F387987

General Info

Members Datasets Scaffolds Average Seq Length
287 177 287 74

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11118746|Ga0105245_111187463
Length 73
Sequence VHDIVDLERRGVPSVFVASTEFVEAAAAQSAALGVEPARVFVPHPIQDRTDDEMRALADAAFDEIVAAVTTAG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
102 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
103 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
165 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 1.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 0
Rhizoplane 9.41
Rhizosphere 72.13
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_101589727 3300005330 Unclassified 530
2 Ga0070670_101585057 3300005331 Bacteria 602
3 Ga0068868_100844995 3300005338 Bacteria 829
4 Ga0070689_100177292 3300005340 Bacteria 1729
5 Ga0070687_100749350 3300005343 Unclassified 687
6 Ga0070661_100618683 3300005344 Bacteria 877
7 Ga0070668_100099544 3300005347 Bacteria 2302
8 Ga0070675_100088735 3300005354 Bacteria 2588
9 Ga0070671_100012324 3300005355 Bacteria 6884
10 Ga0070671_100924476 3300005355 Bacteria 763
11 Ga0070674_100082498 3300005356 Bacteria 2300
12 Ga0070667_100684599 3300005367 Bacteria 948
13 Ga0070714_102419767 3300005435 Bacteria 510
14 Ga0070713_100914900 3300005436 Bacteria 844
15 Ga0070711_101164151 3300005439 Bacteria 666
16 Ga0068867_100034919 3300005459 Bacteria 3646
17 Ga0070685_10396686 3300005466 Bacteria 955
18 Ga0070685_10676962 3300005466 Bacteria 750
19 Ga0070684_100441641 3300005535 Bacteria 1202
20 Ga0070684_101461613 3300005535 Bacteria 644
21 Ga0070672_100302026 3300005543 Bacteria 1357
22 Ga0070686_100099968 3300005544 Bacteria 1957
23 Ga0070686_101307399 3300005544 Bacteria 606
24 Ga0070664_100413989 3300005564 Bacteria 1234
25 Ga0068866_10177726 3300005718 Bacteria 1255
26 Ga0068866_10713456 3300005718 Bacteria 689
27 Ga0068861_100066350 3300005719 Bacteria 2782
28 Ga0068861_100629224 3300005719 Bacteria 989
29 Ga0068863_100534138 3300005841 Bacteria 1157
30 Ga0068860_100314109 3300005843 Bacteria 1537
31 Ga0068860_101317468 3300005843 Bacteria 743
32 Ga0068862_100051179 3300005844 Bacteria 3532
33 Ga0081455_10069478 3300005937 Bacteria 2929
34 Ga0075365_10009780 3300006038 Bacteria 5541
35 Ga0075365_10223080 3300006038 Bacteria 1322
36 Ga0075365_10390717 3300006038 Bacteria 981
37 Ga0075365_10440848 3300006038 Bacteria 920
38 Ga0075365_10986447 3300006038 Bacteria 594
39 Ga0075368_10111056 3300006042 Bacteria 1130
40 Ga0075363_100026088 3300006048 Bacteria 2987
41 Ga0075363_100064720 3300006048 Bacteria 1976
42 Ga0075363_100157291 3300006048 Bacteria 1285
43 Ga0075364_10000990 3300006051 Bacteria 15049
44 Ga0075364_10111348 3300006051 Bacteria 1827
45 Ga0075364_10252896 3300006051 Bacteria 1197
46 Ga0075364_10374608 3300006051 Bacteria 971
47 Ga0075364_10525867 3300006051 Bacteria 809
48 Ga0075364_10534139 3300006051 Bacteria 802
49 Ga0075362_10031850 3300006177 Bacteria 2285
50 Ga0075367_10039556 3300006178 Bacteria 2750
51 Ga0075367_10212886 3300006178 Bacteria 1208
52 Ga0075367_10607604 3300006178 Bacteria 695
53 Ga0075369_10330517 3300006186 Bacteria 714
54 Ga0075366_10801668 3300006195 Bacteria 586
55 Ga0097621_100244176 3300006237 Bacteria 1571
56 Ga0075370_10080829 3300006353 Bacteria 1868
57 Ga0075370_10374155 3300006353 Bacteria 853
58 Ga0075370_10412850 3300006353 Bacteria 811
59 Ga0075428_101096833 3300006844 Bacteria 841
60 Ga0075428_101975595 3300006844 Bacteria 605
61 Ga0075429_101690029 3300006880 Bacteria 550
62 Ga0068865_101570567 3300006881 Bacteria 591
63 Ga0075435_101117731 3300007076 Bacteria 689
64 Ga0105250_10536985 3300009092 Bacteria 535
65 Ga0111539_10151991 3300009094 Bacteria 2710
66 Ga0111539_12664861 3300009094 Bacteria 579
67 Ga0111539_12817823 3300009094 Bacteria 563
68 Ga0105245_10080839 3300009098 Bacteria 2969
69 Ga0105245_11118746 3300009098 Unclassified 834
70 Ga0105247_10786747 3300009101 Bacteria 724
71 Ga0105247_10791771 3300009101 Bacteria 722
72 Ga0114129_12021783 3300009147 Bacteria 696
73 Ga0105243_10007049 3300009148 Bacteria 8647
74 Ga0105241_10858516 3300009174 Bacteria 840
75 Ga0105242_10044681 3300009176 Bacteria 3588
76 Ga0105248_10480361 3300009177 Unclassified 1401
77 Ga0105249_12005005 3300009553 Bacteria 651
78 Ga0105249_12494628 3300009553 Unclassified 589
79 Ga0105239_12426461 3300010375 Bacteria 611
80 Ga0105246_10645920 3300011119 Bacteria 920
81 Ga0105246_11725299 3300011119 Bacteria 596
82 Ga0157378_10017880 3300013297 Bacteria 6222
83 Ga0163162_12238712 3300013306 Bacteria 628
84 Ga0163162_12495422 3300013306 Bacteria 594
85 Ga0157375_10062379 3300013308 Bacteria 3704
86 Ga0157375_10335750 3300013308 Bacteria 1676
87 Ga0157375_12306283 3300013308 Bacteria 642
88 Ga0163163_10581262 3300014325 Bacteria 1183
89 Ga0157380_10432996 3300014326 Bacteria 1258
90 Ga0157380_10948293 3300014326 Bacteria 890
91 Ga0157380_11422214 3300014326 Bacteria 744
92 Ga0157377_11302337 3300014745 Bacteria 568
93 Ga0157379_10060890 3300014968 Bacteria 3375
94 Ga0157379_10602627 3300014968 Bacteria 1025
95 Ga0206352_11121634 3300020078 Bacteria 693
96 Ga0224712_10436504 3300022467 Bacteria 627
97 Ga0207642_10008068 3300025899 Bacteria 3592
98 Ga0207710_10413634 3300025900 Bacteria 693
99 Ga0207643_10343742 3300025908 Bacteria 936
100 Ga0207663_11423987 3300025916 Bacteria 558
101 Ga0207681_11392935 3300025923 Bacteria 589
102 Ga0207659_10336696 3300025926 Bacteria 1249
103 Ga0207687_10077209 3300025927 Bacteria 2395
104 Ga0207644_10927130 3300025931 Bacteria 730
105 Ga0207709_10052776 3300025935 Bacteria 2499
106 Ga0207670_10912260 3300025936 Unclassified 736
107 Ga0207691_10256467 3300025940 Bacteria 1508
108 Ga0207691_10562524 3300025940 Bacteria 966
109 Ga0207711_11021662 3300025941 Unclassified 766
110 Ga0207661_10186300 3300025944 Bacteria 1817
111 Ga0207679_10622058 3300025945 Bacteria 975
112 Ga0207712_10100735 3300025961 Bacteria 2147
113 Ga0207668_10089214 3300025972 Bacteria 2260
114 Ga0207677_12129438 3300026023 Bacteria 522
115 Ga0207639_10888095 3300026041 Bacteria 833
116 Ga0207641_10803081 3300026088 Bacteria 931
117 Ga0207648_10004938 3300026089 Bacteria 13570
118 Ga0207674_11580484 3300026116 Bacteria 624
119 Ga0207675_100007094 3300026118 Bacteria 10589
120 Ga0207675_100071551 3300026118 Bacteria 3243
121 Ga0207675_100791480 3300026118 Bacteria 961
122 Ga0207675_101643452 3300026118 Unclassified 663
123 Ga0207698_12073315 3300026142 Bacteria 582
124 Ga0207698_12464751 3300026142 Bacteria 531
125 Ga0268265_10159031 3300028380 Bacteria 1916
126 Ga0268264_10154648 3300028381 Bacteria 2060
127 Ga0268264_11272748 3300028381 Bacteria 745
128 Ga0268264_11585380 3300028381 Bacteria 665
129 Ga0316576_10003737 3300031727 Bacteria 8983
130 Ga0316576_10475133 3300031727 Bacteria 921
131 Ga0316576_10496413 3300031727 Bacteria 898
132 Ga0316578_10076427 3300031728 Bacteria 1988
133 Ga0307415_101636562 3300032126 Bacteria 619
134 Ga0373939_0300748 3300035114 Bacteria 640
135 Ga0373943_0886535 3300035170 Bacteria 533
136 Ga0316574_0015400 3300035398 Bacteria 4436
137 Ga0316574_0049111 3300035398 Bacteria 2623
138 Ga0316574_0110985 3300035398 Bacteria 1758
139 Ga0316574_0196329 3300035398 Bacteria 1297
140 Ga0316574_0341400 3300035398 Bacteria 949
141 Ga0316574_0674244 3300035398 Bacteria 635
142 Ga0316574_0754259 3300035398 Bacteria 594
143 Ga0373931_0504850 3300035691 Bacteria 781
144 Ga0373937_2012863 3300036401 Bacteria 524
145 Ga0316582_0139655 3300036647 Bacteria 1633
146 Ga0316582_0489628 3300036647 Bacteria 848
147 Ga0316584_0295003 3300036712 Bacteria 1175
148 Ga0439465_0059136 3300041413 Bacteria 1268
149 Ga0451789_1238268 3300041443 Bacteria 523
150 Ga0451791_0790917 3300041451 Bacteria 538
151 Ga0451793_0230090 3300041452 Bacteria 516
152 Ga0451793_0701768 3300041452 Unclassified 572
153 Ga0451800_0559365 3300041459 Bacteria 572
154 Ga0451804_0463578 3300041463 Bacteria 532
155 Ga0451851_0119914 3300041507 Bacteria 501
156 Ga0451843_1498660 3300041509 Bacteria 629
157 Ga0451843_1700329 3300041509 Bacteria 545
158 Ga0451855_0667362 3300041511 Bacteria 566
159 Ga0451855_1609421 3300041511 Bacteria 586
160 Ga0451853_0769242 3300041512 Unclassified 721
161 Ga0450923_015160 3300042125 Bacteria 1438
162 Ga0439446_0093260 3300042156 Bacteria 945
163 Ga0439434_0250020 3300042435 Bacteria 606
164 Ga0450918_044918 3300042531 Bacteria 798
165 Ga0451577_0046641 3300042876 Bacteria 3876
166 Ga0453684_0002246 3300044712 Bacteria 47929
167 Ga0451576_1551728 3300045051 Bacteria 687
168 Ga0495603_0056906 3300046455 Bacteria 2314
169 Ga0495641_0379438 3300046461 Bacteria 640
170 Ga0495664_0883743 3300046477 Bacteria 523
171 Ga0495630_0570492 3300046517 Bacteria 868
172 Ga0495630_0685871 3300046517 Bacteria 784
173 Ga0495640_0665458 3300046533 Bacteria 626
174 Ga0495587_0174312 3300046536 Bacteria 1221
175 Ga0495635_0480867 3300046663 Bacteria 819
176 Ga0495624_0904057 3300046690 Bacteria 520
177 Ga0495676_0733796 3300047321 Bacteria 638
178 Ga0495602_0800634 3300048088 Bacteria 633
179 Ga0496101_0069295 3300048904 Bacteria 2580
180 Ga0496101_0275207 3300048904 Bacteria 1315
181 Ga0496101_0342692 3300048904 Bacteria 1174
182 Ga0496102_0196158 3300048905 Bacteria 1903
183 Ga0496102_0311044 3300048905 Bacteria 1485
184 Ga0496103_0123541 3300048906 Bacteria 1650
185 Ga0496103_1041340 3300048906 Bacteria 508
186 Ga0496104_0111951 3300048907 Bacteria 2617
187 Ga0496104_1660520 3300048907 Bacteria 541
188 Ga0496105_0061487 3300048908 Bacteria 3099
189 Ga0496108_0217399 3300048911 Bacteria 1660
190 Ga0496108_1578349 3300048911 Bacteria 544
191 Ga0496109_0499878 3300048912 Bacteria 1148
192 Ga0496109_1398072 3300048912 Bacteria 635
193 Ga0496110_0093609 3300048913 Bacteria 2690
194 Ga0496110_0133405 3300048913 Bacteria 2243
195 Ga0496111_0131064 3300048914 Bacteria 1855
196 Ga0496111_0449419 3300048914 Bacteria 951
197 Ga0496114_0001390 3300048917 Bacteria 18357
198 Ga0496114_0211585 3300048917 Bacteria 1701
199 Ga0496114_0328821 3300048917 Bacteria 1351
200 Ga0501031_0022110 3300049568 Bacteria 4144
201 Ga0501031_0252476 3300049568 Bacteria 1146
202 Ga0501031_0464827 3300049568 Bacteria 817
203 Ga0501032_0516910 3300049569 Bacteria 762
204 Ga0501033_0714376 3300049570 Bacteria 681
205 Ga0501036_0030557 3300049572 Bacteria 4549
206 Ga0501036_0390504 3300049572 Bacteria 1161
207 Ga0501036_0409866 3300049572 Bacteria 1130
208 Ga0501037_0291804 3300049573 Bacteria 1134
209 Ga0501038_0365051 3300049574 Bacteria 1122
210 Ga0501039_0167069 3300049575 Bacteria 1730
211 Ga0501039_1212444 3300049575 Bacteria 583
212 Ga0501039_1408799 3300049575 Bacteria 536
213 Ga0501041_0323750 3300049577 Bacteria 972
214 Ga0501042_0042677 3300049578 Bacteria 3229
215 Ga0501042_0378933 3300049578 Bacteria 1024
216 Ga0501042_0941718 3300049578 Bacteria 629
217 Ga0501048_0050289 3300049582 Bacteria 2968
218 Ga0501048_0211727 3300049582 Bacteria 1375
219 Ga0501048_0660421 3300049582 Bacteria 751
220 Ga0501067_0263816 3300049583 Bacteria 959
221 Ga0501068_0412820 3300049584 Bacteria 871
222 Ga0501069_0399102 3300049585 Bacteria 814
223 Ga0501071_0035128 3300049587 Bacteria 3570
224 Ga0501071_0089909 3300049587 Bacteria 2254
225 Ga0501071_0418411 3300049587 Bacteria 1024
226 Ga0501071_1387734 3300049587 Bacteria 542
227 Ga0501072_0052970 3300049588 Bacteria 3195
228 Ga0501072_0139359 3300049588 Bacteria 1934
229 Ga0501072_0699787 3300049588 Bacteria 796
230 Ga0501073_0709027 3300049589 Bacteria 694
231 Ga0501074_0102510 3300049590 Bacteria 2049
232 Ga0501074_0986119 3300049590 Bacteria 592
233 Ga0501075_0012553 3300049591 Bacteria 6025
234 Ga0501075_0047640 3300049591 Bacteria 3221
235 Ga0501076_0224002 3300049592 Bacteria 1537
236 Ga0501076_0420678 3300049592 Bacteria 1099
237 Ga0501076_0569280 3300049592 Bacteria 934
238 Ga0501076_0701017 3300049592 Bacteria 836
239 Ga0501077_0502373 3300049593 Bacteria 777
240 Ga0501079_0103208 3300049741 Bacteria 2212
241 Ga0501079_0125850 3300049741 Bacteria 1994
242 Ga0501081_0452036 3300049743 Bacteria 954
243 Ga0501081_1142885 3300049743 Bacteria 589
244 Ga0501035_0068222 3300049822 Bacteria 3154
245 Ga0501044_1194476 3300049823 Bacteria 629
246 Ga0501045_0089830 3300049824 Bacteria 2269
247 Ga0501045_0270075 3300049824 Bacteria 1266
248 Ga0501045_0313225 3300049824 Bacteria 1168
249 Ga0501045_0756816 3300049824 Bacteria 716
250 nmdc:mga03683_10386_c1 3300050489 Bacteria 3338
251 nmdc:mga03n38_620159_c1 3300050490 Bacteria 618
252 nmdc:mga03n38_758639_c1 3300050490 Bacteria 562
253 nmdc:mga03n38_82849_c1 3300050490 Bacteria 1511
254 nmdc:mga00v17_254044_c1 3300050491 Bacteria 1140
255 nmdc:mga00v17_3348_c1 3300050491 Bacteria 8274
256 nmdc:mga00v17_395158_c1 3300050491 Bacteria 899
257 nmdc:mga00v17_423076_c1 3300050491 Bacteria 865
258 nmdc:mga00v17_543898_c1 3300050491 Bacteria 751
259 nmdc:mga00v17_7547_c1 3300050491 Bacteria 5807
260 nmdc:mga0yw44_20712_c1 3300050492 Bacteria 3655
261 nmdc:mga0yw44_2805_c1 3300050492 Bacteria 7550
262 nmdc:mga0yw44_380338_c1 3300050492 Bacteria 953
263 nmdc:mga0yw44_685583_c1 3300050492 Bacteria 696
264 nmdc:mga0yw44_737778_c1 3300050492 Bacteria 669
265 nmdc:mga0yw44_812081_c1 3300050492 Bacteria 635
266 nmdc:mga0k408_354554_c1 3300050493 Bacteria 874
267 nmdc:mga06z11_216883_c1 3300050494 Bacteria 1117
268 nmdc:mga06z11_565696_c1 3300050494 Bacteria 691
269 nmdc:mga04h51_477409_c1 3300050495 Bacteria 530
270 nmdc:mga07m45_125434_c1 3300050496 Bacteria 1484
271 nmdc:mga07m45_82376_c1 3300050496 Bacteria 1837
272 nmdc:mga06r32_1314359_c1 3300050510 Bacteria 667
273 nmdc:mga08y16_137750_c1 3300050511 Bacteria 2537
274 nmdc:mga0n895_1606672_c1 3300050512 Bacteria 614
275 nmdc:mga0a205_1499208_c1 3300050515 Bacteria 522
276 Ga0495601_0388784 3300053077 Bacteria 905
277 Ga0500568_0223681 3300053139 Bacteria 687
278 Ga0501084_0393503 3300054114 Bacteria 1171
279 Ga0501084_0422376 3300054114 Bacteria 1127
280 Ga0501084_0789410 3300054114 Bacteria 800
281 Ga0501084_0991837 3300054114 Bacteria 706
282 Ga0587091_177580 3300059511 Bacteria 558
283 Ga0587094_064250 3300059513 Bacteria 648
284 Ga0587128_095253 3300059630 Bacteria 616
285 Ga0530510_0175478 3300061734 Bacteria 1588
286 Ga0530510_0323592 3300061734 Bacteria 1156
287 Ga0530510_0421949 3300061734 Bacteria 1007

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_101643452 Ga0207675_1016434522 59
2 3300006038 Ga0075365_10390717 Ga0075365_103907172 66
3 3300050492 nmdc:mga0yw44_737778_c1 nmdc:mga0yw44_737778_c1_308_550 66
4 3300005338 Ga0068868_100844995 Ga0068868_1008449952 72
5 3300005718 Ga0068866_10713456 Ga0068866_107134562 72
6 3300006038 Ga0075365_10440848 Ga0075365_104408482 72
7 3300006051 Ga0075364_10252896 Ga0075364_102528961 72
8 3300006177 Ga0075362_10031850 Ga0075362_100318503 72
9 3300006353 Ga0075370_10080829 Ga0075370_100808293 72
10 3300006844 Ga0075428_101096833 Ga0075428_1010968332 72
11 3300007076 Ga0075435_101117731 Ga0075435_1011177312 72
12 3300009094 Ga0111539_10151991 Ga0111539_101519913 72
13 3300009098 Ga0105245_11118746 Ga0105245_111187463 72
14 3300009147 Ga0114129_12021783 Ga0114129_120217831 72
15 3300014326 Ga0157380_10432996 Ga0157380_104329962 72
16 3300014326 Ga0157380_11422214 Ga0157380_114222142 72
17 3300025908 Ga0207643_10343742 Ga0207643_103437422 72
18 3300026116 Ga0207674_11580484 Ga0207674_115804842 72
19 3300031727 Ga0316576_10003737 Ga0316576_100037377 72
20 3300031727 Ga0316576_10496413 Ga0316576_104964132 72
21 3300031728 Ga0316578_10076427 Ga0316578_100764272 72
22 3300035114 Ga0373939_0300748 Ga0373939_0300748_225_443 72
23 3300035398 Ga0316574_0196329 Ga0316574_0196329_90_308 72
24 3300035398 Ga0316574_0341400 Ga0316574_0341400_631_849 72
25 3300036647 Ga0316582_0139655 Ga0316582_0139655_844_1062 72
26 3300036712 Ga0316584_0295003 Ga0316584_0295003_788_1006 72
27 3300041459 Ga0451800_0559365 Ga0451800_0559365_108_326 72
28 3300041507 Ga0451851_0119914 Ga0451851_0119914_64_282 72
29 3300041509 Ga0451843_1498660 Ga0451843_1498660_279_497 72
30 3300041511 Ga0451855_0667362 Ga0451855_0667362_47_265 72
31 3300046461 Ga0495641_0379438 Ga0495641_0379438_38_256 72
32 3300046517 Ga0495630_0685871 Ga0495630_0685871_408_626 72
33 3300046533 Ga0495640_0665458 Ga0495640_0665458_250_468 72
34 3300047321 Ga0495676_0733796 Ga0495676_0733796_168_386 72
35 3300049568 Ga0501031_0022110 Ga0501031_0022110_1066_1284 72
36 3300049568 Ga0501031_0464827 Ga0501031_0464827_434_652 72
37 3300049572 Ga0501036_0030557 Ga0501036_0030557_3983_4201 72
38 3300049572 Ga0501036_0409866 Ga0501036_0409866_598_816 72
39 3300049573 Ga0501037_0291804 Ga0501037_0291804_710_928 72
40 3300049574 Ga0501038_0365051 Ga0501038_0365051_247_465 72
41 3300049575 Ga0501039_0167069 Ga0501039_0167069_859_1077 72
42 3300049575 Ga0501039_1408799 Ga0501039_1408799_104_322 72
43 3300049577 Ga0501041_0323750 Ga0501041_0323750_586_804 72
44 3300049578 Ga0501042_0042677 Ga0501042_0042677_1355_1573 72
45 3300049578 Ga0501042_0378933 Ga0501042_0378933_385_603 72
46 3300049582 Ga0501048_0050289 Ga0501048_0050289_2192_2410 72
47 3300049582 Ga0501048_0211727 Ga0501048_0211727_424_642 72
48 3300049584 Ga0501068_0412820 Ga0501068_0412820_129_347 72
49 3300049585 Ga0501069_0399102 Ga0501069_0399102_298_516 72
50 3300049587 Ga0501071_0035128 Ga0501071_0035128_414_632 72
51 3300049587 Ga0501071_0418411 Ga0501071_0418411_464_682 72
52 3300049587 Ga0501071_1387734 Ga0501071_1387734_164_382 72
53 3300049588 Ga0501072_0052970 Ga0501072_0052970_2893_3111 72
54 3300049588 Ga0501072_0139359 Ga0501072_0139359_1463_1681 72
55 3300049588 Ga0501072_0699787 Ga0501072_0699787_67_285 72
56 3300049590 Ga0501074_0102510 Ga0501074_0102510_1305_1523 72
57 3300049591 Ga0501075_0012553 Ga0501075_0012553_903_1121 72
58 3300049591 Ga0501075_0047640 Ga0501075_0047640_336_554 72
59 3300049592 Ga0501076_0224002 Ga0501076_0224002_677_895 72
60 3300049592 Ga0501076_0420678 Ga0501076_0420678_327_545 72
61 3300049593 Ga0501077_0502373 Ga0501077_0502373_359_577 72
62 3300049741 Ga0501079_0103208 Ga0501079_0103208_463_681 72
63 3300049741 Ga0501079_0125850 Ga0501079_0125850_1588_1806 72
64 3300049743 Ga0501081_0452036 Ga0501081_0452036_117_335 72
65 3300049822 Ga0501035_0068222 Ga0501035_0068222_894_1112 72
66 3300049823 Ga0501044_1194476 Ga0501044_1194476_348_566 72
67 3300049824 Ga0501045_0089830 Ga0501045_0089830_1643_1861 72
68 3300049824 Ga0501045_0270075 Ga0501045_0270075_259_477 72
69 3300050489 nmdc:mga03683_10386_c1 nmdc:mga03683_10386_c1_1984_2202 72
70 3300050490 nmdc:mga03n38_758639_c1 nmdc:mga03n38_758639_c1_101_319 72
71 3300050491 nmdc:mga00v17_254044_c1 nmdc:mga00v17_254044_c1_203_421 72
72 3300050491 nmdc:mga00v17_423076_c1 nmdc:mga00v17_423076_c1_464_682 72
73 3300050491 nmdc:mga00v17_7547_c1 nmdc:mga00v17_7547_c1_2982_3200 72
74 3300050492 nmdc:mga0yw44_20712_c1 nmdc:mga0yw44_20712_c1_3287_3505 72
75 3300050492 nmdc:mga0yw44_685583_c1 nmdc:mga0yw44_685583_c1_49_267 72
76 3300050493 nmdc:mga0k408_354554_c1 nmdc:mga0k408_354554_c1_525_743 72
77 3300050496 nmdc:mga07m45_125434_c1 nmdc:mga07m45_125434_c1_131_349 72
78 3300050510 nmdc:mga06r32_1314359_c1 nmdc:mga06r32_1314359_c1_149_367 72
79 3300050511 nmdc:mga08y16_137750_c1 nmdc:mga08y16_137750_c1_1248_1466 72
80 3300050512 nmdc:mga0n895_1606672_c1 nmdc:mga0n895_1606672_c1_137_355 72
81 3300050515 nmdc:mga0a205_1499208_c1 nmdc:mga0a205_1499208_c1_46_264 72
82 3300053139 Ga0500568_0223681 Ga0500568_0223681_93_311 72
83 3300054114 Ga0501084_0393503 Ga0501084_0393503_166_384 72
84 3300054114 Ga0501084_0422376 Ga0501084_0422376_369_587 72
85 3300059513 Ga0587094_064250 Ga0587094_064250_61_279 72
86 3300061734 Ga0530510_0175478 Ga0530510_0175478_1187_1405 72
87 3300005330 Ga0070690_101589727 Ga0070690_1015897271 73
88 3300005331 Ga0070670_101585057 Ga0070670_1015850571 73
89 3300005340 Ga0070689_100177292 Ga0070689_1001772922 73
90 3300005343 Ga0070687_100749350 Ga0070687_1007493501 73
91 3300005344 Ga0070661_100618683 Ga0070661_1006186832 73
92 3300005347 Ga0070668_100099544 Ga0070668_1000995443 73
93 3300005354 Ga0070675_100088735 Ga0070675_1000887353 73
94 3300005355 Ga0070671_100012324 Ga0070671_1000123247 73
95 3300005355 Ga0070671_100924476 Ga0070671_1009244762 73
96 3300005356 Ga0070674_100082498 Ga0070674_1000824984 73
97 3300005367 Ga0070667_100684599 Ga0070667_1006845991 73
98 3300005435 Ga0070714_102419767 Ga0070714_1024197671 73
99 3300005436 Ga0070713_100914900 Ga0070713_1009149002 73
100 3300005439 Ga0070711_101164151 Ga0070711_1011641512 73
101 3300005459 Ga0068867_100034919 Ga0068867_1000349194 73
102 3300005466 Ga0070685_10396686 Ga0070685_103966862 73
103 3300005466 Ga0070685_10676962 Ga0070685_106769623 73
104 3300005535 Ga0070684_100441641 Ga0070684_1004416412 73
105 3300005535 Ga0070684_101461613 Ga0070684_1014616132 73
106 3300005543 Ga0070672_100302026 Ga0070672_1003020263 73
107 3300005544 Ga0070686_100099968 Ga0070686_1000999682 73
108 3300005544 Ga0070686_101307399 Ga0070686_1013073992 73
109 3300005564 Ga0070664_100413989 Ga0070664_1004139892 73
110 3300005718 Ga0068866_10177726 Ga0068866_101777262 73
111 3300005719 Ga0068861_100066350 Ga0068861_1000663503 73
112 3300005719 Ga0068861_100629224 Ga0068861_1006292243 73
113 3300005841 Ga0068863_100534138 Ga0068863_1005341382 73
114 3300005843 Ga0068860_100314109 Ga0068860_1003141091 73
115 3300005843 Ga0068860_101317468 Ga0068860_1013174682 73
116 3300005844 Ga0068862_100051179 Ga0068862_1000511795 73
117 3300005937 Ga0081455_10069478 Ga0081455_100694784 73
118 3300006038 Ga0075365_10009780 Ga0075365_100097807 73
119 3300006038 Ga0075365_10223080 Ga0075365_102230802 73
120 3300006038 Ga0075365_10986447 Ga0075365_109864472 73
121 3300006042 Ga0075368_10111056 Ga0075368_101110562 73
122 3300006048 Ga0075363_100026088 Ga0075363_1000260882 73
123 3300006048 Ga0075363_100064720 Ga0075363_1000647203 73
124 3300006048 Ga0075363_100157291 Ga0075363_1001572912 73
125 3300006051 Ga0075364_10000990 Ga0075364_1000099010 73
126 3300006051 Ga0075364_10111348 Ga0075364_101113483 73
127 3300006051 Ga0075364_10374608 Ga0075364_103746083 73
128 3300006051 Ga0075364_10525867 Ga0075364_105258672 73
129 3300006051 Ga0075364_10534139 Ga0075364_105341392 73
130 3300006178 Ga0075367_10039556 Ga0075367_100395563 73
131 3300006178 Ga0075367_10212886 Ga0075367_102128862 73
132 3300006178 Ga0075367_10607604 Ga0075367_106076041 73
133 3300006186 Ga0075369_10330517 Ga0075369_103305172 73
134 3300006195 Ga0075366_10801668 Ga0075366_108016681 73
135 3300006237 Ga0097621_100244176 Ga0097621_1002441763 73
136 3300006353 Ga0075370_10374155 Ga0075370_103741552 73
137 3300006353 Ga0075370_10412850 Ga0075370_104128502 73
138 3300006844 Ga0075428_101975595 Ga0075428_1019755952 73
139 3300006880 Ga0075429_101690029 Ga0075429_1016900292 73
140 3300006881 Ga0068865_101570567 Ga0068865_1015705671 73
141 3300009092 Ga0105250_10536985 Ga0105250_105369852 73
142 3300009094 Ga0111539_12664861 Ga0111539_126648612 73
143 3300009094 Ga0111539_12817823 Ga0111539_128178232 73
144 3300009098 Ga0105245_10080839 Ga0105245_100808394 73
145 3300009101 Ga0105247_10786747 Ga0105247_107867472 73
146 3300009101 Ga0105247_10791771 Ga0105247_107917712 73
147 3300009148 Ga0105243_10007049 Ga0105243_100070494 73
148 3300009174 Ga0105241_10858516 Ga0105241_108585162 73
149 3300009176 Ga0105242_10044681 Ga0105242_100446815 73
150 3300009177 Ga0105248_10480361 Ga0105248_104803614 73
151 3300009553 Ga0105249_12005005 Ga0105249_120050052 73
152 3300009553 Ga0105249_12494628 Ga0105249_124946282 73
153 3300010375 Ga0105239_12426461 Ga0105239_124264612 73
154 3300011119 Ga0105246_10645920 Ga0105246_106459201 73
155 3300011119 Ga0105246_11725299 Ga0105246_117252992 73
156 3300013297 Ga0157378_10017880 Ga0157378_100178806 73
157 3300013306 Ga0163162_12238712 Ga0163162_122387122 73
158 3300013306 Ga0163162_12495422 Ga0163162_124954222 73
159 3300013308 Ga0157375_10062379 Ga0157375_100623793 73
160 3300013308 Ga0157375_10335750 Ga0157375_103357502 73
161 3300013308 Ga0157375_12306283 Ga0157375_123062832 73
162 3300014325 Ga0163163_10581262 Ga0163163_105812621 73
163 3300014326 Ga0157380_10948293 Ga0157380_109482932 73
164 3300014745 Ga0157377_11302337 Ga0157377_113023371 73
165 3300014968 Ga0157379_10060890 Ga0157379_100608903 73
166 3300014968 Ga0157379_10602627 Ga0157379_106026272 73
167 3300020078 Ga0206352_11121634 Ga0206352_111216342 73
168 3300022467 Ga0224712_10436504 Ga0224712_104365041 73
169 3300025899 Ga0207642_10008068 Ga0207642_100080684 73
170 3300025900 Ga0207710_10413634 Ga0207710_104136342 73
171 3300025916 Ga0207663_11423987 Ga0207663_114239872 73
172 3300025923 Ga0207681_11392935 Ga0207681_113929352 73
173 3300025926 Ga0207659_10336696 Ga0207659_103366963 73
174 3300025927 Ga0207687_10077209 Ga0207687_100772093 73
175 3300025931 Ga0207644_10927130 Ga0207644_109271302 73
176 3300025935 Ga0207709_10052776 Ga0207709_100527765 73
177 3300025936 Ga0207670_10912260 Ga0207670_109122601 73
178 3300025940 Ga0207691_10256467 Ga0207691_102564673 73
179 3300025940 Ga0207691_10562524 Ga0207691_105625243 73
180 3300025941 Ga0207711_11021662 Ga0207711_110216622 73
181 3300025944 Ga0207661_10186300 Ga0207661_101863003 73
182 3300025945 Ga0207679_10622058 Ga0207679_106220582 73
183 3300025961 Ga0207712_10100735 Ga0207712_101007352 73
184 3300025972 Ga0207668_10089214 Ga0207668_100892143 73
185 3300026023 Ga0207677_12129438 Ga0207677_121294382 73
186 3300026041 Ga0207639_10888095 Ga0207639_108880953 73
187 3300026088 Ga0207641_10803081 Ga0207641_108030812 73
188 3300026089 Ga0207648_10004938 Ga0207648_100049386 73
189 3300026118 Ga0207675_100007094 Ga0207675_10000709410 73
190 3300026118 Ga0207675_100071551 Ga0207675_1000715514 73
191 3300026118 Ga0207675_100791480 Ga0207675_1007914802 73
192 3300026142 Ga0207698_12073315 Ga0207698_120733152 73
193 3300026142 Ga0207698_12464751 Ga0207698_124647512 73
194 3300028380 Ga0268265_10159031 Ga0268265_101590314 73
195 3300028381 Ga0268264_10154648 Ga0268264_101546482 73
196 3300028381 Ga0268264_11272748 Ga0268264_112727482 73
197 3300028381 Ga0268264_11585380 Ga0268264_115853801 73
198 3300031727 Ga0316576_10475133 Ga0316576_104751333 73
199 3300032126 Ga0307415_101636562 Ga0307415_1016365622 73
200 3300035170 Ga0373943_0886535 Ga0373943_0886535_104_325 73
201 3300035398 Ga0316574_0015400 Ga0316574_0015400_3935_4156 73
202 3300035398 Ga0316574_0049111 Ga0316574_0049111_196_417 73
203 3300035398 Ga0316574_0110985 Ga0316574_0110985_1370_1591 73
204 3300035398 Ga0316574_0674244 Ga0316574_0674244_74_295 73
205 3300035398 Ga0316574_0754259 Ga0316574_0754259_133_357 73
206 3300035691 Ga0373931_0504850 Ga0373931_0504850_442_663 73
207 3300036401 Ga0373937_2012863 Ga0373937_2012863_118_339 73
208 3300036647 Ga0316582_0489628 Ga0316582_0489628_552_773 73
209 3300041413 Ga0439465_0059136 Ga0439465_0059136_1008_1229 73
210 3300041443 Ga0451789_1238268 Ga0451789_1238268_100_321 73
211 3300041451 Ga0451791_0790917 Ga0451791_0790917_55_282 73
212 3300041452 Ga0451793_0230090 Ga0451793_0230090_39_266 73
213 3300041452 Ga0451793_0701768 Ga0451793_0701768_83_304 73
214 3300041463 Ga0451804_0463578 Ga0451804_0463578_142_363 73
215 3300041509 Ga0451843_1700329 Ga0451843_1700329_43_276 73
216 3300041511 Ga0451855_1609421 Ga0451855_1609421_227_457 73
217 3300041512 Ga0451853_0769242 Ga0451853_0769242_36_257 73
218 3300042125 Ga0450923_015160 Ga0450923_015160_248_469 73
219 3300042156 Ga0439446_0093260 Ga0439446_0093260_508_729 73
220 3300042435 Ga0439434_0250020 Ga0439434_0250020_244_465 73
221 3300042531 Ga0450918_044918 Ga0450918_044918_440_661 73
222 3300042876 Ga0451577_0046641 Ga0451577_0046641_789_1022 73
223 3300044712 Ga0453684_0002246 Ga0453684_0002246_47604_47837 73
224 3300045051 Ga0451576_1551728 Ga0451576_1551728_185_418 73
225 3300046455 Ga0495603_0056906 Ga0495603_0056906_761_982 73
226 3300046477 Ga0495664_0883743 Ga0495664_0883743_74_295 73
227 3300046517 Ga0495630_0570492 Ga0495630_0570492_556_777 73
228 3300046536 Ga0495587_0174312 Ga0495587_0174312_890_1111 73
229 3300046663 Ga0495635_0480867 Ga0495635_0480867_149_370 73
230 3300046690 Ga0495624_0904057 Ga0495624_0904057_134_355 73
231 3300048088 Ga0495602_0800634 Ga0495602_0800634_55_276 73
232 3300048904 Ga0496101_0069295 Ga0496101_0069295_1874_2101 73
233 3300048904 Ga0496101_0275207 Ga0496101_0275207_467_691 73
234 3300048904 Ga0496101_0342692 Ga0496101_0342692_83_304 73
235 3300048905 Ga0496102_0196158 Ga0496102_0196158_1400_1621 73
236 3300048905 Ga0496102_0311044 Ga0496102_0311044_624_851 73
237 3300048906 Ga0496103_0123541 Ga0496103_0123541_763_990 73
238 3300048906 Ga0496103_1041340 Ga0496103_1041340_180_401 73
239 3300048907 Ga0496104_0111951 Ga0496104_0111951_1602_1829 73
240 3300048907 Ga0496104_1660520 Ga0496104_1660520_85_324 73
241 3300048908 Ga0496105_0061487 Ga0496105_0061487_278_505 73
242 3300048911 Ga0496108_0217399 Ga0496108_0217399_965_1186 73
243 3300048911 Ga0496108_1578349 Ga0496108_1578349_211_435 73
244 3300048912 Ga0496109_0499878 Ga0496109_0499878_915_1136 73
245 3300048912 Ga0496109_1398072 Ga0496109_1398072_66_287 73
246 3300048913 Ga0496110_0093609 Ga0496110_0093609_2036_2263 73
247 3300048913 Ga0496110_0133405 Ga0496110_0133405_1152_1373 73
248 3300048914 Ga0496111_0131064 Ga0496111_0131064_1348_1575 73
249 3300048914 Ga0496111_0449419 Ga0496111_0449419_167_388 73
250 3300048917 Ga0496114_0001390 Ga0496114_0001390_930_1157 73
251 3300048917 Ga0496114_0211585 Ga0496114_0211585_1199_1423 73
252 3300048917 Ga0496114_0328821 Ga0496114_0328821_781_1002 73
253 3300049568 Ga0501031_0252476 Ga0501031_0252476_28_249 73
254 3300049569 Ga0501032_0516910 Ga0501032_0516910_500_721 73
255 3300049570 Ga0501033_0714376 Ga0501033_0714376_186_407 73
256 3300049572 Ga0501036_0390504 Ga0501036_0390504_771_992 73
257 3300049575 Ga0501039_1212444 Ga0501039_1212444_189_410 73
258 3300049578 Ga0501042_0941718 Ga0501042_0941718_104_325 73
259 3300049582 Ga0501048_0660421 Ga0501048_0660421_55_288 73
260 3300049583 Ga0501067_0263816 Ga0501067_0263816_495_734 73
261 3300049587 Ga0501071_0089909 Ga0501071_0089909_373_594 73
262 3300049589 Ga0501073_0709027 Ga0501073_0709027_336_557 73
263 3300049590 Ga0501074_0986119 Ga0501074_0986119_344_565 73
264 3300049592 Ga0501076_0569280 Ga0501076_0569280_143_364 73
265 3300049592 Ga0501076_0701017 Ga0501076_0701017_576_797 73
266 3300049743 Ga0501081_1142885 Ga0501081_1142885_235_456 73
267 3300049824 Ga0501045_0313225 Ga0501045_0313225_126_347 73
268 3300049824 Ga0501045_0756816 Ga0501045_0756816_30_251 73
269 3300050490 nmdc:mga03n38_620159_c1 nmdc:mga03n38_620159_c1_23_250 73
270 3300050490 nmdc:mga03n38_82849_c1 nmdc:mga03n38_82849_c1_369_614 73
271 3300050491 nmdc:mga00v17_3348_c1 nmdc:mga00v17_3348_c1_6996_7241 73
272 3300050491 nmdc:mga00v17_395158_c1 nmdc:mga00v17_395158_c1_537_767 73
273 3300050491 nmdc:mga00v17_543898_c1 nmdc:mga00v17_543898_c1_336_557 73
274 3300050492 nmdc:mga0yw44_2805_c1 nmdc:mga0yw44_2805_c1_5173_5418 73
275 3300050492 nmdc:mga0yw44_380338_c1 nmdc:mga0yw44_380338_c1_692_922 73
276 3300050492 nmdc:mga0yw44_812081_c1 nmdc:mga0yw44_812081_c1_401_622 73
277 3300050494 nmdc:mga06z11_216883_c1 nmdc:mga06z11_216883_c1_809_1036 73
278 3300050494 nmdc:mga06z11_565696_c1 nmdc:mga06z11_565696_c1_426_656 73
279 3300050495 nmdc:mga04h51_477409_c1 nmdc:mga04h51_477409_c1_92_337 73
280 3300050496 nmdc:mga07m45_82376_c1 nmdc:mga07m45_82376_c1_458_688 73
281 3300053077 Ga0495601_0388784 Ga0495601_0388784_469_690 73
282 3300054114 Ga0501084_0789410 Ga0501084_0789410_554_775 73
283 3300054114 Ga0501084_0991837 Ga0501084_0991837_329_550 73
284 3300059511 Ga0587091_177580 Ga0587091_177580_231_452 73
285 3300059630 Ga0587128_095253 Ga0587128_095253_350_574 73
286 3300061734 Ga0530510_0323592 Ga0530510_0323592_613_834 73
287 3300061734 Ga0530510_0421949 Ga0530510_0421949_495_716 73

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24696

1

71

0.95

Feature Viewer

pLDDT pTM Quality
77.86 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map