 2946072368 2946074357 512
167 iso_pu_bacteria 2947224130 2947231322 512
168 iso_pu_bacteria 2954380949 2954388079 512
169 iso_pu_bacteria 2954673503 2954675001 512
170 iso_pu_bacteria 2954682443 2954689134 512
171 iso_pu_bacteria 2954691527 2954698886 512
172 iso_pu_bacteria 2954701450 2954703335 512
173 iso_pu_bacteria 2954721474 2954727828 512
174 iso_pu_bacteria 2966598605 2966603946 512
175 iso_pu_bacteria 2990059506 2990066277 512
176 iso_pu_bacteria 3006493962 3006496557 512
177 iso_pu_bacteria 8008558824 8008561834 512
178 iso_pu_bacteria 8023623736 8023631627 512
179 iso_pu_bacteria 8048406513 8048407780 512
180 iso_pu_bacteria 8056447290 8056449086 512
181 iso_pu_bacteria 8056667051 8056668109 512
182 iso_pu_bacteria 8056829672 8056833076 512
183 3300046680 Ga0495646_0017710 Ga0495646_0017710_1274_2950 513
184 3300006948 Ga0099826_10032052 Ga0099826_100320524 515
185 3300028794 Ga0307515_10000046 Ga0307515_10000046143 515
186 3300046455 Ga0495603_0060018 Ga0495603_0060018_272_1852 515
187 3300046459 Ga0495629_0012434 Ga0495629_0012434_4243_5823 515
188 3300046514 Ga0495618_0080423 Ga0495618_0080423_128_1783 515
189 3300046516 Ga0495628_0048047 Ga0495628_0048047_524_2179 515
190 3300046529 Ga0495652_0006586 Ga0495652_0006586_2794_4482 515
191 3300046642 Ga0495634_0032651 Ga0495634_0032651_640_2220 515
192 3300046675 Ga0495657_0005147 Ga0495657_0005147_5555_7135 515
193 3300046678 Ga0495599_0073382 Ga0495599_0073382_100_1755 515
194 3300046683 Ga0495658_0004878 Ga0495658_0004878_2718_4400 515
195 3300046689 Ga0495613_0017394 Ga0495613_0017394_2550_4130 515
196 3300047322 Ga0495680_0040336 Ga0495680_0040336_1059_2714 515
197 3300047447 Ga0495685_002925 Ga0495685_002925_3766_5346 515
198 3300047673 Ga0495593_0075634 Ga0495593_0075634_11_1591 515
199 3300049823 Ga0501044_0007492 Ga0501044_0007492_8192_9772 515
200 3300003316 rootH1_10007091 rootH1_1000709120 516
201 3300003320 rootH2_10036518 rootH2_100365183 516
202 3300015688 Ga0183367_1007 Ga0183367_1007148 516
203 3300025297 Ga0209758_1009949 Ga0209758_10099495 516
204 3300026041 Ga0207639_10025511 Ga0207639_100255113 516
205 3300028786 Ga0307517_10005429 Ga0307517_1000542912 516
206 3300028794 Ga0307515_10013237 Ga0307515_100132378 516
207 3300030521 Ga0307511_10001377 Ga0307511_1000137710 516
208 3300030522 Ga0307512_10008768 Ga0307512_100087683 516
209 3300030522 Ga0307512_10019962 Ga0307512_100199623 516
210 3300031507 Ga0307509_10007327 Ga0307509_100073272 516
211 3300031507 Ga0307509_10022846 Ga0307509_100228466 516
212 3300031507 Ga0307509_10104552 Ga0307509_101045521 516
213 3300031649 Ga0307514_10002565 Ga0307514_1000256518 516
214 3300031730 Ga0307516_10003136 Ga0307516_100031362 516
215 3300031838 Ga0307518_10029391 Ga0307518_100293913 516
216 3300033179 Ga0307507_10079897 Ga0307507_100798972 516
217 3300033180 Ga0307510_10019245 Ga0307510_100192455 516
218 3300033180 Ga0307510_10106637 Ga0307510_101066371 516
219 3300037466 Ga0395898_0036698 Ga0395898_0036698_123_1706 516
220 3300038443 Ga0395901_0071328 Ga0395901_0071328_47_1630 516
221 3300041404 Ga0439436_0000579 Ga0439436_0000579_5383_7095 516
222 3300041512 Ga0451853_1547220 Ga0451853_1547220_283_1875 516
223 3300041512 Ga0451853_2199356 Ga0451853_2199356_2271_3857 516
224 3300041512 Ga0451853_3632939 Ga0451853_3632939_1263_2846 516
225 3300042014 Ga0439457_001053 Ga0439457_001053_1126_2838 516
226 3300042134 Ga0450898_000111 Ga0450898_000111_617_2203 516
227 3300042135 Ga0450899_001839 Ga0450899_001839_231_1868 516
228 3300042138 Ga0450903_004180 Ga0450903_004180_321_1901 516
229 3300042145 Ga0450906_005885 Ga0450906_005885_55_1641 516
230 3300042157 Ga0439458_0004727 Ga0439458_0004727_763_2346 516
231 3300044765 Ga0466970_0007855 Ga0466970_0007855_1657_3243 516
232 3300046455 Ga0495603_0001145 Ga0495603_0001145_5530_7131 516
233 3300046455 Ga0495603_0002972 Ga0495603_0002972_6950_8530 516
234 3300046459 Ga0495629_0000237 Ga0495629_0000237_6750_8351 516
235 3300046459 Ga0495629_0000860 Ga0495629_0000860_4768_6432 516
236 3300046459 Ga0495629_0005747 Ga0495629_0005747_2462_4045 516
237 3300046475 Ga0495639_0000730 Ga0495639_0000730_8463_10127 516
238 3300046476 Ga0495662_0000514 Ga0495662_0000514_1913_3577 516
239 3300046477 Ga0495664_0000457 Ga0495664_0000457_3932_5515 516
240 3300046499 Ga0495594_0001272 Ga0495594_0001272_3296_4876 516
241 3300046499 Ga0495594_0047588 Ga0495594_0047588_736_2325 516
242 3300046506 Ga0495583_0035023 Ga0495583_0035023_668_2272 516
243 3300046515 Ga0495620_0013804 Ga0495620_0013804_2252_3856 516
244 3300046522 Ga0495643_0003668 Ga0495643_0003668_9279_10883 516
245 3300046529 Ga0495652_0017221 Ga0495652_0017221_3485_5068 516
246 3300046535 Ga0495586_0012128 Ga0495586_0012128_835_2526 516
247 3300046542 Ga0495597_0017166 Ga0495597_0017166_201_1805 516
248 3300046543 Ga0495645_0021955 Ga0495645_0021955_2560_4143 516
249 3300046616 Ga0495668_0019992 Ga0495668_0019992_2058_3662 516
250 3300046642 Ga0495634_0000983 Ga0495634_0000983_7491_9155 516
251 3300046660 Ga0495625_0008618 Ga0495625_0008618_1587_3170 516
252 3300046663 Ga0495635_0000049 Ga0495635_0000049_13254_14945 516
253 3300046663 Ga0495635_0040085 Ga0495635_0040085_893_2476 516
254 3300046674 Ga0495588_0004493 Ga0495588_0004493_2345_3934 516
255 3300046674 Ga0495588_0004930 Ga0495588_0004930_4316_5896 516
256 3300046675 Ga0495657_0001644 Ga0495657_0001644_16521_18104 516
257 3300046675 Ga0495657_0049414 Ga0495657_0049414_829_2493 516
258 3300046680 Ga0495646_0065410 Ga0495646_0065410_10_1593 516
259 3300046681 Ga0495647_0001610 Ga0495647_0001610_4173_5864 516
260 3300046689 Ga0495613_0000540 Ga0495613_0000540_6615_8216 516
261 3300046689 Ga0495613_0000631 Ga0495613_0000631_1546_3129 516
262 3300046689 Ga0495613_0005662 Ga0495613_0005662_6595_8259 516
263 3300046689 Ga0495613_0005717 Ga0495613_0005717_5528_7111 516
264 3300046690 Ga0495624_0000046 Ga0495624_0000046_13813_15504 516
265 3300046794 Ga0495589_0004608 Ga0495589_0004608_602_2206 516
266 3300046794 Ga0495589_0012228 Ga0495589_0012228_2502_4106 516
267 3300047315 Ga0495581_0000002 Ga0495581_0000002_28280_29944 516
268 3300047317 Ga0495604_0001981 Ga0495604_0001981_7241_8824 516
269 3300047319 Ga0495674_0119531 Ga0495674_0119531_55_1638 516
270 3300047321 Ga0495676_0000044 Ga0495676_0000044_36060_37751 516
271 3300047321 Ga0495676_0001491 Ga0495676_0001491_6708_8309 516
272 3300047321 Ga0495676_0007409 Ga0495676_0007409_6997_8577 516
273 3300047443 Ga0495687_008777 Ga0495687_008777_1089_2672 516
274 3300047447 Ga0495685_023443 Ga0495685_023443_17_1621 516
275 3300047470 Ga0495681_0001783 Ga0495681_0001783_14052_15635 516
276 3300047673 Ga0495593_0000625 Ga0495593_0000625_3384_4967 516
277 3300048089 Ga0495614_0000111 Ga0495614_0000111_19785_21386 516
278 3300048912 Ga0496109_0041067 Ga0496109_0041067_240_1829 516
279 3300049569 Ga0501032_0086852 Ga0501032_0086852_413_1996 516
280 3300049571 Ga0501034_0100516 Ga0501034_0100516_104_1687 516
281 3300049571 Ga0501034_0168351 Ga0501034_0168351_103_1686 516
282 3300049574 Ga0501038_0004870 Ga0501038_0004870_97_1680 516
283 3300049822 Ga0501035_0096441 Ga0501035_0096441_207_1790 516
284 3300050490 nmdc:mga03n38_8649_c1 nmdc:mga03n38_8649_c1_1877_3460 516
285 3300050494 nmdc:mga06z11_882_c1 nmdc:mga06z11_882_c1_998_2578 516
286 iso_pu_bacteria 2643221714 2644630483 516
287 iso_pu_bacteria 8025478263 8025485328 516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05731

TROVE

TROVE domain

300

382

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvp-assembly1.cif.gz_A ro autoantigen complexed with rnas 0.7586 13 507
1yvr-assembly1.cif.gz_A ro autoantigen 0.7579 13 492
1yvp-assembly2.cif.gz_B ro autoantigen complexed with rnas 0.757 13 507
2i91-assembly1.cif.gz_A 60kda ro autoantigen in complex with a fragment of misfolded rna 0.7439 2 502
2i91-assembly2.cif.gz_B 60kda ro autoantigen in complex with a fragment of misfolded rna 0.7357 2 502
ID Description Score Start End Superfamily
1yvpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8228 346 507 3.40.50.410
af_Q27274_446_641_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7991 326 501 3.40.50.410
af_F1QQM0_342_534_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7851 332 502 3.40.50.410
af_P10155_345_538_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7268 334 501 3.40.50.410
af_Q27274_446_641_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7231 326 501 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A7J0CMB3-F1-model_v4 TROVE domain-containing protein 0.9769 61 142
AF-A0A6B2XY09-F1-model_v4 TROVE domain-containing protein 0.9735 220 351 GO:0003723
GO:0005737
GO:0046872
GO:1990904
AF-A0A6B1QFI1-F1-model_v4 deleted 0.953 211 516
AF-A0A6B3I624-F1-model_v4 TROVE domain-containing protein 0.9485 10 105 GO:0003723
AF-A0A6B1QFI1-F1-model_v4 deleted 0.947 211 516

Feature Viewer

pLDDT pTM Quality
85.31 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map