F387987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 177 | 287 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_11118746|Ga0105245_111187463 |
| Length | 73 |
| Sequence | VHDIVDLERRGVPSVFVASTEFVEAAAAQSAALGVEPARVFVPHPIQDRTDDEMRALADAAFDEIVAAVTTAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 28 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 32 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 88 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 89 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 90 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 91 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 92 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 93 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 96 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 97 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 98 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 99 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 100 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 101 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 102 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 103 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 104 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 105 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 106 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 107 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 108 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 109 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 110 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 111 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 112 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 113 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 129 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 132 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 133 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 134 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 160 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 161 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 163 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 164 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 165 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 166 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 173 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.26 |
| Metatranscriptomes | 1.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.38 |
| Nodule | 0 |
| Rhizoplane | 9.41 |
| Rhizosphere | 72.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_101589727 | 3300005330 | Unclassified | 530 |
| 2 | Ga0070670_101585057 | 3300005331 | Bacteria | 602 |
| 3 | Ga0068868_100844995 | 3300005338 | Bacteria | 829 |
| 4 | Ga0070689_100177292 | 3300005340 | Bacteria | 1729 |
| 5 | Ga0070687_100749350 | 3300005343 | Unclassified | 687 |
| 6 | Ga0070661_100618683 | 3300005344 | Bacteria | 877 |
| 7 | Ga0070668_100099544 | 3300005347 | Bacteria | 2302 |
| 8 | Ga0070675_100088735 | 3300005354 | Bacteria | 2588 |
| 9 | Ga0070671_100012324 | 3300005355 | Bacteria | 6884 |
| 10 | Ga0070671_100924476 | 3300005355 | Bacteria | 763 |
| 11 | Ga0070674_100082498 | 3300005356 | Bacteria | 2300 |
| 12 | Ga0070667_100684599 | 3300005367 | Bacteria | 948 |
| 13 | Ga0070714_102419767 | 3300005435 | Bacteria | 510 |
| 14 | Ga0070713_100914900 | 3300005436 | Bacteria | 844 |
| 15 | Ga0070711_101164151 | 3300005439 | Bacteria | 666 |
| 16 | Ga0068867_100034919 | 3300005459 | Bacteria | 3646 |
| 17 | Ga0070685_10396686 | 3300005466 | Bacteria | 955 |
| 18 | Ga0070685_10676962 | 3300005466 | Bacteria | 750 |
| 19 | Ga0070684_100441641 | 3300005535 | Bacteria | 1202 |
| 20 | Ga0070684_101461613 | 3300005535 | Bacteria | 644 |
| 21 | Ga0070672_100302026 | 3300005543 | Bacteria | 1357 |
| 22 | Ga0070686_100099968 | 3300005544 | Bacteria | 1957 |
| 23 | Ga0070686_101307399 | 3300005544 | Bacteria | 606 |
| 24 | Ga0070664_100413989 | 3300005564 | Bacteria | 1234 |
| 25 | Ga0068866_10177726 | 3300005718 | Bacteria | 1255 |
| 26 | Ga0068866_10713456 | 3300005718 | Bacteria | 689 |
| 27 | Ga0068861_100066350 | 3300005719 | Bacteria | 2782 |
| 28 | Ga0068861_100629224 | 3300005719 | Bacteria | 989 |
| 29 | Ga0068863_100534138 | 3300005841 | Bacteria | 1157 |
| 30 | Ga0068860_100314109 | 3300005843 | Bacteria | 1537 |
| 31 | Ga0068860_101317468 | 3300005843 | Bacteria | 743 |
| 32 | Ga0068862_100051179 | 3300005844 | Bacteria | 3532 |
| 33 | Ga0081455_10069478 | 3300005937 | Bacteria | 2929 |
| 34 | Ga0075365_10009780 | 3300006038 | Bacteria | 5541 |
| 35 | Ga0075365_10223080 | 3300006038 | Bacteria | 1322 |
| 36 | Ga0075365_10390717 | 3300006038 | Bacteria | 981 |
| 37 | Ga0075365_10440848 | 3300006038 | Bacteria | 920 |
| 38 | Ga0075365_10986447 | 3300006038 | Bacteria | 594 |
| 39 | Ga0075368_10111056 | 3300006042 | Bacteria | 1130 |
| 40 | Ga0075363_100026088 | 3300006048 | Bacteria | 2987 |
| 41 | Ga0075363_100064720 | 3300006048 | Bacteria | 1976 |
| 42 | Ga0075363_100157291 | 3300006048 | Bacteria | 1285 |
| 43 | Ga0075364_10000990 | 3300006051 | Bacteria | 15049 |
| 44 | Ga0075364_10111348 | 3300006051 | Bacteria | 1827 |
| 45 | Ga0075364_10252896 | 3300006051 | Bacteria | 1197 |
| 46 | Ga0075364_10374608 | 3300006051 | Bacteria | 971 |
| 47 | Ga0075364_10525867 | 3300006051 | Bacteria | 809 |
| 48 | Ga0075364_10534139 | 3300006051 | Bacteria | 802 |
| 49 | Ga0075362_10031850 | 3300006177 | Bacteria | 2285 |
| 50 | Ga0075367_10039556 | 3300006178 | Bacteria | 2750 |
| 51 | Ga0075367_10212886 | 3300006178 | Bacteria | 1208 |
| 52 | Ga0075367_10607604 | 3300006178 | Bacteria | 695 |
| 53 | Ga0075369_10330517 | 3300006186 | Bacteria | 714 |
| 54 | Ga0075366_10801668 | 3300006195 | Bacteria | 586 |
| 55 | Ga0097621_100244176 | 3300006237 | Bacteria | 1571 |
| 56 | Ga0075370_10080829 | 3300006353 | Bacteria | 1868 |
| 57 | Ga0075370_10374155 | 3300006353 | Bacteria | 853 |
| 58 | Ga0075370_10412850 | 3300006353 | Bacteria | 811 |
| 59 | Ga0075428_101096833 | 3300006844 | Bacteria | 841 |
| 60 | Ga0075428_101975595 | 3300006844 | Bacteria | 605 |
| 61 | Ga0075429_101690029 | 3300006880 | Bacteria | 550 |
| 62 | Ga0068865_101570567 | 3300006881 | Bacteria | 591 |
| 63 | Ga0075435_101117731 | 3300007076 | Bacteria | 689 |
| 64 | Ga0105250_10536985 | 3300009092 | Bacteria | 535 |
| 65 | Ga0111539_10151991 | 3300009094 | Bacteria | 2710 |
| 66 | Ga0111539_12664861 | 3300009094 | Bacteria | 579 |
| 67 | Ga0111539_12817823 | 3300009094 | Bacteria | 563 |
| 68 | Ga0105245_10080839 | 3300009098 | Bacteria | 2969 |
| 69 | Ga0105245_11118746 | 3300009098 | Unclassified | 834 |
| 70 | Ga0105247_10786747 | 3300009101 | Bacteria | 724 |
| 71 | Ga0105247_10791771 | 3300009101 | Bacteria | 722 |
| 72 | Ga0114129_12021783 | 3300009147 | Bacteria | 696 |
| 73 | Ga0105243_10007049 | 3300009148 | Bacteria | 8647 |
| 74 | Ga0105241_10858516 | 3300009174 | Bacteria | 840 |
| 75 | Ga0105242_10044681 | 3300009176 | Bacteria | 3588 |
| 76 | Ga0105248_10480361 | 3300009177 | Unclassified | 1401 |
| 77 | Ga0105249_12005005 | 3300009553 | Bacteria | 651 |
| 78 | Ga0105249_12494628 | 3300009553 | Unclassified | 589 |
| 79 | Ga0105239_12426461 | 3300010375 | Bacteria | 611 |
| 80 | Ga0105246_10645920 | 3300011119 | Bacteria | 920 |
| 81 | Ga0105246_11725299 | 3300011119 | Bacteria | 596 |
| 82 | Ga0157378_10017880 | 3300013297 | Bacteria | 6222 |
| 83 | Ga0163162_12238712 | 3300013306 | Bacteria | 628 |
| 84 | Ga0163162_12495422 | 3300013306 | Bacteria | 594 |
| 85 | Ga0157375_10062379 | 3300013308 | Bacteria | 3704 |
| 86 | Ga0157375_10335750 | 3300013308 | Bacteria | 1676 |
| 87 | Ga0157375_12306283 | 3300013308 | Bacteria | 642 |
| 88 | Ga0163163_10581262 | 3300014325 | Bacteria | 1183 |
| 89 | Ga0157380_10432996 | 3300014326 | Bacteria | 1258 |
| 90 | Ga0157380_10948293 | 3300014326 | Bacteria | 890 |
| 91 | Ga0157380_11422214 | 3300014326 | Bacteria | 744 |
| 92 | Ga0157377_11302337 | 3300014745 | Bacteria | 568 |
| 93 | Ga0157379_10060890 | 3300014968 | Bacteria | 3375 |
| 94 | Ga0157379_10602627 | 3300014968 | Bacteria | 1025 |
| 95 | Ga0206352_11121634 | 3300020078 | Bacteria | 693 |
| 96 | Ga0224712_10436504 | 3300022467 | Bacteria | 627 |
| 97 | Ga0207642_10008068 | 3300025899 | Bacteria | 3592 |
| 98 | Ga0207710_10413634 | 3300025900 | Bacteria | 693 |
| 99 | Ga0207643_10343742 | 3300025908 | Bacteria | 936 |
| 100 | Ga0207663_11423987 | 3300025916 | Bacteria | 558 |
| 101 | Ga0207681_11392935 | 3300025923 | Bacteria | 589 |
| 102 | Ga0207659_10336696 | 3300025926 | Bacteria | 1249 |
| 103 | Ga0207687_10077209 | 3300025927 | Bacteria | 2395 |
| 104 | Ga0207644_10927130 | 3300025931 | Bacteria | 730 |
| 105 | Ga0207709_10052776 | 3300025935 | Bacteria | 2499 |
| 106 | Ga0207670_10912260 | 3300025936 | Unclassified | 736 |
| 107 | Ga0207691_10256467 | 3300025940 | Bacteria | 1508 |
| 108 | Ga0207691_10562524 | 3300025940 | Bacteria | 966 |
| 109 | Ga0207711_11021662 | 3300025941 | Unclassified | 766 |
| 110 | Ga0207661_10186300 | 3300025944 | Bacteria | 1817 |
| 111 | Ga0207679_10622058 | 3300025945 | Bacteria | 975 |
| 112 | Ga0207712_10100735 | 3300025961 | Bacteria | 2147 |
| 113 | Ga0207668_10089214 | 3300025972 | Bacteria | 2260 |
| 114 | Ga0207677_12129438 | 3300026023 | Bacteria | 522 |
| 115 | Ga0207639_10888095 | 3300026041 | Bacteria | 833 |
| 116 | Ga0207641_10803081 | 3300026088 | Bacteria | 931 |
| 117 | Ga0207648_10004938 | 3300026089 | Bacteria | 13570 |
| 118 | Ga0207674_11580484 | 3300026116 | Bacteria | 624 |
| 119 | Ga0207675_100007094 | 3300026118 | Bacteria | 10589 |
| 120 | Ga0207675_100071551 | 3300026118 | Bacteria | 3243 |
| 121 | Ga0207675_100791480 | 3300026118 | Bacteria | 961 |
| 122 | Ga0207675_101643452 | 3300026118 | Unclassified | 663 |
| 123 | Ga0207698_12073315 | 3300026142 | Bacteria | 582 |
| 124 | Ga0207698_12464751 | 3300026142 | Bacteria | 531 |
| 125 | Ga0268265_10159031 | 3300028380 | Bacteria | 1916 |
| 126 | Ga0268264_10154648 | 3300028381 | Bacteria | 2060 |
| 127 | Ga0268264_11272748 | 3300028381 | Bacteria | 745 |
| 128 | Ga0268264_11585380 | 3300028381 | Bacteria | 665 |
| 129 | Ga0316576_10003737 | 3300031727 | Bacteria | 8983 |
| 130 | Ga0316576_10475133 | 3300031727 | Bacteria | 921 |
| 131 | Ga0316576_10496413 | 3300031727 | Bacteria | 898 |
| 132 | Ga0316578_10076427 | 3300031728 | Bacteria | 1988 |
| 133 | Ga0307415_101636562 | 3300032126 | Bacteria | 619 |
| 134 | Ga0373939_0300748 | 3300035114 | Bacteria | 640 |
| 135 | Ga0373943_0886535 | 3300035170 | Bacteria | 533 |
| 136 | Ga0316574_0015400 | 3300035398 | Bacteria | 4436 |
| 137 | Ga0316574_0049111 | 3300035398 | Bacteria | 2623 |
| 138 | Ga0316574_0110985 | 3300035398 | Bacteria | 1758 |
| 139 | Ga0316574_0196329 | 3300035398 | Bacteria | 1297 |
| 140 | Ga0316574_0341400 | 3300035398 | Bacteria | 949 |
| 141 | Ga0316574_0674244 | 3300035398 | Bacteria | 635 |
| 142 | Ga0316574_0754259 | 3300035398 | Bacteria | 594 |
| 143 | Ga0373931_0504850 | 3300035691 | Bacteria | 781 |
| 144 | Ga0373937_2012863 | 3300036401 | Bacteria | 524 |
| 145 | Ga0316582_0139655 | 3300036647 | Bacteria | 1633 |
| 146 | Ga0316582_0489628 | 3300036647 | Bacteria | 848 |
| 147 | Ga0316584_0295003 | 3300036712 | Bacteria | 1175 |
| 148 | Ga0439465_0059136 | 3300041413 | Bacteria | 1268 |
| 149 | Ga0451789_1238268 | 3300041443 | Bacteria | 523 |
| 150 | Ga0451791_0790917 | 3300041451 | Bacteria | 538 |
| 151 | Ga0451793_0230090 | 3300041452 | Bacteria | 516 |
| 152 | Ga0451793_0701768 | 3300041452 | Unclassified | 572 |
| 153 | Ga0451800_0559365 | 3300041459 | Bacteria | 572 |
| 154 | Ga0451804_0463578 | 3300041463 | Bacteria | 532 |
| 155 | Ga0451851_0119914 | 3300041507 | Bacteria | 501 |
| 156 | Ga0451843_1498660 | 3300041509 | Bacteria | 629 |
| 157 | Ga0451843_1700329 | 3300041509 | Bacteria | 545 |
| 158 | Ga0451855_0667362 | 3300041511 | Bacteria | 566 |
| 159 | Ga0451855_1609421 | 3300041511 | Bacteria | 586 |
| 160 | Ga0451853_0769242 | 3300041512 | Unclassified | 721 |
| 161 | Ga0450923_015160 | 3300042125 | Bacteria | 1438 |
| 162 | Ga0439446_0093260 | 3300042156 | Bacteria | 945 |
| 163 | Ga0439434_0250020 | 3300042435 | Bacteria | 606 |
| 164 | Ga0450918_044918 | 3300042531 | Bacteria | 798 |
| 165 | Ga0451577_0046641 | 3300042876 | Bacteria | 3876 |
| 166 | Ga0453684_0002246 | 3300044712 | Bacteria | 47929 |
| 167 | Ga0451576_1551728 | 3300045051 | Bacteria | 687 |
| 168 | Ga0495603_0056906 | 3300046455 | Bacteria | 2314 |
| 169 | Ga0495641_0379438 | 3300046461 | Bacteria | 640 |
| 170 | Ga0495664_0883743 | 3300046477 | Bacteria | 523 |
| 171 | Ga0495630_0570492 | 3300046517 | Bacteria | 868 |
| 172 | Ga0495630_0685871 | 3300046517 | Bacteria | 784 |
| 173 | Ga0495640_0665458 | 3300046533 | Bacteria | 626 |
| 174 | Ga0495587_0174312 | 3300046536 | Bacteria | 1221 |
| 175 | Ga0495635_0480867 | 3300046663 | Bacteria | 819 |
| 176 | Ga0495624_0904057 | 3300046690 | Bacteria | 520 |
| 177 | Ga0495676_0733796 | 3300047321 | Bacteria | 638 |
| 178 | Ga0495602_0800634 | 3300048088 | Bacteria | 633 |
| 179 | Ga0496101_0069295 | 3300048904 | Bacteria | 2580 |
| 180 | Ga0496101_0275207 | 3300048904 | Bacteria | 1315 |
| 181 | Ga0496101_0342692 | 3300048904 | Bacteria | 1174 |
| 182 | Ga0496102_0196158 | 3300048905 | Bacteria | 1903 |
| 183 | Ga0496102_0311044 | 3300048905 | Bacteria | 1485 |
| 184 | Ga0496103_0123541 | 3300048906 | Bacteria | 1650 |
| 185 | Ga0496103_1041340 | 3300048906 | Bacteria | 508 |
| 186 | Ga0496104_0111951 | 3300048907 | Bacteria | 2617 |
| 187 | Ga0496104_1660520 | 3300048907 | Bacteria | 541 |
| 188 | Ga0496105_0061487 | 3300048908 | Bacteria | 3099 |
| 189 | Ga0496108_0217399 | 3300048911 | Bacteria | 1660 |
| 190 | Ga0496108_1578349 | 3300048911 | Bacteria | 544 |
| 191 | Ga0496109_0499878 | 3300048912 | Bacteria | 1148 |
| 192 | Ga0496109_1398072 | 3300048912 | Bacteria | 635 |
| 193 | Ga0496110_0093609 | 3300048913 | Bacteria | 2690 |
| 194 | Ga0496110_0133405 | 3300048913 | Bacteria | 2243 |
| 195 | Ga0496111_0131064 | 3300048914 | Bacteria | 1855 |
| 196 | Ga0496111_0449419 | 3300048914 | Bacteria | 951 |
| 197 | Ga0496114_0001390 | 3300048917 | Bacteria | 18357 |
| 198 | Ga0496114_0211585 | 3300048917 | Bacteria | 1701 |
| 199 | Ga0496114_0328821 | 3300048917 | Bacteria | 1351 |
| 200 | Ga0501031_0022110 | 3300049568 | Bacteria | 4144 |
| 201 | Ga0501031_0252476 | 3300049568 | Bacteria | 1146 |
| 202 | Ga0501031_0464827 | 3300049568 | Bacteria | 817 |
| 203 | Ga0501032_0516910 | 3300049569 | Bacteria | 762 |
| 204 | Ga0501033_0714376 | 3300049570 | Bacteria | 681 |
| 205 | Ga0501036_0030557 | 3300049572 | Bacteria | 4549 |
| 206 | Ga0501036_0390504 | 3300049572 | Bacteria | 1161 |
| 207 | Ga0501036_0409866 | 3300049572 | Bacteria | 1130 |
| 208 | Ga0501037_0291804 | 3300049573 | Bacteria | 1134 |
| 209 | Ga0501038_0365051 | 3300049574 | Bacteria | 1122 |
| 210 | Ga0501039_0167069 | 3300049575 | Bacteria | 1730 |
| 211 | Ga0501039_1212444 | 3300049575 | Bacteria | 583 |
| 212 | Ga0501039_1408799 | 3300049575 | Bacteria | 536 |
| 213 | Ga0501041_0323750 | 3300049577 | Bacteria | 972 |
| 214 | Ga0501042_0042677 | 3300049578 | Bacteria | 3229 |
| 215 | Ga0501042_0378933 | 3300049578 | Bacteria | 1024 |
| 216 | Ga0501042_0941718 | 3300049578 | Bacteria | 629 |
| 217 | Ga0501048_0050289 | 3300049582 | Bacteria | 2968 |
| 218 | Ga0501048_0211727 | 3300049582 | Bacteria | 1375 |
| 219 | Ga0501048_0660421 | 3300049582 | Bacteria | 751 |
| 220 | Ga0501067_0263816 | 3300049583 | Bacteria | 959 |
| 221 | Ga0501068_0412820 | 3300049584 | Bacteria | 871 |
| 222 | Ga0501069_0399102 | 3300049585 | Bacteria | 814 |
| 223 | Ga0501071_0035128 | 3300049587 | Bacteria | 3570 |
| 224 | Ga0501071_0089909 | 3300049587 | Bacteria | 2254 |
| 225 | Ga0501071_0418411 | 3300049587 | Bacteria | 1024 |
| 226 | Ga0501071_1387734 | 3300049587 | Bacteria | 542 |
| 227 | Ga0501072_0052970 | 3300049588 | Bacteria | 3195 |
| 228 | Ga0501072_0139359 | 3300049588 | Bacteria | 1934 |
| 229 | Ga0501072_0699787 | 3300049588 | Bacteria | 796 |
| 230 | Ga0501073_0709027 | 3300049589 | Bacteria | 694 |
| 231 | Ga0501074_0102510 | 3300049590 | Bacteria | 2049 |
| 232 | Ga0501074_0986119 | 3300049590 | Bacteria | 592 |
| 233 | Ga0501075_0012553 | 3300049591 | Bacteria | 6025 |
| 234 | Ga0501075_0047640 | 3300049591 | Bacteria | 3221 |
| 235 | Ga0501076_0224002 | 3300049592 | Bacteria | 1537 |
| 236 | Ga0501076_0420678 | 3300049592 | Bacteria | 1099 |
| 237 | Ga0501076_0569280 | 3300049592 | Bacteria | 934 |
| 238 | Ga0501076_0701017 | 3300049592 | Bacteria | 836 |
| 239 | Ga0501077_0502373 | 3300049593 | Bacteria | 777 |
| 240 | Ga0501079_0103208 | 3300049741 | Bacteria | 2212 |
| 241 | Ga0501079_0125850 | 3300049741 | Bacteria | 1994 |
| 242 | Ga0501081_0452036 | 3300049743 | Bacteria | 954 |
| 243 | Ga0501081_1142885 | 3300049743 | Bacteria | 589 |
| 244 | Ga0501035_0068222 | 3300049822 | Bacteria | 3154 |
| 245 | Ga0501044_1194476 | 3300049823 | Bacteria | 629 |
| 246 | Ga0501045_0089830 | 3300049824 | Bacteria | 2269 |
| 247 | Ga0501045_0270075 | 3300049824 | Bacteria | 1266 |
| 248 | Ga0501045_0313225 | 3300049824 | Bacteria | 1168 |
| 249 | Ga0501045_0756816 | 3300049824 | Bacteria | 716 |
| 250 | nmdc:mga03683_10386_c1 | 3300050489 | Bacteria | 3338 |
| 251 | nmdc:mga03n38_620159_c1 | 3300050490 | Bacteria | 618 |
| 252 | nmdc:mga03n38_758639_c1 | 3300050490 | Bacteria | 562 |
| 253 | nmdc:mga03n38_82849_c1 | 3300050490 | Bacteria | 1511 |
| 254 | nmdc:mga00v17_254044_c1 | 3300050491 | Bacteria | 1140 |
| 255 | nmdc:mga00v17_3348_c1 | 3300050491 | Bacteria | 8274 |
| 256 | nmdc:mga00v17_395158_c1 | 3300050491 | Bacteria | 899 |
| 257 | nmdc:mga00v17_423076_c1 | 3300050491 | Bacteria | 865 |
| 258 | nmdc:mga00v17_543898_c1 | 3300050491 | Bacteria | 751 |
| 259 | nmdc:mga00v17_7547_c1 | 3300050491 | Bacteria | 5807 |
| 260 | nmdc:mga0yw44_20712_c1 | 3300050492 | Bacteria | 3655 |
| 261 | nmdc:mga0yw44_2805_c1 | 3300050492 | Bacteria | 7550 |
| 262 | nmdc:mga0yw44_380338_c1 | 3300050492 | Bacteria | 953 |
| 263 | nmdc:mga0yw44_685583_c1 | 3300050492 | Bacteria | 696 |
| 264 | nmdc:mga0yw44_737778_c1 | 3300050492 | Bacteria | 669 |
| 265 | nmdc:mga0yw44_812081_c1 | 3300050492 | Bacteria | 635 |
| 266 | nmdc:mga0k408_354554_c1 | 3300050493 | Bacteria | 874 |
| 267 | nmdc:mga06z11_216883_c1 | 3300050494 | Bacteria | 1117 |
| 268 | nmdc:mga06z11_565696_c1 | 3300050494 | Bacteria | 691 |
| 269 | nmdc:mga04h51_477409_c1 | 3300050495 | Bacteria | 530 |
| 270 | nmdc:mga07m45_125434_c1 | 3300050496 | Bacteria | 1484 |
| 271 | nmdc:mga07m45_82376_c1 | 3300050496 | Bacteria | 1837 |
| 272 | nmdc:mga06r32_1314359_c1 | 3300050510 | Bacteria | 667 |
| 273 | nmdc:mga08y16_137750_c1 | 3300050511 | Bacteria | 2537 |
| 274 | nmdc:mga0n895_1606672_c1 | 3300050512 | Bacteria | 614 |
| 275 | nmdc:mga0a205_1499208_c1 | 3300050515 | Bacteria | 522 |
| 276 | Ga0495601_0388784 | 3300053077 | Bacteria | 905 |
| 277 | Ga0500568_0223681 | 3300053139 | Bacteria | 687 |
| 278 | Ga0501084_0393503 | 3300054114 | Bacteria | 1171 |
| 279 | Ga0501084_0422376 | 3300054114 | Bacteria | 1127 |
| 280 | Ga0501084_0789410 | 3300054114 | Bacteria | 800 |
| 281 | Ga0501084_0991837 | 3300054114 | Bacteria | 706 |
| 282 | Ga0587091_177580 | 3300059511 | Bacteria | 558 |
| 283 | Ga0587094_064250 | 3300059513 | Bacteria | 648 |
| 284 | Ga0587128_095253 | 3300059630 | Bacteria | 616 |
| 285 | Ga0530510_0175478 | 3300061734 | Bacteria | 1588 |
| 286 | Ga0530510_0323592 | 3300061734 | Bacteria | 1156 |
| 287 | Ga0530510_0421949 | 3300061734 | Bacteria | 1007 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_101643452 | Ga0207675_1016434522 | 59 |
| 2 | 3300006038 | Ga0075365_10390717 | Ga0075365_103907172 | 66 |
| 3 | 3300050492 | nmdc:mga0yw44_737778_c1 | nmdc:mga0yw44_737778_c1_308_550 | 66 |
| 4 | 3300005338 | Ga0068868_100844995 | Ga0068868_1008449952 | 72 |
| 5 | 3300005718 | Ga0068866_10713456 | Ga0068866_107134562 | 72 |
| 6 | 3300006038 | Ga0075365_10440848 | Ga0075365_104408482 | 72 |
| 7 | 3300006051 | Ga0075364_10252896 | Ga0075364_102528961 | 72 |
| 8 | 3300006177 | Ga0075362_10031850 | Ga0075362_100318503 | 72 |
| 9 | 3300006353 | Ga0075370_10080829 | Ga0075370_100808293 | 72 |
| 10 | 3300006844 | Ga0075428_101096833 | Ga0075428_1010968332 | 72 |
| 11 | 3300007076 | Ga0075435_101117731 | Ga0075435_1011177312 | 72 |
| 12 | 3300009094 | Ga0111539_10151991 | Ga0111539_101519913 | 72 |
| 13 | 3300009098 | Ga0105245_11118746 | Ga0105245_111187463 | 72 |
| 14 | 3300009147 | Ga0114129_12021783 | Ga0114129_120217831 | 72 |
| 15 | 3300014326 | Ga0157380_10432996 | Ga0157380_104329962 | 72 |
| 16 | 3300014326 | Ga0157380_11422214 | Ga0157380_114222142 | 72 |
| 17 | 3300025908 | Ga0207643_10343742 | Ga0207643_103437422 | 72 |
| 18 | 3300026116 | Ga0207674_11580484 | Ga0207674_115804842 | 72 |
| 19 | 3300031727 | Ga0316576_10003737 | Ga0316576_100037377 | 72 |
| 20 | 3300031727 | Ga0316576_10496413 | Ga0316576_104964132 | 72 |
| 21 | 3300031728 | Ga0316578_10076427 | Ga0316578_100764272 | 72 |
| 22 | 3300035114 | Ga0373939_0300748 | Ga0373939_0300748_225_443 | 72 |
| 23 | 3300035398 | Ga0316574_0196329 | Ga0316574_0196329_90_308 | 72 |
| 24 | 3300035398 | Ga0316574_0341400 | Ga0316574_0341400_631_849 | 72 |
| 25 | 3300036647 | Ga0316582_0139655 | Ga0316582_0139655_844_1062 | 72 |
| 26 | 3300036712 | Ga0316584_0295003 | Ga0316584_0295003_788_1006 | 72 |
| 27 | 3300041459 | Ga0451800_0559365 | Ga0451800_0559365_108_326 | 72 |
| 28 | 3300041507 | Ga0451851_0119914 | Ga0451851_0119914_64_282 | 72 |
| 29 | 3300041509 | Ga0451843_1498660 | Ga0451843_1498660_279_497 | 72 |
| 30 | 3300041511 | Ga0451855_0667362 | Ga0451855_0667362_47_265 | 72 |
| 31 | 3300046461 | Ga0495641_0379438 | Ga0495641_0379438_38_256 | 72 |
| 32 | 3300046517 | Ga0495630_0685871 | Ga0495630_0685871_408_626 | 72 |
| 33 | 3300046533 | Ga0495640_0665458 | Ga0495640_0665458_250_468 | 72 |
| 34 | 3300047321 | Ga0495676_0733796 | Ga0495676_0733796_168_386 | 72 |
| 35 | 3300049568 | Ga0501031_0022110 | Ga0501031_0022110_1066_1284 | 72 |
| 36 | 3300049568 | Ga0501031_0464827 | Ga0501031_0464827_434_652 | 72 |
| 37 | 3300049572 | Ga0501036_0030557 | Ga0501036_0030557_3983_4201 | 72 |
| 38 | 3300049572 | Ga0501036_0409866 | Ga0501036_0409866_598_816 | 72 |
| 39 | 3300049573 | Ga0501037_0291804 | Ga0501037_0291804_710_928 | 72 |
| 40 | 3300049574 | Ga0501038_0365051 | Ga0501038_0365051_247_465 | 72 |
| 41 | 3300049575 | Ga0501039_0167069 | Ga0501039_0167069_859_1077 | 72 |
| 42 | 3300049575 | Ga0501039_1408799 | Ga0501039_1408799_104_322 | 72 |
| 43 | 3300049577 | Ga0501041_0323750 | Ga0501041_0323750_586_804 | 72 |
| 44 | 3300049578 | Ga0501042_0042677 | Ga0501042_0042677_1355_1573 | 72 |
| 45 | 3300049578 | Ga0501042_0378933 | Ga0501042_0378933_385_603 | 72 |
| 46 | 3300049582 | Ga0501048_0050289 | Ga0501048_0050289_2192_2410 | 72 |
| 47 | 3300049582 | Ga0501048_0211727 | Ga0501048_0211727_424_642 | 72 |
| 48 | 3300049584 | Ga0501068_0412820 | Ga0501068_0412820_129_347 | 72 |
| 49 | 3300049585 | Ga0501069_0399102 | Ga0501069_0399102_298_516 | 72 |
| 50 | 3300049587 | Ga0501071_0035128 | Ga0501071_0035128_414_632 | 72 |
| 51 | 3300049587 | Ga0501071_0418411 | Ga0501071_0418411_464_682 | 72 |
| 52 | 3300049587 | Ga0501071_1387734 | Ga0501071_1387734_164_382 | 72 |
| 53 | 3300049588 | Ga0501072_0052970 | Ga0501072_0052970_2893_3111 | 72 |
| 54 | 3300049588 | Ga0501072_0139359 | Ga0501072_0139359_1463_1681 | 72 |
| 55 | 3300049588 | Ga0501072_0699787 | Ga0501072_0699787_67_285 | 72 |
| 56 | 3300049590 | Ga0501074_0102510 | Ga0501074_0102510_1305_1523 | 72 |
| 57 | 3300049591 | Ga0501075_0012553 | Ga0501075_0012553_903_1121 | 72 |
| 58 | 3300049591 | Ga0501075_0047640 | Ga0501075_0047640_336_554 | 72 |
| 59 | 3300049592 | Ga0501076_0224002 | Ga0501076_0224002_677_895 | 72 |
| 60 | 3300049592 | Ga0501076_0420678 | Ga0501076_0420678_327_545 | 72 |
| 61 | 3300049593 | Ga0501077_0502373 | Ga0501077_0502373_359_577 | 72 |
| 62 | 3300049741 | Ga0501079_0103208 | Ga0501079_0103208_463_681 | 72 |
| 63 | 3300049741 | Ga0501079_0125850 | Ga0501079_0125850_1588_1806 | 72 |
| 64 | 3300049743 | Ga0501081_0452036 | Ga0501081_0452036_117_335 | 72 |
| 65 | 3300049822 | Ga0501035_0068222 | Ga0501035_0068222_894_1112 | 72 |
| 66 | 3300049823 | Ga0501044_1194476 | Ga0501044_1194476_348_566 | 72 |
| 67 | 3300049824 | Ga0501045_0089830 | Ga0501045_0089830_1643_1861 | 72 |
| 68 | 3300049824 | Ga0501045_0270075 | Ga0501045_0270075_259_477 | 72 |
| 69 | 3300050489 | nmdc:mga03683_10386_c1 | nmdc:mga03683_10386_c1_1984_2202 | 72 |
| 70 | 3300050490 | nmdc:mga03n38_758639_c1 | nmdc:mga03n38_758639_c1_101_319 | 72 |
| 71 | 3300050491 | nmdc:mga00v17_254044_c1 | nmdc:mga00v17_254044_c1_203_421 | 72 |
| 72 | 3300050491 | nmdc:mga00v17_423076_c1 | nmdc:mga00v17_423076_c1_464_682 | 72 |
| 73 | 3300050491 | nmdc:mga00v17_7547_c1 | nmdc:mga00v17_7547_c1_2982_3200 | 72 |
| 74 | 3300050492 | nmdc:mga0yw44_20712_c1 | nmdc:mga0yw44_20712_c1_3287_3505 | 72 |
| 75 | 3300050492 | nmdc:mga0yw44_685583_c1 | nmdc:mga0yw44_685583_c1_49_267 | 72 |
| 76 | 3300050493 | nmdc:mga0k408_354554_c1 | nmdc:mga0k408_354554_c1_525_743 | 72 |
| 77 | 3300050496 | nmdc:mga07m45_125434_c1 | nmdc:mga07m45_125434_c1_131_349 | 72 |
| 78 | 3300050510 | nmdc:mga06r32_1314359_c1 | nmdc:mga06r32_1314359_c1_149_367 | 72 |
| 79 | 3300050511 | nmdc:mga08y16_137750_c1 | nmdc:mga08y16_137750_c1_1248_1466 | 72 |
| 80 | 3300050512 | nmdc:mga0n895_1606672_c1 | nmdc:mga0n895_1606672_c1_137_355 | 72 |
| 81 | 3300050515 | nmdc:mga0a205_1499208_c1 | nmdc:mga0a205_1499208_c1_46_264 | 72 |
| 82 | 3300053139 | Ga0500568_0223681 | Ga0500568_0223681_93_311 | 72 |
| 83 | 3300054114 | Ga0501084_0393503 | Ga0501084_0393503_166_384 | 72 |
| 84 | 3300054114 | Ga0501084_0422376 | Ga0501084_0422376_369_587 | 72 |
| 85 | 3300059513 | Ga0587094_064250 | Ga0587094_064250_61_279 | 72 |
| 86 | 3300061734 | Ga0530510_0175478 | Ga0530510_0175478_1187_1405 | 72 |
| 87 | 3300005330 | Ga0070690_101589727 | Ga0070690_1015897271 | 73 |
| 88 | 3300005331 | Ga0070670_101585057 | Ga0070670_1015850571 | 73 |
| 89 | 3300005340 | Ga0070689_100177292 | Ga0070689_1001772922 | 73 |
| 90 | 3300005343 | Ga0070687_100749350 | Ga0070687_1007493501 | 73 |
| 91 | 3300005344 | Ga0070661_100618683 | Ga0070661_1006186832 | 73 |
| 92 | 3300005347 | Ga0070668_100099544 | Ga0070668_1000995443 | 73 |
| 93 | 3300005354 | Ga0070675_100088735 | Ga0070675_1000887353 | 73 |
| 94 | 3300005355 | Ga0070671_100012324 | Ga0070671_1000123247 | 73 |
| 95 | 3300005355 | Ga0070671_100924476 | Ga0070671_1009244762 | 73 |
| 96 | 3300005356 | Ga0070674_100082498 | Ga0070674_1000824984 | 73 |
| 97 | 3300005367 | Ga0070667_100684599 | Ga0070667_1006845991 | 73 |
| 98 | 3300005435 | Ga0070714_102419767 | Ga0070714_1024197671 | 73 |
| 99 | 3300005436 | Ga0070713_100914900 | Ga0070713_1009149002 | 73 |
| 100 | 3300005439 | Ga0070711_101164151 | Ga0070711_1011641512 | 73 |
| 101 | 3300005459 | Ga0068867_100034919 | Ga0068867_1000349194 | 73 |
| 102 | 3300005466 | Ga0070685_10396686 | Ga0070685_103966862 | 73 |
| 103 | 3300005466 | Ga0070685_10676962 | Ga0070685_106769623 | 73 |
| 104 | 3300005535 | Ga0070684_100441641 | Ga0070684_1004416412 | 73 |
| 105 | 3300005535 | Ga0070684_101461613 | Ga0070684_1014616132 | 73 |
| 106 | 3300005543 | Ga0070672_100302026 | Ga0070672_1003020263 | 73 |
| 107 | 3300005544 | Ga0070686_100099968 | Ga0070686_1000999682 | 73 |
| 108 | 3300005544 | Ga0070686_101307399 | Ga0070686_1013073992 | 73 |
| 109 | 3300005564 | Ga0070664_100413989 | Ga0070664_1004139892 | 73 |
| 110 | 3300005718 | Ga0068866_10177726 | Ga0068866_101777262 | 73 |
| 111 | 3300005719 | Ga0068861_100066350 | Ga0068861_1000663503 | 73 |
| 112 | 3300005719 | Ga0068861_100629224 | Ga0068861_1006292243 | 73 |
| 113 | 3300005841 | Ga0068863_100534138 | Ga0068863_1005341382 | 73 |
| 114 | 3300005843 | Ga0068860_100314109 | Ga0068860_1003141091 | 73 |
| 115 | 3300005843 | Ga0068860_101317468 | Ga0068860_1013174682 | 73 |
| 116 | 3300005844 | Ga0068862_100051179 | Ga0068862_1000511795 | 73 |
| 117 | 3300005937 | Ga0081455_10069478 | Ga0081455_100694784 | 73 |
| 118 | 3300006038 | Ga0075365_10009780 | Ga0075365_100097807 | 73 |
| 119 | 3300006038 | Ga0075365_10223080 | Ga0075365_102230802 | 73 |
| 120 | 3300006038 | Ga0075365_10986447 | Ga0075365_109864472 | 73 |
| 121 | 3300006042 | Ga0075368_10111056 | Ga0075368_101110562 | 73 |
| 122 | 3300006048 | Ga0075363_100026088 | Ga0075363_1000260882 | 73 |
| 123 | 3300006048 | Ga0075363_100064720 | Ga0075363_1000647203 | 73 |
| 124 | 3300006048 | Ga0075363_100157291 | Ga0075363_1001572912 | 73 |
| 125 | 3300006051 | Ga0075364_10000990 | Ga0075364_1000099010 | 73 |
| 126 | 3300006051 | Ga0075364_10111348 | Ga0075364_101113483 | 73 |
| 127 | 3300006051 | Ga0075364_10374608 | Ga0075364_103746083 | 73 |
| 128 | 3300006051 | Ga0075364_10525867 | Ga0075364_105258672 | 73 |
| 129 | 3300006051 | Ga0075364_10534139 | Ga0075364_105341392 | 73 |
| 130 | 3300006178 | Ga0075367_10039556 | Ga0075367_100395563 | 73 |
| 131 | 3300006178 | Ga0075367_10212886 | Ga0075367_102128862 | 73 |
| 132 | 3300006178 | Ga0075367_10607604 | Ga0075367_106076041 | 73 |
| 133 | 3300006186 | Ga0075369_10330517 | Ga0075369_103305172 | 73 |
| 134 | 3300006195 | Ga0075366_10801668 | Ga0075366_108016681 | 73 |
| 135 | 3300006237 | Ga0097621_100244176 | Ga0097621_1002441763 | 73 |
| 136 | 3300006353 | Ga0075370_10374155 | Ga0075370_103741552 | 73 |
| 137 | 3300006353 | Ga0075370_10412850 | Ga0075370_104128502 | 73 |
| 138 | 3300006844 | Ga0075428_101975595 | Ga0075428_1019755952 | 73 |
| 139 | 3300006880 | Ga0075429_101690029 | Ga0075429_1016900292 | 73 |
| 140 | 3300006881 | Ga0068865_101570567 | Ga0068865_1015705671 | 73 |
| 141 | 3300009092 | Ga0105250_10536985 | Ga0105250_105369852 | 73 |
| 142 | 3300009094 | Ga0111539_12664861 | Ga0111539_126648612 | 73 |
| 143 | 3300009094 | Ga0111539_12817823 | Ga0111539_128178232 | 73 |
| 144 | 3300009098 | Ga0105245_10080839 | Ga0105245_100808394 | 73 |
| 145 | 3300009101 | Ga0105247_10786747 | Ga0105247_107867472 | 73 |
| 146 | 3300009101 | Ga0105247_10791771 | Ga0105247_107917712 | 73 |
| 147 | 3300009148 | Ga0105243_10007049 | Ga0105243_100070494 | 73 |
| 148 | 3300009174 | Ga0105241_10858516 | Ga0105241_108585162 | 73 |
| 149 | 3300009176 | Ga0105242_10044681 | Ga0105242_100446815 | 73 |
| 150 | 3300009177 | Ga0105248_10480361 | Ga0105248_104803614 | 73 |
| 151 | 3300009553 | Ga0105249_12005005 | Ga0105249_120050052 | 73 |
| 152 | 3300009553 | Ga0105249_12494628 | Ga0105249_124946282 | 73 |
| 153 | 3300010375 | Ga0105239_12426461 | Ga0105239_124264612 | 73 |
| 154 | 3300011119 | Ga0105246_10645920 | Ga0105246_106459201 | 73 |
| 155 | 3300011119 | Ga0105246_11725299 | Ga0105246_117252992 | 73 |
| 156 | 3300013297 | Ga0157378_10017880 | Ga0157378_100178806 | 73 |
| 157 | 3300013306 | Ga0163162_12238712 | Ga0163162_122387122 | 73 |
| 158 | 3300013306 | Ga0163162_12495422 | Ga0163162_124954222 | 73 |
| 159 | 3300013308 | Ga0157375_10062379 | Ga0157375_100623793 | 73 |
| 160 | 3300013308 | Ga0157375_10335750 | Ga0157375_103357502 | 73 |
| 161 | 3300013308 | Ga0157375_12306283 | Ga0157375_123062832 | 73 |
| 162 | 3300014325 | Ga0163163_10581262 | Ga0163163_105812621 | 73 |
| 163 | 3300014326 | Ga0157380_10948293 | Ga0157380_109482932 | 73 |
| 164 | 3300014745 | Ga0157377_11302337 | Ga0157377_113023371 | 73 |
| 165 | 3300014968 | Ga0157379_10060890 | Ga0157379_100608903 | 73 |
| 166 | 3300014968 | Ga0157379_10602627 | Ga0157379_106026272 | 73 |
| 167 | 3300020078 | Ga0206352_11121634 | Ga0206352_111216342 | 73 |
| 168 | 3300022467 | Ga0224712_10436504 | Ga0224712_104365041 | 73 |
| 169 | 3300025899 | Ga0207642_10008068 | Ga0207642_100080684 | 73 |
| 170 | 3300025900 | Ga0207710_10413634 | Ga0207710_104136342 | 73 |
| 171 | 3300025916 | Ga0207663_11423987 | Ga0207663_114239872 | 73 |
| 172 | 3300025923 | Ga0207681_11392935 | Ga0207681_113929352 | 73 |
| 173 | 3300025926 | Ga0207659_10336696 | Ga0207659_103366963 | 73 |
| 174 | 3300025927 | Ga0207687_10077209 | Ga0207687_100772093 | 73 |
| 175 | 3300025931 | Ga0207644_10927130 | Ga0207644_109271302 | 73 |
| 176 | 3300025935 | Ga0207709_10052776 | Ga0207709_100527765 | 73 |
| 177 | 3300025936 | Ga0207670_10912260 | Ga0207670_109122601 | 73 |
| 178 | 3300025940 | Ga0207691_10256467 | Ga0207691_102564673 | 73 |
| 179 | 3300025940 | Ga0207691_10562524 | Ga0207691_105625243 | 73 |
| 180 | 3300025941 | Ga0207711_11021662 | Ga0207711_110216622 | 73 |
| 181 | 3300025944 | Ga0207661_10186300 | Ga0207661_101863003 | 73 |
| 182 | 3300025945 | Ga0207679_10622058 | Ga0207679_106220582 | 73 |
| 183 | 3300025961 | Ga0207712_10100735 | Ga0207712_101007352 | 73 |
| 184 | 3300025972 | Ga0207668_10089214 | Ga0207668_100892143 | 73 |
| 185 | 3300026023 | Ga0207677_12129438 | Ga0207677_121294382 | 73 |
| 186 | 3300026041 | Ga0207639_10888095 | Ga0207639_108880953 | 73 |
| 187 | 3300026088 | Ga0207641_10803081 | Ga0207641_108030812 | 73 |
| 188 | 3300026089 | Ga0207648_10004938 | Ga0207648_100049386 | 73 |
| 189 | 3300026118 | Ga0207675_100007094 | Ga0207675_10000709410 | 73 |
| 190 | 3300026118 | Ga0207675_100071551 | Ga0207675_1000715514 | 73 |
| 191 | 3300026118 | Ga0207675_100791480 | Ga0207675_1007914802 | 73 |
| 192 | 3300026142 | Ga0207698_12073315 | Ga0207698_120733152 | 73 |
| 193 | 3300026142 | Ga0207698_12464751 | Ga0207698_124647512 | 73 |
| 194 | 3300028380 | Ga0268265_10159031 | Ga0268265_101590314 | 73 |
| 195 | 3300028381 | Ga0268264_10154648 | Ga0268264_101546482 | 73 |
| 196 | 3300028381 | Ga0268264_11272748 | Ga0268264_112727482 | 73 |
| 197 | 3300028381 | Ga0268264_11585380 | Ga0268264_115853801 | 73 |
| 198 | 3300031727 | Ga0316576_10475133 | Ga0316576_104751333 | 73 |
| 199 | 3300032126 | Ga0307415_101636562 | Ga0307415_1016365622 | 73 |
| 200 | 3300035170 | Ga0373943_0886535 | Ga0373943_0886535_104_325 | 73 |
| 201 | 3300035398 | Ga0316574_0015400 | Ga0316574_0015400_3935_4156 | 73 |
| 202 | 3300035398 | Ga0316574_0049111 | Ga0316574_0049111_196_417 | 73 |
| 203 | 3300035398 | Ga0316574_0110985 | Ga0316574_0110985_1370_1591 | 73 |
| 204 | 3300035398 | Ga0316574_0674244 | Ga0316574_0674244_74_295 | 73 |
| 205 | 3300035398 | Ga0316574_0754259 | Ga0316574_0754259_133_357 | 73 |
| 206 | 3300035691 | Ga0373931_0504850 | Ga0373931_0504850_442_663 | 73 |
| 207 | 3300036401 | Ga0373937_2012863 | Ga0373937_2012863_118_339 | 73 |
| 208 | 3300036647 | Ga0316582_0489628 | Ga0316582_0489628_552_773 | 73 |
| 209 | 3300041413 | Ga0439465_0059136 | Ga0439465_0059136_1008_1229 | 73 |
| 210 | 3300041443 | Ga0451789_1238268 | Ga0451789_1238268_100_321 | 73 |
| 211 | 3300041451 | Ga0451791_0790917 | Ga0451791_0790917_55_282 | 73 |
| 212 | 3300041452 | Ga0451793_0230090 | Ga0451793_0230090_39_266 | 73 |
| 213 | 3300041452 | Ga0451793_0701768 | Ga0451793_0701768_83_304 | 73 |
| 214 | 3300041463 | Ga0451804_0463578 | Ga0451804_0463578_142_363 | 73 |
| 215 | 3300041509 | Ga0451843_1700329 | Ga0451843_1700329_43_276 | 73 |
| 216 | 3300041511 | Ga0451855_1609421 | Ga0451855_1609421_227_457 | 73 |
| 217 | 3300041512 | Ga0451853_0769242 | Ga0451853_0769242_36_257 | 73 |
| 218 | 3300042125 | Ga0450923_015160 | Ga0450923_015160_248_469 | 73 |
| 219 | 3300042156 | Ga0439446_0093260 | Ga0439446_0093260_508_729 | 73 |
| 220 | 3300042435 | Ga0439434_0250020 | Ga0439434_0250020_244_465 | 73 |
| 221 | 3300042531 | Ga0450918_044918 | Ga0450918_044918_440_661 | 73 |
| 222 | 3300042876 | Ga0451577_0046641 | Ga0451577_0046641_789_1022 | 73 |
| 223 | 3300044712 | Ga0453684_0002246 | Ga0453684_0002246_47604_47837 | 73 |
| 224 | 3300045051 | Ga0451576_1551728 | Ga0451576_1551728_185_418 | 73 |
| 225 | 3300046455 | Ga0495603_0056906 | Ga0495603_0056906_761_982 | 73 |
| 226 | 3300046477 | Ga0495664_0883743 | Ga0495664_0883743_74_295 | 73 |
| 227 | 3300046517 | Ga0495630_0570492 | Ga0495630_0570492_556_777 | 73 |
| 228 | 3300046536 | Ga0495587_0174312 | Ga0495587_0174312_890_1111 | 73 |
| 229 | 3300046663 | Ga0495635_0480867 | Ga0495635_0480867_149_370 | 73 |
| 230 | 3300046690 | Ga0495624_0904057 | Ga0495624_0904057_134_355 | 73 |
| 231 | 3300048088 | Ga0495602_0800634 | Ga0495602_0800634_55_276 | 73 |
| 232 | 3300048904 | Ga0496101_0069295 | Ga0496101_0069295_1874_2101 | 73 |
| 233 | 3300048904 | Ga0496101_0275207 | Ga0496101_0275207_467_691 | 73 |
| 234 | 3300048904 | Ga0496101_0342692 | Ga0496101_0342692_83_304 | 73 |
| 235 | 3300048905 | Ga0496102_0196158 | Ga0496102_0196158_1400_1621 | 73 |
| 236 | 3300048905 | Ga0496102_0311044 | Ga0496102_0311044_624_851 | 73 |
| 237 | 3300048906 | Ga0496103_0123541 | Ga0496103_0123541_763_990 | 73 |
| 238 | 3300048906 | Ga0496103_1041340 | Ga0496103_1041340_180_401 | 73 |
| 239 | 3300048907 | Ga0496104_0111951 | Ga0496104_0111951_1602_1829 | 73 |
| 240 | 3300048907 | Ga0496104_1660520 | Ga0496104_1660520_85_324 | 73 |
| 241 | 3300048908 | Ga0496105_0061487 | Ga0496105_0061487_278_505 | 73 |
| 242 | 3300048911 | Ga0496108_0217399 | Ga0496108_0217399_965_1186 | 73 |
| 243 | 3300048911 | Ga0496108_1578349 | Ga0496108_1578349_211_435 | 73 |
| 244 | 3300048912 | Ga0496109_0499878 | Ga0496109_0499878_915_1136 | 73 |
| 245 | 3300048912 | Ga0496109_1398072 | Ga0496109_1398072_66_287 | 73 |
| 246 | 3300048913 | Ga0496110_0093609 | Ga0496110_0093609_2036_2263 | 73 |
| 247 | 3300048913 | Ga0496110_0133405 | Ga0496110_0133405_1152_1373 | 73 |
| 248 | 3300048914 | Ga0496111_0131064 | Ga0496111_0131064_1348_1575 | 73 |
| 249 | 3300048914 | Ga0496111_0449419 | Ga0496111_0449419_167_388 | 73 |
| 250 | 3300048917 | Ga0496114_0001390 | Ga0496114_0001390_930_1157 | 73 |
| 251 | 3300048917 | Ga0496114_0211585 | Ga0496114_0211585_1199_1423 | 73 |
| 252 | 3300048917 | Ga0496114_0328821 | Ga0496114_0328821_781_1002 | 73 |
| 253 | 3300049568 | Ga0501031_0252476 | Ga0501031_0252476_28_249 | 73 |
| 254 | 3300049569 | Ga0501032_0516910 | Ga0501032_0516910_500_721 | 73 |
| 255 | 3300049570 | Ga0501033_0714376 | Ga0501033_0714376_186_407 | 73 |
| 256 | 3300049572 | Ga0501036_0390504 | Ga0501036_0390504_771_992 | 73 |
| 257 | 3300049575 | Ga0501039_1212444 | Ga0501039_1212444_189_410 | 73 |
| 258 | 3300049578 | Ga0501042_0941718 | Ga0501042_0941718_104_325 | 73 |
| 259 | 3300049582 | Ga0501048_0660421 | Ga0501048_0660421_55_288 | 73 |
| 260 | 3300049583 | Ga0501067_0263816 | Ga0501067_0263816_495_734 | 73 |
| 261 | 3300049587 | Ga0501071_0089909 | Ga0501071_0089909_373_594 | 73 |
| 262 | 3300049589 | Ga0501073_0709027 | Ga0501073_0709027_336_557 | 73 |
| 263 | 3300049590 | Ga0501074_0986119 | Ga0501074_0986119_344_565 | 73 |
| 264 | 3300049592 | Ga0501076_0569280 | Ga0501076_0569280_143_364 | 73 |
| 265 | 3300049592 | Ga0501076_0701017 | Ga0501076_0701017_576_797 | 73 |
| 266 | 3300049743 | Ga0501081_1142885 | Ga0501081_1142885_235_456 | 73 |
| 267 | 3300049824 | Ga0501045_0313225 | Ga0501045_0313225_126_347 | 73 |
| 268 | 3300049824 | Ga0501045_0756816 | Ga0501045_0756816_30_251 | 73 |
| 269 | 3300050490 | nmdc:mga03n38_620159_c1 | nmdc:mga03n38_620159_c1_23_250 | 73 |
| 270 | 3300050490 | nmdc:mga03n38_82849_c1 | nmdc:mga03n38_82849_c1_369_614 | 73 |
| 271 | 3300050491 | nmdc:mga00v17_3348_c1 | nmdc:mga00v17_3348_c1_6996_7241 | 73 |
| 272 | 3300050491 | nmdc:mga00v17_395158_c1 | nmdc:mga00v17_395158_c1_537_767 | 73 |
| 273 | 3300050491 | nmdc:mga00v17_543898_c1 | nmdc:mga00v17_543898_c1_336_557 | 73 |
| 274 | 3300050492 | nmdc:mga0yw44_2805_c1 | nmdc:mga0yw44_2805_c1_5173_5418 | 73 |
| 275 | 3300050492 | nmdc:mga0yw44_380338_c1 | nmdc:mga0yw44_380338_c1_692_922 | 73 |
| 276 | 3300050492 | nmdc:mga0yw44_812081_c1 | nmdc:mga0yw44_812081_c1_401_622 | 73 |
| 277 | 3300050494 | nmdc:mga06z11_216883_c1 | nmdc:mga06z11_216883_c1_809_1036 | 73 |
| 278 | 3300050494 | nmdc:mga06z11_565696_c1 | nmdc:mga06z11_565696_c1_426_656 | 73 |
| 279 | 3300050495 | nmdc:mga04h51_477409_c1 | nmdc:mga04h51_477409_c1_92_337 | 73 |
| 280 | 3300050496 | nmdc:mga07m45_82376_c1 | nmdc:mga07m45_82376_c1_458_688 | 73 |
| 281 | 3300053077 | Ga0495601_0388784 | Ga0495601_0388784_469_690 | 73 |
| 282 | 3300054114 | Ga0501084_0789410 | Ga0501084_0789410_554_775 | 73 |
| 283 | 3300054114 | Ga0501084_0991837 | Ga0501084_0991837_329_550 | 73 |
| 284 | 3300059511 | Ga0587091_177580 | Ga0587091_177580_231_452 | 73 |
| 285 | 3300059630 | Ga0587128_095253 | Ga0587128_095253_350_574 | 73 |
| 286 | 3300061734 | Ga0530510_0323592 | Ga0530510_0323592_613_834 | 73 |
| 287 | 3300061734 | Ga0530510_0421949 | Ga0530510_0421949_495_716 | 73 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar