F387983

General Info

Members Datasets Scaffolds Average Seq Length
287 119 574 196

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10002449|Ga0111539_1000244910
Length 202
Sequence MLKEIKQGVLFTVVTMVLLGGAYHMVLWGVGRVFFAEQTDGSLIRRDDGTIIGSRLIAQKFTRPEYFRPRPSGVDYNAASTGGTNYGPSNPDHLKAVQQRVDAIVEEEGVQAARQIPSEMVTASGAGLDPHVPPNAAELQATRVARSRDVDVSRVRELIAAHTETPTFGFLGRARVNVLELNLALDAAFGSRRPAASTSATP

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
50 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
53 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
56 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
57 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
58 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
59 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
60 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
61 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
62 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
67 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
68 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
69 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
72 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
73 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
76 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
77 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
116 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 0
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10002449 3300009094 Bacteria 24673
2 Ga0070680_100493702 3300005336 Bacteria 1047
3 Ga0070689_100011495 3300005340 Bacteria 6345
4 Ga0070669_100238184 3300005353 Bacteria 1445
5 Ga0070675_100501558 3300005354 Bacteria 1094
6 Ga0070675_100649253 3300005354 Unclassified 959
7 Ga0070688_100281456 3300005365 Bacteria 1195
8 Ga0070700_100099901 3300005441 Bacteria 1910
9 Ga0070694_100472925 3300005444 Bacteria 993
10 Ga0070662_100088757 3300005457 Bacteria 2318
11 Ga0070695_100133996 3300005545 Bacteria 1710
12 Ga0068859_100117840 3300005617 Bacteria 2721
13 Ga0068859_101436370 3300005617 Unclassified 761
14 Ga0068861_100090643 3300005719 Bacteria 2412
15 Ga0068858_100174971 3300005842 Bacteria 2025
16 Ga0068862_100305059 3300005844 Bacteria 1466
17 Ga0081539_10000056 3300005985 Bacteria 256522
18 Ga0075365_10924384 3300006038 Bacteria 615
19 Ga0075368_10118438 3300006042 Bacteria 1095
20 Ga0075363_100631717 3300006048 Bacteria 643
21 Ga0075367_10026773 3300006178 Bacteria 3273
22 Ga0075367_10283413 3300006178 Bacteria 1042
23 Ga0075428_100007351 3300006844 Bacteria 12208
24 Ga0075428_100041846 3300006844 Bacteria 5038
25 Ga0075428_100258124 3300006844 Bacteria 1877
26 Ga0075430_100003385 3300006846 Bacteria 13344
27 Ga0075430_100022591 3300006846 Bacteria 5353
28 Ga0075431_100028074 3300006847 Bacteria 5778
29 Ga0075431_100209423 3300006847 Bacteria 1992
30 Ga0075431_100392449 3300006847 Bacteria 1390
31 Ga0075431_100522035 3300006847 Bacteria 1177
32 Ga0075433_10597489 3300006852 Bacteria 969
33 Ga0075434_100993513 3300006871 Unclassified 853
34 Ga0075429_100174678 3300006880 Bacteria 1882
35 Ga0097620_100117836 3300006931 Bacteria 2721
36 Ga0097620_101435723 3300006931 Unclassified 761
37 Ga0075435_100843616 3300007076 Unclassified 798
38 Ga0111539_10000073 3300009094 Bacteria 100413
39 Ga0111539_10007929 3300009094 Bacteria 13539
40 Ga0111539_10051756 3300009094 Bacteria 4890
41 Ga0111539_10058252 3300009094 Bacteria 4584
42 Ga0111539_10190199 3300009094 Bacteria 2395
43 Ga0111539_10292322 3300009094 Bacteria 1896
44 Ga0111539_10942573 3300009094 Bacteria 1004
45 Ga0111539_11400379 3300009094 Bacteria 811
46 Ga0114129_10000475 3300009147 Bacteria 48344
47 Ga0114129_10001370 3300009147 Bacteria 32769
48 Ga0114129_11512285 3300009147 Bacteria 824
49 Ga0157371_10006647 3300013102 Bacteria 9472
50 Ga0157380_10689334 3300014326 Bacteria 1025
51 Ga0157380_11132636 3300014326 Bacteria 823
52 Ga0157376_10009782 3300014969 Bacteria 6985
53 Ga0207681_10605417 3300025923 Bacteria 906
54 Ga0207659_10348029 3300025926 Bacteria 1229
55 Ga0207706_10346101 3300025933 Bacteria 1293
56 Ga0207670_10008985 3300025936 Bacteria 5669
57 Ga0207703_10149641 3300026035 Bacteria 2034
58 Ga0207708_10107006 3300026075 Bacteria 2169
59 Ga0207428_10010677 3300027907 Bacteria 8190
60 Ga0207428_10576042 3300027907 Bacteria 813
61 Ga0265328_10160025 3300031239 Bacteria 849
62 Ga0265331_10290271 3300031250 Bacteria 733
63 Ga0265327_10021869 3300031251 Bacteria 3846
64 Ga0307513_10210669 3300031456 Bacteria 1775
65 Ga0307408_100003867 3300031548 Bacteria 10192
66 Ga0307410_10336383 3300031852 Bacteria 1202
67 Ga0307412_10582404 3300031911 Bacteria 945
68 Ga0307409_100366530 3300031995 Bacteria 1365
69 Ga0307416_100012702 3300032002 Bacteria 5687
70 Ga0307416_100262724 3300032002 Bacteria 1688
71 Ga0307411_10319578 3300032005 Bacteria 1253
72 Ga0373946_0002673 3300035171 Bacteria 6297
73 Ga0373947_0022363 3300035725 Bacteria 3667
74 Ga0373925_0000645 3300037068 Bacteria 32864
75 Ga0439460_0111382 3300042461 Unclassified 888
76 Ga0450916_005292 3300042530 Bacteria 1488
77 Ga0451576_0213893 3300045051 Bacteria 2013
78 Ga0495603_0033494 3300046455 Bacteria 3091
79 Ga0495629_0000199 3300046459 Bacteria 53276
80 Ga0495629_0135088 3300046459 Bacteria 1717
81 Ga0495641_0010913 3300046461 Bacteria 5220
82 Ga0495582_0003372 3300046473 Bacteria 8988
83 Ga0495639_0000268 3300046475 Bacteria 25844
84 Ga0495639_0002903 3300046475 Bacteria 7466
85 Ga0495663_0132618 3300046525 Unclassified 841
86 Ga0495666_0000030 3300046526 Bacteria 54704
87 Ga0495642_0025207 3300046528 Bacteria 2356
88 Ga0495586_0000837 3300046535 Bacteria 17667
89 Ga0495621_0010989 3300046539 Bacteria 2786
90 Ga0495634_0004457 3300046642 Bacteria 10990
91 Ga0495635_0001808 3300046663 Bacteria 14440
92 Ga0495659_0024412 3300046664 Bacteria 2062
93 Ga0495657_0272457 3300046675 Bacteria 1015
94 Ga0495647_0010039 3300046681 Bacteria 3219
95 Ga0495658_0000022 3300046683 Bacteria 82571
96 Ga0495658_0023058 3300046683 Bacteria 3301
97 Ga0495613_0002334 3300046689 Bacteria 14368
98 Ga0495613_0111814 3300046689 Bacteria 1968
99 Ga0495581_0000097 3300047315 Bacteria 36396
100 Ga0495581_0018824 3300047315 Bacteria 4008
101 Ga0495581_0436477 3300047315 Unclassified 763
102 Ga0495676_0001448 3300047321 Bacteria 20478
103 Ga0495680_0008400 3300047322 Bacteria 9392
104 Ga0495593_0032641 3300047673 Bacteria 2837
105 Ga0495614_0000392 3300048089 Bacteria 17780
106 Ga0501031_0317099 3300049568 Bacteria 1010
107 Ga0501032_0000090 3300049569 Bacteria 79705
108 Ga0501032_0277560 3300049569 Bacteria 1085
109 Ga0501034_0086354 3300049571 Bacteria 3138
110 Ga0501036_0006105 3300049572 Bacteria 9778
111 Ga0501036_0040916 3300049572 Bacteria 3921
112 Ga0501036_0430978 3300049572 Bacteria 1099
113 Ga0501036_0432309 3300049572 Bacteria 1097
114 Ga0501036_0668008 3300049572 Unclassified 860
115 Ga0501036_0942314 3300049572 Bacteria 708
116 Ga0501037_0109839 3300049573 Bacteria 1987
117 Ga0501038_0011533 3300049574 Bacteria 8064
118 Ga0501038_0225286 3300049574 Bacteria 1494
119 Ga0501038_0510926 3300049574 Bacteria 918
120 Ga0501038_0631489 3300049574 Bacteria 808
121 Ga0501039_0030605 3300049575 Bacteria 4151
122 Ga0501039_0101981 3300049575 Bacteria 2240
123 Ga0501039_0139269 3300049575 Bacteria 1906
124 Ga0501039_0267017 3300049575 Bacteria 1345
125 Ga0501039_0292219 3300049575 Bacteria 1281
126 Ga0501039_0506859 3300049575 Bacteria 947
127 Ga0501039_0862805 3300049575 Unclassified 705
128 Ga0501040_0003545 3300049576 Bacteria 10086
129 Ga0501040_0019841 3300049576 Bacteria 4474
130 Ga0501040_0043985 3300049576 Bacteria 3044
131 Ga0501040_0063429 3300049576 Bacteria 2543
132 Ga0501040_0206745 3300049576 Bacteria 1395
133 Ga0501041_0005061 3300049577 Bacteria 7681
134 Ga0501041_0031269 3300049577 Bacteria 3215
135 Ga0501041_0086391 3300049577 Bacteria 1935
136 Ga0501041_0298068 3300049577 Bacteria 1015
137 Ga0501041_0458858 3300049577 Unclassified 809
138 Ga0501042_0093588 3300049578 Bacteria 2158
139 Ga0501042_0102887 3300049578 Bacteria 2055
140 Ga0501042_0115625 3300049578 Bacteria 1932
141 Ga0501042_0134645 3300049578 Bacteria 1781
142 Ga0501042_0157334 3300049578 Bacteria 1639
143 Ga0501042_0167886 3300049578 Bacteria 1583
144 Ga0501042_0180282 3300049578 Bacteria 1524
145 Ga0501042_0463306 3300049578 Unclassified 919
146 Ga0501042_0657925 3300049578 Unclassified 762
147 Ga0501043_0040450 3300049579 Bacteria 3664
148 Ga0501043_0386495 3300049579 Bacteria 1059
149 Ga0501046_0005586 3300049580 Bacteria 11231
150 Ga0501046_0472809 3300049580 Bacteria 900
151 Ga0501046_0850779 3300049580 Unclassified 638
152 Ga0501047_0825105 3300049581 Unclassified 742
153 Ga0501048_0083050 3300049582 Bacteria 2259
154 Ga0501048_0161550 3300049582 Bacteria 1586
155 Ga0501048_0162794 3300049582 Bacteria 1579
156 Ga0501048_0183279 3300049582 Bacteria 1484
157 Ga0501048_0216096 3300049582 Bacteria 1359
158 Ga0501048_0603742 3300049582 Bacteria 788
159 Ga0501048_0791060 3300049582 Unclassified 681
160 Ga0501068_0302753 3300049584 Bacteria 1023
161 Ga0501068_0479494 3300049584 Bacteria 806
162 Ga0501071_0069721 3300049587 Bacteria 2561
163 Ga0501071_0077558 3300049587 Bacteria 2427
164 Ga0501071_0101356 3300049587 Bacteria 2123
165 Ga0501071_0110765 3300049587 Bacteria 2029
166 Ga0501071_0482775 3300049587 Bacteria 950
167 Ga0501071_0592108 3300049587 Bacteria 852
168 Ga0501071_0789575 3300049587 Unclassified 732
169 Ga0501072_0007459 3300049588 Bacteria 8297
170 Ga0501072_0088685 3300049588 Bacteria 2454
171 Ga0501072_0106882 3300049588 Bacteria 2226
172 Ga0501072_0279137 3300049588 Bacteria 1329
173 Ga0501072_0806204 3300049588 Bacteria 735
174 Ga0501072_0820590 3300049588 Unclassified 728
175 Ga0501073_0001725 3300049589 Bacteria 16245
176 Ga0501073_0363392 3300049589 Bacteria 1000
177 Ga0501074_0010803 3300049590 Bacteria 6631
178 Ga0501074_0077795 3300049590 Bacteria 2381
179 Ga0501074_0123910 3300049590 Bacteria 1848
180 Ga0501074_0203334 3300049590 Bacteria 1411
181 Ga0501074_0319924 3300049590 Bacteria 1102
182 Ga0501074_0373064 3300049590 Bacteria 1012
183 Ga0501074_0717276 3300049590 Bacteria 705
184 Ga0501075_0004924 3300049591 Bacteria 9105
185 Ga0501075_0055923 3300049591 Bacteria 2970
186 Ga0501075_0077086 3300049591 Bacteria 2522
187 Ga0501075_0126672 3300049591 Bacteria 1944
188 Ga0501075_0149526 3300049591 Bacteria 1780
189 Ga0501075_0168263 3300049591 Bacteria 1672
190 Ga0501075_0442702 3300049591 Unclassified 991
191 Ga0501075_0449241 3300049591 Unclassified 983
192 Ga0501075_0626785 3300049591 Bacteria 820
193 Ga0501075_1054725 3300049591 Bacteria 617
194 Ga0501076_0000722 3300049592 Bacteria 21362
195 Ga0501076_0016890 3300049592 Bacteria 5542
196 Ga0501076_0037467 3300049592 Bacteria 3803
197 Ga0501076_0038360 3300049592 Bacteria 3761
198 Ga0501076_0041866 3300049592 Bacteria 3606
199 Ga0501076_0085876 3300049592 Bacteria 2529
200 Ga0501076_0131570 3300049592 Bacteria 2029
201 Ga0501076_0177771 3300049592 Bacteria 1735
202 Ga0501076_0304238 3300049592 Bacteria 1307
203 Ga0501076_0309964 3300049592 Bacteria 1294
204 Ga0501076_0398019 3300049592 Bacteria 1132
205 Ga0501076_0513870 3300049592 Unclassified 987
206 Ga0501076_0678622 3300049592 Bacteria 850
207 Ga0501076_1071745 3300049592 Bacteria 664
208 Ga0501077_0009523 3300049593 Bacteria 6041
209 Ga0501077_0013851 3300049593 Bacteria 5056
210 Ga0501077_0187869 3300049593 Bacteria 1313
211 Ga0501079_0004654 3300049741 Bacteria 10167
212 Ga0501079_0031001 3300049741 Bacteria 4108
213 Ga0501079_0069668 3300049741 Bacteria 2715
214 Ga0501079_0107531 3300049741 Bacteria 2165
215 Ga0501079_0536650 3300049741 Bacteria 920
216 Ga0501079_0687003 3300049741 Bacteria 806
217 Ga0501080_0095836 3300049742 Bacteria 2755
218 Ga0501080_0131029 3300049742 Bacteria 2322
219 Ga0501080_0427847 3300049742 Bacteria 1189
220 Ga0501080_0438658 3300049742 Bacteria 1172
221 Ga0501080_0612974 3300049742 Bacteria 965
222 Ga0501080_0881849 3300049742 Bacteria 781
223 Ga0501081_0000459 3300049743 Bacteria 22598
224 Ga0501081_0002516 3300049743 Bacteria 11555
225 Ga0501081_0040588 3300049743 Bacteria 3186
226 Ga0501081_0075987 3300049743 Bacteria 2345
227 Ga0501081_0087189 3300049743 Bacteria 2192
228 Ga0501081_0171928 3300049743 Bacteria 1564
229 Ga0501081_0184448 3300049743 Bacteria 1510
230 Ga0501081_0212516 3300049743 Bacteria 1405
231 Ga0501081_0366621 3300049743 Bacteria 1063
232 Ga0501083_0087360 3300049744 Bacteria 2062
233 Ga0501083_0143583 3300049744 Bacteria 1563
234 Ga0501083_0200690 3300049744 Bacteria 1301
235 Ga0501083_0334303 3300049744 Bacteria 985
236 Ga0501035_0162726 3300049822 Bacteria 1931
237 Ga0501035_0252250 3300049822 Bacteria 1498
238 Ga0501035_0683766 3300049822 Bacteria 829
239 Ga0501045_0020869 3300049824 Bacteria 4683
240 Ga0501045_0021718 3300049824 Bacteria 4594
241 Ga0501045_0064349 3300049824 Bacteria 2692
242 Ga0501045_0084825 3300049824 Bacteria 2337
243 Ga0501045_0471466 3300049824 Bacteria 933
244 Ga0501045_0657104 3300049824 Bacteria 775
245 nmdc:mga0yw44_849857_c1 3300050492 Bacteria 619
246 nmdc:mga05p37_108731_c1 3300050507 Bacteria 3411
247 nmdc:mga05p37_27_c1 3300050507 Bacteria 115422
248 nmdc:mga09592_91428_c1 3300050508 Bacteria 2601
249 nmdc:mga0qj67_22826_c1 3300050509 Bacteria 4807
250 nmdc:mga0qj67_596_c1 3300050509 Bacteria 24614
251 nmdc:mga0qj67_74252_c1 3300050509 Bacteria 2717
252 nmdc:mga06r32_145425_c1 3300050510 Bacteria 2348
253 nmdc:mga06r32_157512_c1 3300050510 Bacteria 2253
254 nmdc:mga06r32_165125_c1 3300050510 Bacteria 2197
255 nmdc:mga06r32_168205_c1 3300050510 Bacteria 2175
256 nmdc:mga08y16_1225611_c1 3300050511 Unclassified 720
257 nmdc:mga08y16_19411_c1 3300050511 Bacteria 7167
258 nmdc:mga08y16_231433_c1 3300050511 Bacteria 1911
259 nmdc:mga08y16_32466_c1 3300050511 Bacteria 5488
260 nmdc:mga08y16_333094_c1 3300050511 Bacteria 1561
261 nmdc:mga08y16_79220_c1 3300050511 Bacteria 3424
262 nmdc:mga08y16_940253_c1 3300050511 Bacteria 848
263 nmdc:mga0n895_1162306_c1 3300050512 Bacteria 747
264 nmdc:mga0rr50_741310_c1 3300050513 Unclassified 838
265 nmdc:mga0a205_533550_c1 3300050515 Unclassified 736
266 Ga0495619_0001562 3300053085 Bacteria 15065
267 Ga0500646_0019786 3300053090 Bacteria 1783
268 Ga0500652_338953 3300053131 Unclassified 571
269 Ga0501084_0020181 3300054114 Bacteria 5555
270 Ga0501084_0037537 3300054114 Bacteria 4048
271 Ga0501084_0239624 3300054114 Bacteria 1531
272 Ga0501084_0276928 3300054114 Bacteria 1417
273 Ga0501084_0535930 3300054114 Bacteria 989
274 Ga0501084_0735161 3300054114 Unclassified 832
275 Ga0501082_0008077 3300060353 Bacteria 9080
276 Ga0501082_0050620 3300060353 Bacteria 3582
277 Ga0501082_0180550 3300060353 Bacteria 1836
278 Ga0501082_0207850 3300060353 Bacteria 1703
279 Ga0501082_0220548 3300060353 Bacteria 1650
280 Ga0501082_0228740 3300060353 Bacteria 1619
281 Ga0501082_0239279 3300060353 Bacteria 1580
282 Ga0501082_0362514 3300060353 Bacteria 1264
283 Ga0501082_0662169 3300060353 Bacteria 914
284 Ga0530510_0000967 3300061734 Bacteria 18967
285 Ga0530510_0079182 3300061734 Bacteria 2390
286 Ga0530510_0085148 3300061734 Bacteria 2303
287 Ga0530510_0530873 3300061734 Bacteria 893
288 Ga0111539_10002449
289 Ga0070680_100493702
290 Ga0070689_100011495
291 Ga0070669_100238184
292 Ga0070675_100501558
293 Ga0070675_100649253
294 Ga0070688_100281456
295 Ga0070700_100099901
296 Ga0070694_100472925
297 Ga0070662_100088757
298 Ga0070695_100133996
299 Ga0068859_100117840
300 Ga0068859_101436370
301 Ga0068861_100090643
302 Ga0068858_100174971
303 Ga0068862_100305059
304 Ga0081539_10000056
305 Ga0075365_10924384
306 Ga0075368_10118438
307 Ga0075363_100631717
308 Ga0075367_10026773
309 Ga0075367_10283413
310 Ga0075428_100007351
311 Ga0075428_100041846
312 Ga0075428_100258124
313 Ga0075430_100003385
314 Ga0075430_100022591
315 Ga0075431_100028074
316 Ga0075431_100209423
317 Ga0075431_100392449
318 Ga0075431_100522035
319 Ga0075433_10597489
320 Ga0075434_100993513
321 Ga0075429_100174678
322 Ga0097620_100117836
323 Ga0097620_101435723
324 Ga0075435_100843616
325 Ga0111539_10000073
326 Ga0111539_10007929
327 Ga0111539_10051756
328 Ga0111539_10058252
329 Ga0111539_10190199
330 Ga0111539_10292322
331 Ga0111539_10942573
332 Ga0111539_11400379
333 Ga0114129_10000475
334 Ga0114129_10001370
335 Ga0114129_11512285
336 Ga0157371_10006647
337 Ga0157380_10689334
338 Ga0157380_11132636
339 Ga0157376_10009782
340 Ga0207681_10605417
341 Ga0207659_10348029
342 Ga0207706_10346101
343 Ga0207670_10008985
344 Ga0207703_10149641
345 Ga0207708_10107006
346 Ga0207428_10010677
347 Ga0207428_10576042
348 Ga0265328_10160025
349 Ga0265331_10290271
350 Ga0265327_10021869
351 Ga0307513_10210669
352 Ga0307408_100003867
353 Ga0307410_10336383
354 Ga0307412_10582404
355 Ga0307409_100366530
356 Ga0307416_100012702
357 Ga0307416_100262724
358 Ga0307411_10319578
359 Ga0373946_0002673
360 Ga0373947_0022363
361 Ga0373925_0000645
362 Ga0439460_0111382
363 Ga0450916_005292
364 Ga0451576_0213893
365 Ga0495603_0033494
366 Ga0495629_0000199
367 Ga0495629_0135088
368 Ga0495641_0010913
369 Ga0495582_0003372
370 Ga0495639_0000268
371 Ga0495639_0002903
372 Ga0495663_0132618
373 Ga0495666_0000030
374 Ga0495642_0025207
375 Ga0495586_0000837
376 Ga0495621_0010989
377 Ga0495634_0004457
378 Ga0495635_0001808
379 Ga0495659_0024412
380 Ga0495657_0272457
381 Ga0495647_0010039
382 Ga0495658_0000022
383 Ga0495658_0023058
384 Ga0495613_0002334
385 Ga0495613_0111814
386 Ga0495581_0000097
387 Ga0495581_0018824
388 Ga0495581_0436477
389 Ga0495676_0001448
390 Ga0495680_0008400
391 Ga0495593_0032641
392 Ga0495614_0000392
393 Ga0501031_0317099
394 Ga0501032_0000090
395 Ga0501032_0277560
396 Ga0501034_0086354
397 Ga0501036_0006105
398 Ga0501036_0040916
399 Ga0501036_0430978
400 Ga0501036_0432309
401 Ga0501036_0668008
402 Ga0501036_0942314
403 Ga0501037_0109839
404 Ga0501038_0011533
405 Ga0501038_0225286
406 Ga0501038_0510926
407 Ga0501038_0631489
408 Ga0501039_0030605
409 Ga0501039_0101981
410 Ga0501039_0139269
411 Ga0501039_0267017
412 Ga0501039_0292219
413 Ga0501039_0506859
414 Ga0501039_0862805
415 Ga0501040_0003545
416 Ga0501040_0019841
417 Ga0501040_0043985
418 Ga0501040_0063429
419 Ga0501040_0206745
420 Ga0501041_0005061
421 Ga0501041_0031269
422 Ga0501041_0086391
423 Ga0501041_0298068
424 Ga0501041_0458858
425 Ga0501042_0093588
426 Ga0501042_0102887
427 Ga0501042_0115625
428 Ga0501042_0134645
429 Ga0501042_0157334
430 Ga0501042_0167886
431 Ga0501042_0180282
432 Ga0501042_0463306
433 Ga0501042_0657925
434 Ga0501043_0040450
435 Ga0501043_0386495
436 Ga0501046_0005586
437 Ga0501046_0472809
438 Ga0501046_0850779
439 Ga0501047_0825105
440 Ga0501048_0083050
441 Ga0501048_0161550
442 Ga0501048_0162794
443 Ga0501048_0183279
444 Ga0501048_0216096
445 Ga0501048_0603742
446 Ga0501048_0791060
447 Ga0501068_0302753
448 Ga0501068_0479494
449 Ga0501071_0069721
450 Ga0501071_0077558
451 Ga0501071_0101356
452 Ga0501071_0110765
453 Ga0501071_0482775
454 Ga0501071_0592108
455 Ga0501071_0789575
456 Ga0501072_0007459
457 Ga0501072_0088685
458 Ga0501072_0106882
459 Ga0501072_0279137
460 Ga0501072_0806204
461 Ga0501072_0820590
462 Ga0501073_0001725
463 Ga0501073_0363392
464 Ga0501074_0010803
465 Ga0501074_0077795
466 Ga0501074_0123910
467 Ga0501074_0203334
468 Ga0501074_0319924
469 Ga0501074_0373064
470 Ga0501074_0717276
471 Ga0501075_0004924
472 Ga0501075_0055923
473 Ga0501075_0077086
474 Ga0501075_0126672
475 Ga0501075_0149526
476 Ga0501075_0168263
477 Ga0501075_0442702
478 Ga0501075_0449241
479 Ga0501075_0626785
480 Ga0501075_1054725
481 Ga0501076_0000722
482 Ga0501076_0016890
483 Ga0501076_0037467
484 Ga0501076_0038360
485 Ga0501076_0041866
486 Ga0501076_0085876
487 Ga0501076_0131570
488 Ga0501076_0177771
489 Ga0501076_0304238
490 Ga0501076_0309964
491 Ga0501076_0398019
492 Ga0501076_0513870
493 Ga0501076_0678622
494 Ga0501076_1071745
495 Ga0501077_0009523
496 Ga0501077_0013851
497 Ga0501077_0187869
498 Ga0501079_0004654
499 Ga0501079_0031001
500 Ga0501079_0069668
501 Ga0501079_0107531
502 Ga0501079_0536650
503 Ga0501079_0687003
504 Ga0501080_0095836
505 Ga0501080_0131029
506 Ga0501080_0427847
507 Ga0501080_0438658
508 Ga0501080_0612974
509 Ga0501080_0881849
510 Ga0501081_0000459
511 Ga0501081_0002516
512 Ga0501081_0040588
513 Ga0501081_0075987
514 Ga0501081_0087189
515 Ga0501081_0171928
516 Ga0501081_0184448
517 Ga0501081_0212516
518 Ga0501081_0366621
519 Ga0501083_0087360
520 Ga0501083_0143583
521 Ga0501083_0200690
522 Ga0501083_0334303
523 Ga0501035_0162726
524 Ga0501035_0252250
525 Ga0501035_0683766
526 Ga0501045_0020869
527 Ga0501045_0021718
528 Ga0501045_0064349
529 Ga0501045_0084825
530 Ga0501045_0471466
531 Ga0501045_0657104
532 nmdc:mga0yw44_849857_c1
533 nmdc:mga05p37_108731_c1
534 nmdc:mga05p37_27_c1
535 nmdc:mga09592_91428_c1
536 nmdc:mga0qj67_22826_c1
537 nmdc:mga0qj67_596_c1
538 nmdc:mga0qj67_74252_c1
539 nmdc:mga06r32_145425_c1
540 nmdc:mga06r32_157512_c1
541 nmdc:mga06r32_165125_c1
542 nmdc:mga06r32_168205_c1
543 nmdc:mga08y16_1225611_c1
544 nmdc:mga08y16_19411_c1
545 nmdc:mga08y16_231433_c1
546 nmdc:mga08y16_32466_c1
547 nmdc:mga08y16_333094_c1
548 nmdc:mga08y16_79220_c1
549 nmdc:mga08y16_940253_c1
550 nmdc:mga0n895_1162306_c1
551 nmdc:mga0rr50_741310_c1
552 nmdc:mga0a205_533550_c1
553 Ga0495619_0001562
554 Ga0500646_0019786
555 Ga0500652_338953
556 Ga0501084_0020181
557 Ga0501084_0037537
558 Ga0501084_0239624
559 Ga0501084_0276928
560 Ga0501084_0535930
561 Ga0501084_0735161
562 Ga0501082_0008077
563 Ga0501082_0050620
564 Ga0501082_0180550
565 Ga0501082_0207850
566 Ga0501082_0220548
567 Ga0501082_0228740
568 Ga0501082_0239279
569 Ga0501082_0362514
570 Ga0501082_0662169
571 Ga0530510_0000967
572 Ga0530510_0079182
573 Ga0530510_0085148
574 Ga0530510_0530873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

5

187

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7965 7 187
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7933 5 187
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7692 7 187
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7626 5 187
6amk-assembly1.cif.gz_B structure of streptomyces venezuelae bldc-whii opt complex 0.4293 129 184
ID Description Score Start End Superfamily
af_P32191_499_647_1.10.8.870 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Alpha-glycerophosphate oxidase, cap domain 0.5083 133 160 1.10.8.870
af_Q9W4L4_2_67_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4987 99 159 1.10.10.10
af_P9WID3_12_317_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.4736 133 182 3.40.1190.20
af_O06585_321_417_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.4466 88 188 1.10.1200.10
af_A1Z935_209_282_3.90.530.10 Alpha Beta;Alpha-Beta Complex;Nucleotide Excision Repair Protein XPA (XPA-MBD); B Chain A;XPA C-terminal domain 0.44 130 190 3.90.530.10
ID Description Score Start End GO Terms
AF-A0A3Q9K6A7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9579 80 187 GO:0005524
GO:0005886
GO:0008556
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9515 115 185 GO:0005524
GO:0005886
GO:0008556
AF-A0A5D0VZ49-F1-model_v4 Potassium-transporting ATPase subunit C 0.9514 56 187 GO:0005524
GO:0005886
GO:0008556
AF-A0A1N7DLN9-F1-model_v4 K+-transporting ATPase ATPase C chain 0.9512 115 187 GO:0005524
GO:0005886
GO:0008556
AF-A0A7K2VFX8-F1-model_v4 Potassium-transporting ATPase subunit C 0.951 110 187 GO:0005524
GO:0005886
GO:0008556

Map