F387932
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 287 | 187 | 287 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10088412|Ga0081455_100884122 |
| Length | 299 |
| Sequence | VSATPVTPVAPLQEVKGPSALGGGSRRFFDLLWLISVTEFKRVYFGTVLGYLWSLIRPLLLFGVLLLVFTQVFRVGSEKVEHYPVFLLMGIVLYTFFSESTSNAVTSVVSQEGVVRKTQFPRAVIPLATTITAAFNLTPTWTWLLFPVCLLFLFIGAAGTSMALSALYVRYRDTAIIWVVAAQVLLYLTPILYPVNALGEETKERLLMVNPLSVIFEQVRVWVLHEPAAPTAVDAAGGWLGLLPAAVIFFGVIGGAMTFGLVGVFLGPTLLAVVYKLIQDWLVTTPKMVSSPTEPPLKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 101 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 102 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 103 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 134 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 137 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 138 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 143 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 144 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 145 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 146 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 147 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 148 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 149 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 150 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 178 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 179 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 185 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 186 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 187 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 8.71 |
| Rhizosphere | 83.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000332 | 3300001977 | Bacteria | 6796 |
| 2 | JGI24748J21848_1000531 | 3300002074 | Bacteria | 4158 |
| 3 | JGI24034J26672_10000095 | 3300002239 | Bacteria | 15947 |
| 4 | JGI24742J22300_10001109 | 3300002244 | Bacteria | 4171 |
| 5 | JGI25406J46586_10035388 | 3300003203 | Bacteria | 1823 |
| 6 | rootH2_10031028 | 3300003320 | Bacteria | 2218 |
| 7 | Ga0070670_100024099 | 3300005331 | Bacteria | 5235 |
| 8 | Ga0070666_10022667 | 3300005335 | Bacteria | 4080 |
| 9 | Ga0070682_100000040 | 3300005337 | Bacteria | 143944 |
| 10 | Ga0070682_100158927 | 3300005337 | Bacteria | 1559 |
| 11 | Ga0070691_10007663 | 3300005341 | Bacteria | 4948 |
| 12 | Ga0070661_100234541 | 3300005344 | Bacteria | 1411 |
| 13 | Ga0070692_10051239 | 3300005345 | Bacteria | 2146 |
| 14 | Ga0070668_100002688 | 3300005347 | Bacteria | 13077 |
| 15 | Ga0070674_100000016 | 3300005356 | Bacteria | 91058 |
| 16 | Ga0070688_100000151 | 3300005365 | Bacteria | 37674 |
| 17 | Ga0070688_100000258 | 3300005365 | Bacteria | 27791 |
| 18 | Ga0070659_100113577 | 3300005366 | Bacteria | 2188 |
| 19 | Ga0070659_100160135 | 3300005366 | Bacteria | 1840 |
| 20 | Ga0070667_100005305 | 3300005367 | Bacteria | 10770 |
| 21 | Ga0070713_100000055 | 3300005436 | Bacteria | 70759 |
| 22 | Ga0070713_100026581 | 3300005436 | Bacteria | 4546 |
| 23 | Ga0070711_100056755 | 3300005439 | Bacteria | 2709 |
| 24 | Ga0070663_100000101 | 3300005455 | Bacteria | 39196 |
| 25 | Ga0070663_100078316 | 3300005455 | Bacteria | 2423 |
| 26 | Ga0070678_100000713 | 3300005456 | Bacteria | 16488 |
| 27 | Ga0068867_100261836 | 3300005459 | Unclassified | 1410 |
| 28 | Ga0070685_10000092 | 3300005466 | Bacteria | 55484 |
| 29 | Ga0070685_10000360 | 3300005466 | Bacteria | 27792 |
| 30 | Ga0070679_100000784 | 3300005530 | Bacteria | 27643 |
| 31 | Ga0070684_100032648 | 3300005535 | Bacteria | 4438 |
| 32 | Ga0070693_100215911 | 3300005547 | Bacteria | 1254 |
| 33 | Ga0070665_100029059 | 3300005548 | Bacteria | 5565 |
| 34 | Ga0070665_100036005 | 3300005548 | Bacteria | 4980 |
| 35 | Ga0070664_100085313 | 3300005564 | Bacteria | 2727 |
| 36 | Ga0070664_100171154 | 3300005564 | Bacteria | 1927 |
| 37 | Ga0068857_100129875 | 3300005577 | Bacteria | 2272 |
| 38 | Ga0068854_100000123 | 3300005578 | Bacteria | 53446 |
| 39 | Ga0068856_100001659 | 3300005614 | Bacteria | 23332 |
| 40 | Ga0068856_100003489 | 3300005614 | Bacteria | 15873 |
| 41 | Ga0068856_100149261 | 3300005614 | Unclassified | 2346 |
| 42 | Ga0068856_100340849 | 3300005614 | Bacteria | 1517 |
| 43 | Ga0070702_100280830 | 3300005615 | Unclassified | 1143 |
| 44 | Ga0068852_100000195 | 3300005616 | Bacteria | 41405 |
| 45 | Ga0068852_100262446 | 3300005616 | Bacteria | 1659 |
| 46 | Ga0068864_100000035 | 3300005618 | Bacteria | 195218 |
| 47 | Ga0068851_10000138 | 3300005834 | Bacteria | 39261 |
| 48 | Ga0068851_10063315 | 3300005834 | Bacteria | 1899 |
| 49 | Ga0068858_100003595 | 3300005842 | Bacteria | 15344 |
| 50 | Ga0068858_100139515 | 3300005842 | Bacteria | 2275 |
| 51 | Ga0068858_100533006 | 3300005842 | Unclassified | 1136 |
| 52 | Ga0068860_100055333 | 3300005843 | Bacteria | 3772 |
| 53 | Ga0068862_100002457 | 3300005844 | Bacteria | 16420 |
| 54 | Ga0081455_10005106 | 3300005937 | Bacteria | 14474 |
| 55 | Ga0081455_10054809 | 3300005937 | Bacteria | 3396 |
| 56 | Ga0081455_10067763 | 3300005937 | Bacteria | 2973 |
| 57 | Ga0081455_10088412 | 3300005937 | Bacteria | 2517 |
| 58 | Ga0081538_10003063 | 3300005981 | Bacteria | 15925 |
| 59 | Ga0081538_10016023 | 3300005981 | Bacteria | 5768 |
| 60 | Ga0081540_1000419 | 3300005983 | Bacteria | 41957 |
| 61 | Ga0081539_10000615 | 3300005985 | Bacteria | 72134 |
| 62 | Ga0070712_100000142 | 3300006175 | Bacteria | 37397 |
| 63 | Ga0097621_100426589 | 3300006237 | Unclassified | 1191 |
| 64 | Ga0068865_100000009 | 3300006881 | Bacteria | 168291 |
| 65 | Ga0111539_10653688 | 3300009094 | Unclassified | 1224 |
| 66 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 67 | Ga0105245_10192803 | 3300009098 | Bacteria | 1953 |
| 68 | Ga0105245_10262350 | 3300009098 | Unclassified | 1682 |
| 69 | Ga0105247_10000110 | 3300009101 | Bacteria | 83499 |
| 70 | Ga0105247_10111326 | 3300009101 | Bacteria | 1763 |
| 71 | Ga0105247_10124398 | 3300009101 | Bacteria | 1674 |
| 72 | Ga0105241_10176536 | 3300009174 | Bacteria | 1769 |
| 73 | Ga0105242_10000010 | 3300009176 | Bacteria | 151649 |
| 74 | Ga0105242_10007661 | 3300009176 | Bacteria | 8309 |
| 75 | Ga0105242_10125683 | 3300009176 | Bacteria | 2207 |
| 76 | Ga0105248_10000307 | 3300009177 | Bacteria | 58221 |
| 77 | Ga0105238_10469443 | 3300009551 | Bacteria | 1257 |
| 78 | Ga0105249_10003023 | 3300009553 | Bacteria | 14514 |
| 79 | Ga0157371_10006368 | 3300013102 | Bacteria | 9763 |
| 80 | Ga0157370_10007054 | 3300013104 | Bacteria | 12266 |
| 81 | Ga0157370_10020731 | 3300013104 | Bacteria | 6559 |
| 82 | Ga0157369_10000222 | 3300013105 | Bacteria | 78413 |
| 83 | Ga0157374_10045649 | 3300013296 | Bacteria | 4055 |
| 84 | Ga0157374_10635469 | 3300013296 | Bacteria | 1079 |
| 85 | Ga0157378_10133703 | 3300013297 | Bacteria | 2298 |
| 86 | Ga0157378_10188411 | 3300013297 | Unclassified | 1944 |
| 87 | Ga0163162_10052178 | 3300013306 | Bacteria | 4107 |
| 88 | Ga0163162_10616904 | 3300013306 | Unclassified | 1210 |
| 89 | Ga0157372_10000150 | 3300013307 | Bacteria | 75963 |
| 90 | Ga0157375_10004632 | 3300013308 | Bacteria | 11949 |
| 91 | Ga0157380_10000096 | 3300014326 | Bacteria | 48405 |
| 92 | Ga0163161_10053118 | 3300017792 | Bacteria | 2938 |
| 93 | Ga0163161_10222571 | 3300017792 | Unclassified | 1462 |
| 94 | Ga0206356_10903912 | 3300020070 | Bacteria | 2204 |
| 95 | Ga0207656_10003856 | 3300025321 | Bacteria | 5199 |
| 96 | Ga0207656_10043822 | 3300025321 | Bacteria | 1909 |
| 97 | Ga0207710_10000138 | 3300025900 | Bacteria | 83652 |
| 98 | Ga0207710_10063300 | 3300025900 | Bacteria | 1683 |
| 99 | Ga0207680_10002641 | 3300025903 | Bacteria | 8377 |
| 100 | Ga0207693_10002124 | 3300025915 | Bacteria | 17299 |
| 101 | Ga0207663_10014855 | 3300025916 | Bacteria | 4279 |
| 102 | Ga0207649_10117782 | 3300025920 | Bacteria | 1786 |
| 103 | Ga0207652_10000303 | 3300025921 | Bacteria | 50549 |
| 104 | Ga0207694_10448459 | 3300025924 | Unclassified | 1077 |
| 105 | Ga0207650_10052602 | 3300025925 | Bacteria | 3017 |
| 106 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 107 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 108 | Ga0207700_10073287 | 3300025928 | Bacteria | 2644 |
| 109 | Ga0207690_10028794 | 3300025932 | Bacteria | 3524 |
| 110 | Ga0207686_10000107 | 3300025934 | Bacteria | 67766 |
| 111 | Ga0207686_10001420 | 3300025934 | Bacteria | 13574 |
| 112 | Ga0207686_10015440 | 3300025934 | Bacteria | 4270 |
| 113 | Ga0207669_10000037 | 3300025937 | Bacteria | 77494 |
| 114 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 115 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 116 | Ga0207679_10103565 | 3300025945 | Bacteria | 2231 |
| 117 | Ga0207679_10279355 | 3300025945 | Unclassified | 1431 |
| 118 | Ga0207712_10004536 | 3300025961 | Bacteria | 8766 |
| 119 | Ga0207668_10002906 | 3300025972 | Bacteria | 10052 |
| 120 | Ga0207640_10000040 | 3300025981 | Bacteria | 106134 |
| 121 | Ga0207658_10024437 | 3300025986 | Bacteria | 4228 |
| 122 | Ga0207658_10080755 | 3300025986 | Bacteria | 2491 |
| 123 | Ga0207703_10000028 | 3300026035 | Bacteria | 208682 |
| 124 | Ga0207703_10028153 | 3300026035 | Bacteria | 4427 |
| 125 | Ga0207678_10000174 | 3300026067 | Bacteria | 54529 |
| 126 | Ga0207678_10107052 | 3300026067 | Bacteria | 2385 |
| 127 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 128 | Ga0207702_10006973 | 3300026078 | Bacteria | 9671 |
| 129 | Ga0207702_10056878 | 3300026078 | Bacteria | 3322 |
| 130 | Ga0207702_10278298 | 3300026078 | Unclassified | 1581 |
| 131 | Ga0207702_10401591 | 3300026078 | Bacteria | 1322 |
| 132 | Ga0207648_10201299 | 3300026089 | Bacteria | 1766 |
| 133 | Ga0207676_10000026 | 3300026095 | Bacteria | 248593 |
| 134 | Ga0207674_10133380 | 3300026116 | Bacteria | 2446 |
| 135 | Ga0207683_10002711 | 3300026121 | Bacteria | 15470 |
| 136 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 137 | Ga0268266_10001090 | 3300028379 | Bacteria | 34068 |
| 138 | Ga0268266_10009287 | 3300028379 | Bacteria | 8675 |
| 139 | Ga0268266_10456486 | 3300028379 | Bacteria | 1215 |
| 140 | Ga0268265_10005289 | 3300028380 | Bacteria | 8840 |
| 141 | Ga0268264_10052744 | 3300028381 | Bacteria | 3391 |
| 142 | Ga0265319_1000227 | 3300028563 | Bacteria | 42176 |
| 143 | Ga0265338_10000383 | 3300028800 | Bacteria | 79248 |
| 144 | Ga0373937_0237333 | 3300036401 | Bacteria | 1717 |
| 145 | Ga0451807_2346686 | 3300041486 | Bacteria | 1563 |
| 146 | Ga0466963_0006324 | 3300044694 | Bacteria | 7003 |
| 147 | Ga0466963_0067706 | 3300044694 | Bacteria | 2397 |
| 148 | Ga0466957_0131630 | 3300044842 | Bacteria | 1603 |
| 149 | Ga0495592_0167592 | 3300046454 | Unclassified | 1506 |
| 150 | Ga0495603_0000022 | 3300046455 | Bacteria | 64108 |
| 151 | Ga0495603_0000825 | 3300046455 | Bacteria | 17802 |
| 152 | Ga0495629_0001233 | 3300046459 | Bacteria | 20100 |
| 153 | Ga0495653_0315803 | 3300046463 | Bacteria | 1014 |
| 154 | Ga0495662_0010679 | 3300046476 | Bacteria | 4492 |
| 155 | Ga0495606_0000219 | 3300046507 | Bacteria | 101614 |
| 156 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 157 | Ga0495628_0002027 | 3300046516 | Bacteria | 18361 |
| 158 | Ga0495628_0003567 | 3300046516 | Bacteria | 13932 |
| 159 | Ga0495628_0039415 | 3300046516 | Bacteria | 3779 |
| 160 | Ga0495628_0041799 | 3300046516 | Bacteria | 3659 |
| 161 | Ga0495628_0134374 | 3300046516 | Bacteria | 1891 |
| 162 | Ga0495630_0000115 | 3300046517 | Bacteria | 63124 |
| 163 | Ga0495630_0000141 | 3300046517 | Bacteria | 55652 |
| 164 | Ga0495652_0007748 | 3300046529 | Bacteria | 9875 |
| 165 | Ga0495640_0001957 | 3300046533 | Bacteria | 16433 |
| 166 | Ga0495656_0000195 | 3300046615 | Bacteria | 21694 |
| 167 | Ga0495634_0030157 | 3300046642 | Bacteria | 3748 |
| 168 | Ga0495634_0040454 | 3300046642 | Bacteria | 3171 |
| 169 | Ga0495625_0000154 | 3300046660 | Bacteria | 105083 |
| 170 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 171 | Ga0495657_0058477 | 3300046675 | Unclassified | 2560 |
| 172 | Ga0495599_0123075 | 3300046678 | Bacteria | 1612 |
| 173 | Ga0495647_0000492 | 3300046681 | Bacteria | 11492 |
| 174 | Ga0495658_0005468 | 3300046683 | Bacteria | 6247 |
| 175 | Ga0495613_0000175 | 3300046689 | Bacteria | 62391 |
| 176 | Ga0495624_0000149 | 3300046690 | Bacteria | 51112 |
| 177 | Ga0495600_0013630 | 3300046809 | Bacteria | 5114 |
| 178 | Ga0495604_0002829 | 3300047317 | Bacteria | 13928 |
| 179 | Ga0495676_0002845 | 3300047321 | Bacteria | 15595 |
| 180 | Ga0495676_0081128 | 3300047321 | Bacteria | 2460 |
| 181 | Ga0495680_0040706 | 3300047322 | Bacteria | 3701 |
| 182 | Ga0495680_0346798 | 3300047322 | Bacteria | 1034 |
| 183 | Ga0495675_0000104 | 3300047444 | Bacteria | 60748 |
| 184 | Ga0495675_0044576 | 3300047444 | Bacteria | 2825 |
| 185 | Ga0495593_0019252 | 3300047673 | Bacteria | 3828 |
| 186 | Ga0495602_0000063 | 3300048088 | Bacteria | 104915 |
| 187 | Ga0496102_0208459 | 3300048905 | Bacteria | 1843 |
| 188 | Ga0496103_0013192 | 3300048906 | Bacteria | 4899 |
| 189 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 190 | Ga0496104_0000243 | 3300048907 | Bacteria | 48237 |
| 191 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 192 | Ga0496105_0000622 | 3300048908 | Bacteria | 23722 |
| 193 | Ga0496105_0006026 | 3300048908 | Bacteria | 9268 |
| 194 | Ga0496105_0178366 | 3300048908 | Bacteria | 1740 |
| 195 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 196 | Ga0496108_0000492 | 3300048911 | Bacteria | 31518 |
| 197 | Ga0496108_0067813 | 3300048911 | Bacteria | 3009 |
| 198 | Ga0496109_0000057 | 3300048912 | Bacteria | 120274 |
| 199 | Ga0496109_0000058 | 3300048912 | Bacteria | 118556 |
| 200 | Ga0496109_0305752 | 3300048912 | Unclassified | 1500 |
| 201 | Ga0496110_0000170 | 3300048913 | Bacteria | 39947 |
| 202 | Ga0496110_0035303 | 3300048913 | Bacteria | 4337 |
| 203 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 204 | Ga0496111_0010953 | 3300048914 | Bacteria | 6101 |
| 205 | Ga0496112_0006122 | 3300048915 | Bacteria | 10518 |
| 206 | Ga0496113_0000010 | 3300048916 | Bacteria | 86561 |
| 207 | Ga0496114_0000080 | 3300048917 | Bacteria | 68701 |
| 208 | Ga0496114_0077464 | 3300048917 | Bacteria | 2803 |
| 209 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 210 | Ga0496115_0000104 | 3300048918 | Bacteria | 79824 |
| 211 | Ga0496116_0000500 | 3300048919 | Bacteria | 53809 |
| 212 | Ga0496117_0001638 | 3300048920 | Bacteria | 31520 |
| 213 | Ga0496118_0001976 | 3300048921 | Bacteria | 29112 |
| 214 | Ga0496119_0001539 | 3300048922 | Bacteria | 27538 |
| 215 | Ga0496119_0011330 | 3300048922 | Bacteria | 7403 |
| 216 | Ga0496119_0018675 | 3300048922 | Bacteria | 5146 |
| 217 | Ga0496119_0034914 | 3300048922 | Bacteria | 3302 |
| 218 | Ga0496119_0077875 | 3300048922 | Bacteria | 1919 |
| 219 | Ga0496120_0000528 | 3300048923 | Bacteria | 59001 |
| 220 | Ga0496121_0049557 | 3300048924 | Bacteria | 3560 |
| 221 | Ga0496125_0035474 | 3300048928 | Bacteria | 4373 |
| 222 | Ga0496126_0005533 | 3300048929 | Bacteria | 14380 |
| 223 | Ga0496126_0005630 | 3300048929 | Bacteria | 14246 |
| 224 | Ga0496126_0006214 | 3300048929 | Bacteria | 13364 |
| 225 | Ga0496126_0067672 | 3300048929 | Bacteria | 3191 |
| 226 | Ga0496126_0325218 | 3300048929 | Bacteria | 1263 |
| 227 | Ga0501031_0000326 | 3300049568 | Bacteria | 27423 |
| 228 | Ga0501032_0000701 | 3300049569 | Bacteria | 27295 |
| 229 | Ga0501033_0000890 | 3300049570 | Bacteria | 27318 |
| 230 | Ga0501034_0003994 | 3300049571 | Bacteria | 16563 |
| 231 | Ga0501034_0004977 | 3300049571 | Bacteria | 14620 |
| 232 | Ga0501036_0000131 | 3300049572 | Bacteria | 48019 |
| 233 | Ga0501037_0000621 | 3300049573 | Bacteria | 27506 |
| 234 | Ga0501038_0000835 | 3300049574 | Bacteria | 27413 |
| 235 | Ga0501039_0053002 | 3300049575 | Bacteria | 3139 |
| 236 | Ga0501040_0125048 | 3300049576 | Bacteria | 1806 |
| 237 | Ga0501042_0480935 | 3300049578 | Bacteria | 901 |
| 238 | Ga0501043_0000841 | 3300049579 | Bacteria | 27283 |
| 239 | Ga0501046_0001019 | 3300049580 | Bacteria | 27339 |
| 240 | Ga0501047_0000177 | 3300049581 | Bacteria | 78448 |
| 241 | Ga0501047_0001093 | 3300049581 | Bacteria | 26985 |
| 242 | Ga0501048_0000094 | 3300049582 | Bacteria | 48036 |
| 243 | Ga0501067_0132357 | 3300049583 | Bacteria | 1388 |
| 244 | Ga0501069_0000132 | 3300049585 | Bacteria | 32575 |
| 245 | Ga0501070_0000184 | 3300049586 | Bacteria | 58715 |
| 246 | Ga0501070_0003280 | 3300049586 | Bacteria | 14043 |
| 247 | Ga0501070_0084556 | 3300049586 | Bacteria | 2627 |
| 248 | Ga0501071_0020509 | 3300049587 | Bacteria | 4594 |
| 249 | Ga0501072_0154300 | 3300049588 | Bacteria | 1831 |
| 250 | Ga0501072_0547066 | 3300049588 | Unclassified | 914 |
| 251 | Ga0501073_0004127 | 3300049589 | Bacteria | 10904 |
| 252 | Ga0501074_0024004 | 3300049590 | Bacteria | 4431 |
| 253 | Ga0501074_0026778 | 3300049590 | Bacteria | 4181 |
| 254 | Ga0501076_0055331 | 3300049592 | Bacteria | 3147 |
| 255 | Ga0501076_0464826 | 3300049592 | Bacteria | 1042 |
| 256 | Ga0501080_0005156 | 3300049742 | Bacteria | 11635 |
| 257 | Ga0501080_0118327 | 3300049742 | Bacteria | 2456 |
| 258 | Ga0501083_0000414 | 3300049744 | Bacteria | 27277 |
| 259 | Ga0501083_0001778 | 3300049744 | Bacteria | 14725 |
| 260 | Ga0501083_0063806 | 3300049744 | Bacteria | 2456 |
| 261 | Ga0501035_0000246 | 3300049822 | Bacteria | 65227 |
| 262 | Ga0501044_0003897 | 3300049823 | Bacteria | 16720 |
| 263 | Ga0501044_0004276 | 3300049823 | Bacteria | 16022 |
| 264 | Ga0501044_0411810 | 3300049823 | Unclassified | 1263 |
| 265 | Ga0501045_0330891 | 3300049824 | Bacteria | 1134 |
| 266 | nmdc:mga00v17_129796_c1 | 3300050491 | Bacteria | 1610 |
| 267 | nmdc:mga0yw44_129860_c1 | 3300050492 | Bacteria | 1630 |
| 268 | Ga0495601_0000041 | 3300053077 | Bacteria | 79353 |
| 269 | Ga0495601_0005254 | 3300053077 | Bacteria | 7537 |
| 270 | Ga0495601_0111984 | 3300053077 | Unclassified | 1768 |
| 271 | Ga0495612_0007952 | 3300053078 | Bacteria | 4321 |
| 272 | Ga0495612_0044949 | 3300053078 | Bacteria | 1808 |
| 273 | Ga0495655_0000012 | 3300053083 | Bacteria | 92485 |
| 274 | Ga0495655_0000710 | 3300053083 | Bacteria | 5329 |
| 275 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 276 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 277 | Ga0495619_0000041 | 3300053085 | Bacteria | 112824 |
| 278 | Ga0495619_0000094 | 3300053085 | Bacteria | 67416 |
| 279 | Ga0495619_0000745 | 3300053085 | Bacteria | 21209 |
| 280 | Ga0495619_0007231 | 3300053085 | Bacteria | 7033 |
| 281 | Ga0495619_0054315 | 3300053085 | Bacteria | 2651 |
| 282 | Ga0495619_0077628 | 3300053085 | Bacteria | 2231 |
| 283 | Ga0495619_0119190 | 3300053085 | Unclassified | 1809 |
| 284 | Ga0500566_0004132 | 3300053094 | Bacteria | 8660 |
| 285 | Ga0500641_0002411 | 3300053096 | Bacteria | 6634 |
| 286 | Ga0500628_000014 | 3300053129 | Bacteria | 102838 |
| 287 | Ga0501082_0005208 | 3300060353 | Bacteria | 11305 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049578 | Ga0501042_0480935 | Ga0501042_0480935_10_753 | 222 |
| 2 | 3300048922 | Ga0496119_0034914 | Ga0496119_0034914_215_1117 | 231 |
| 3 | 3300048923 | Ga0496120_0000528 | Ga0496120_0000528_27784_28686 | 231 |
| 4 | 3300046459 | Ga0495629_0001233 | Ga0495629_0001233_19114_19971 | 232 |
| 5 | 3300048908 | Ga0496105_0006026 | Ga0496105_0006026_5022_5873 | 232 |
| 6 | 3300048917 | Ga0496114_0077464 | Ga0496114_0077464_314_1198 | 232 |
| 7 | 3300048918 | Ga0496115_0000004 | Ga0496115_0000004_116584_117468 | 232 |
| 8 | 3300053094 | Ga0500566_0004132 | Ga0500566_0004132_2399_3256 | 232 |
| 9 | 3300005436 | Ga0070713_100026581 | Ga0070713_1000265812 | 233 |
| 10 | 3300025928 | Ga0207700_10073287 | Ga0207700_100732872 | 233 |
| 11 | 3300046476 | Ga0495662_0010679 | Ga0495662_0010679_3505_4356 | 233 |
| 12 | 3300048929 | Ga0496126_0325218 | Ga0496126_0325218_165_1040 | 233 |
| 13 | 3300005439 | Ga0070711_100056755 | Ga0070711_1000567552 | 234 |
| 14 | 3300009176 | Ga0105242_10007661 | Ga0105242_100076613 | 235 |
| 15 | 3300009176 | Ga0105242_10125683 | Ga0105242_101256832 | 235 |
| 16 | 3300025934 | Ga0207686_10001420 | Ga0207686_100014206 | 235 |
| 17 | 3300005347 | Ga0070668_100002688 | Ga0070668_1000026884 | 238 |
| 18 | 3300005367 | Ga0070667_100005305 | Ga0070667_1000053051 | 238 |
| 19 | 3300005842 | Ga0068858_100139515 | Ga0068858_1001395152 | 238 |
| 20 | 3300005843 | Ga0068860_100055333 | Ga0068860_1000553333 | 238 |
| 21 | 3300005844 | Ga0068862_100002457 | Ga0068862_10000245710 | 238 |
| 22 | 3300009553 | Ga0105249_10003023 | Ga0105249_1000302311 | 238 |
| 23 | 3300013306 | Ga0163162_10052178 | Ga0163162_100521781 | 238 |
| 24 | 3300025961 | Ga0207712_10004536 | Ga0207712_100045364 | 238 |
| 25 | 3300025972 | Ga0207668_10002906 | Ga0207668_100029068 | 238 |
| 26 | 3300025986 | Ga0207658_10080755 | Ga0207658_100807552 | 238 |
| 27 | 3300026035 | Ga0207703_10028153 | Ga0207703_100281533 | 238 |
| 28 | 3300028380 | Ga0268265_10005289 | Ga0268265_100052894 | 238 |
| 29 | 3300028381 | Ga0268264_10052744 | Ga0268264_100527443 | 238 |
| 30 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_333596_334447 | 238 |
| 31 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_334276_335127 | 238 |
| 32 | 3300047444 | Ga0495675_0000104 | Ga0495675_0000104_16782_17633 | 238 |
| 33 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_270276_271151 | 238 |
| 34 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_1057028_1057903 | 238 |
| 35 | 3300048922 | Ga0496119_0018675 | Ga0496119_0018675_2979_3854 | 238 |
| 36 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_76832_77683 | 238 |
| 37 | 3300053085 | Ga0495619_0000094 | Ga0495619_0000094_23501_24352 | 238 |
| 38 | 3300013296 | Ga0157374_10045649 | Ga0157374_100456493 | 239 |
| 39 | 3300013297 | Ga0157378_10133703 | Ga0157378_101337032 | 239 |
| 40 | 3300048924 | Ga0496121_0049557 | Ga0496121_0049557_456_1331 | 239 |
| 41 | 3300049586 | Ga0501070_0003280 | Ga0501070_0003280_1977_2858 | 239 |
| 42 | 3300005564 | Ga0070664_100085313 | Ga0070664_1000853132 | 240 |
| 43 | 3300025945 | Ga0207679_10103565 | Ga0207679_101035652 | 240 |
| 44 | 3300053096 | Ga0500641_0002411 | Ga0500641_0002411_2986_3849 | 241 |
| 45 | 3300046455 | Ga0495603_0000022 | Ga0495603_0000022_23101_23958 | 242 |
| 46 | 3300046517 | Ga0495630_0000115 | Ga0495630_0000115_42478_43341 | 242 |
| 47 | 3300005356 | Ga0070674_100000016 | Ga0070674_10000001681 | 243 |
| 48 | 3300005614 | Ga0068856_100003489 | Ga0068856_10000348910 | 243 |
| 49 | 3300005937 | Ga0081455_10067763 | Ga0081455_100677632 | 243 |
| 50 | 3300005981 | Ga0081538_10016023 | Ga0081538_100160233 | 243 |
| 51 | 3300025916 | Ga0207663_10014855 | Ga0207663_100148552 | 243 |
| 52 | 3300025934 | Ga0207686_10015440 | Ga0207686_100154402 | 243 |
| 53 | 3300025937 | Ga0207669_10000037 | Ga0207669_100000379 | 243 |
| 54 | 3300026078 | Ga0207702_10006973 | Ga0207702_100069733 | 243 |
| 55 | 3300044694 | Ga0466963_0067706 | Ga0466963_0067706_316_1179 | 243 |
| 56 | 3300046455 | Ga0495603_0000825 | Ga0495603_0000825_519_1364 | 243 |
| 57 | 3300046517 | Ga0495630_0000141 | Ga0495630_0000141_39048_39899 | 243 |
| 58 | 3300046675 | Ga0495657_0058477 | Ga0495657_0058477_1370_2221 | 243 |
| 59 | 3300047321 | Ga0495676_0081128 | Ga0495676_0081128_356_1207 | 243 |
| 60 | 3300053085 | Ga0495619_0119190 | Ga0495619_0119190_599_1450 | 243 |
| 61 | 3300005365 | Ga0070688_100000151 | Ga0070688_10000015135 | 245 |
| 62 | 3300005466 | Ga0070685_10000360 | Ga0070685_100003604 | 245 |
| 63 | 3300053078 | Ga0495612_0044949 | Ga0495612_0044949_274_1140 | 245 |
| 64 | 3300005548 | Ga0070665_100036005 | Ga0070665_1000360055 | 246 |
| 65 | 3300005345 | Ga0070692_10051239 | Ga0070692_100512392 | 248 |
| 66 | 3300005365 | Ga0070688_100000258 | Ga0070688_10000025823 | 248 |
| 67 | 3300005466 | Ga0070685_10000092 | Ga0070685_1000009231 | 248 |
| 68 | 3300050492 | nmdc:mga0yw44_129860_c1 | nmdc:mga0yw44_129860_c1_381_1238 | 248 |
| 69 | 3300046463 | Ga0495653_0315803 | Ga0495653_0315803_90_986 | 249 |
| 70 | 3300047673 | Ga0495593_0019252 | Ga0495593_0019252_1384_2244 | 250 |
| 71 | 3300005614 | Ga0068856_100149261 | Ga0068856_1001492613 | 251 |
| 72 | 3300026078 | Ga0207702_10056878 | Ga0207702_100568783 | 251 |
| 73 | 3300046660 | Ga0495625_0000154 | Ga0495625_0000154_75358_76224 | 251 |
| 74 | 3300009098 | Ga0105245_10000012 | Ga0105245_10000012197 | 252 |
| 75 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011251 | 252 |
| 76 | 3300009094 | Ga0111539_10653688 | Ga0111539_106536881 | 253 |
| 77 | 3300013105 | Ga0157369_10000222 | Ga0157369_100002229 | 253 |
| 78 | 3300044694 | Ga0466963_0006324 | Ga0466963_0006324_1356_2204 | 254 |
| 79 | 3300048929 | Ga0496126_0006214 | Ga0496126_0006214_10775_11635 | 254 |
| 80 | 3300005616 | Ga0068852_100000195 | Ga0068852_10000019520 | 255 |
| 81 | 3300009177 | Ga0105248_10000307 | Ga0105248_1000030732 | 255 |
| 82 | 3300013297 | Ga0157378_10188411 | Ga0157378_101884112 | 255 |
| 83 | 3300013308 | Ga0157375_10004632 | Ga0157375_100046324 | 255 |
| 84 | 3300025941 | Ga0207711_10000024 | Ga0207711_1000002414 | 255 |
| 85 | 3300026142 | Ga0207698_10000009 | Ga0207698_10000009148 | 255 |
| 86 | 3300048922 | Ga0496119_0077875 | Ga0496119_0077875_610_1476 | 255 |
| 87 | 3300006175 | Ga0070712_100000142 | Ga0070712_10000014220 | 257 |
| 88 | 3300025915 | Ga0207693_10002124 | Ga0207693_1000212420 | 257 |
| 89 | 3300028563 | Ga0265319_1000227 | Ga0265319_10002273 | 257 |
| 90 | 3300028800 | Ga0265338_10000383 | Ga0265338_1000038335 | 257 |
| 91 | 3300053083 | Ga0495655_0000710 | Ga0495655_0000710_1644_2507 | 257 |
| 92 | 3300026089 | Ga0207648_10201299 | Ga0207648_102012993 | 258 |
| 93 | 3300005834 | Ga0068851_10063315 | Ga0068851_100633152 | 259 |
| 94 | 3300009101 | Ga0105247_10000110 | Ga0105247_1000011034 | 259 |
| 95 | 3300025321 | Ga0207656_10043822 | Ga0207656_100438222 | 259 |
| 96 | 3300025900 | Ga0207710_10000138 | Ga0207710_1000013862 | 259 |
| 97 | 3300046642 | Ga0495634_0040454 | Ga0495634_0040454_486_1337 | 259 |
| 98 | 3300053077 | Ga0495601_0005254 | Ga0495601_0005254_6539_7390 | 259 |
| 99 | 3300053085 | Ga0495619_0007231 | Ga0495619_0007231_5098_5949 | 259 |
| 100 | 3300009098 | Ga0105245_10192803 | Ga0105245_101928032 | 260 |
| 101 | 3300048905 | Ga0496102_0208459 | Ga0496102_0208459_500_1411 | 260 |
| 102 | 3300048906 | Ga0496103_0013192 | Ga0496103_0013192_570_1481 | 260 |
| 103 | 3300048920 | Ga0496117_0001638 | Ga0496117_0001638_6699_7610 | 260 |
| 104 | 3300048921 | Ga0496118_0001976 | Ga0496118_0001976_22520_23431 | 260 |
| 105 | 3300049568 | Ga0501031_0000326 | Ga0501031_0000326_9523_10383 | 260 |
| 106 | 3300049569 | Ga0501032_0000701 | Ga0501032_0000701_9483_10343 | 260 |
| 107 | 3300049570 | Ga0501033_0000890 | Ga0501033_0000890_9508_10368 | 260 |
| 108 | 3300049571 | Ga0501034_0003994 | Ga0501034_0003994_9539_10399 | 260 |
| 109 | 3300049572 | Ga0501036_0000131 | Ga0501036_0000131_30215_31075 | 260 |
| 110 | 3300049573 | Ga0501037_0000621 | Ga0501037_0000621_16991_17851 | 260 |
| 111 | 3300049574 | Ga0501038_0000835 | Ga0501038_0000835_16992_17852 | 260 |
| 112 | 3300049575 | Ga0501039_0053002 | Ga0501039_0053002_2241_3101 | 260 |
| 113 | 3300049576 | Ga0501040_0125048 | Ga0501040_0125048_730_1590 | 260 |
| 114 | 3300049579 | Ga0501043_0000841 | Ga0501043_0000841_16947_17807 | 260 |
| 115 | 3300049580 | Ga0501046_0001019 | Ga0501046_0001019_16964_17824 | 260 |
| 116 | 3300049581 | Ga0501047_0000177 | Ga0501047_0000177_60570_61430 | 260 |
| 117 | 3300049582 | Ga0501048_0000094 | Ga0501048_0000094_30219_31079 | 260 |
| 118 | 3300049586 | Ga0501070_0000184 | Ga0501070_0000184_16948_17808 | 260 |
| 119 | 3300049588 | Ga0501072_0154300 | Ga0501072_0154300_866_1726 | 260 |
| 120 | 3300049589 | Ga0501073_0004127 | Ga0501073_0004127_9506_10366 | 260 |
| 121 | 3300049590 | Ga0501074_0026778 | Ga0501074_0026778_1909_2769 | 260 |
| 122 | 3300049592 | Ga0501076_0464826 | Ga0501076_0464826_81_941 | 260 |
| 123 | 3300049742 | Ga0501080_0005156 | Ga0501080_0005156_6365_7225 | 260 |
| 124 | 3300049744 | Ga0501083_0000414 | Ga0501083_0000414_9472_10332 | 260 |
| 125 | 3300049822 | Ga0501035_0000246 | Ga0501035_0000246_58203_59063 | 260 |
| 126 | 3300049823 | Ga0501044_0003897 | Ga0501044_0003897_9702_10562 | 260 |
| 127 | 3300060353 | Ga0501082_0005208 | Ga0501082_0005208_10404_11264 | 260 |
| 128 | 3300013296 | Ga0157374_10635469 | Ga0157374_106354692 | 261 |
| 129 | 3300014326 | Ga0157380_10000096 | Ga0157380_1000009633 | 261 |
| 130 | 3300017792 | Ga0163161_10053118 | Ga0163161_100531182 | 261 |
| 131 | 3300047322 | Ga0495680_0040706 | Ga0495680_0040706_1699_2559 | 261 |
| 132 | 3300005456 | Ga0070678_100000713 | Ga0070678_1000007134 | 262 |
| 133 | 3300013104 | Ga0157370_10007054 | Ga0157370_100070544 | 262 |
| 134 | 3300026121 | Ga0207683_10002711 | Ga0207683_100027113 | 262 |
| 135 | 3300046507 | Ga0495606_0000219 | Ga0495606_0000219_12091_12945 | 262 |
| 136 | 3300048913 | Ga0496110_0035303 | Ga0496110_0035303_1942_2796 | 262 |
| 137 | 3300048919 | Ga0496116_0000500 | Ga0496116_0000500_5832_6680 | 262 |
| 138 | 3300048922 | Ga0496119_0001539 | Ga0496119_0001539_5830_6678 | 262 |
| 139 | 3300053083 | Ga0495655_0000012 | Ga0495655_0000012_65255_66106 | 262 |
| 140 | 3300053129 | Ga0500628_000014 | Ga0500628_000014_85919_86770 | 262 |
| 141 | 3300005366 | Ga0070659_100160135 | Ga0070659_1001601351 | 263 |
| 142 | 3300005459 | Ga0068867_100261836 | Ga0068867_1002618362 | 263 |
| 143 | 3300005564 | Ga0070664_100171154 | Ga0070664_1001711542 | 263 |
| 144 | 3300025945 | Ga0207679_10279355 | Ga0207679_102793552 | 263 |
| 145 | 3300046516 | Ga0495628_0003567 | Ga0495628_0003567_7603_8415 | 263 |
| 146 | 3300049824 | Ga0501045_0330891 | Ga0501045_0330891_101_946 | 263 |
| 147 | 3300005455 | Ga0070663_100000101 | Ga0070663_10000010117 | 264 |
| 148 | 3300005530 | Ga0070679_100000784 | Ga0070679_10000078418 | 264 |
| 149 | 3300005578 | Ga0068854_100000123 | Ga0068854_10000012333 | 264 |
| 150 | 3300005937 | Ga0081455_10005106 | Ga0081455_100051069 | 264 |
| 151 | 3300025921 | Ga0207652_10000303 | Ga0207652_1000030317 | 264 |
| 152 | 3300025981 | Ga0207640_10000040 | Ga0207640_1000004068 | 264 |
| 153 | 3300026067 | Ga0207678_10000174 | Ga0207678_1000017417 | 264 |
| 154 | 3300003320 | rootH2_10031028 | rootH2_100310282 | 265 |
| 155 | 3300049581 | Ga0501047_0001093 | Ga0501047_0001093_17395_18252 | 265 |
| 156 | 3300049586 | Ga0501070_0084556 | Ga0501070_0084556_1020_1877 | 265 |
| 157 | 3300050491 | nmdc:mga00v17_129796_c1 | nmdc:mga00v17_129796_c1_556_1416 | 265 |
| 158 | 3300005614 | Ga0068856_100001659 | Ga0068856_1000016598 | 266 |
| 159 | 3300005937 | Ga0081455_10088412 | Ga0081455_100884122 | 266 |
| 160 | 3300026078 | Ga0207702_10000027 | Ga0207702_100000278 | 266 |
| 161 | 3300009098 | Ga0105245_10262350 | Ga0105245_102623502 | 267 |
| 162 | 3300026078 | Ga0207702_10401591 | Ga0207702_104015912 | 267 |
| 163 | 3300046454 | Ga0495592_0167592 | Ga0495592_0167592_599_1483 | 267 |
| 164 | 3300046516 | Ga0495628_0134374 | Ga0495628_0134374_448_1332 | 267 |
| 165 | 3300046529 | Ga0495652_0007748 | Ga0495652_0007748_6294_7178 | 267 |
| 166 | 3300048912 | Ga0496109_0305752 | Ga0496109_0305752_72_926 | 267 |
| 167 | 3300048914 | Ga0496111_0010953 | Ga0496111_0010953_5179_6033 | 267 |
| 168 | 3300049592 | Ga0501076_0055331 | Ga0501076_0055331_61_915 | 267 |
| 169 | 3300053077 | Ga0495601_0111984 | Ga0495601_0111984_819_1703 | 267 |
| 170 | 3300005983 | Ga0081540_1000419 | Ga0081540_100041933 | 268 |
| 171 | 3300047321 | Ga0495676_0002845 | Ga0495676_0002845_2450_3310 | 268 |
| 172 | 3300049583 | Ga0501067_0132357 | Ga0501067_0132357_440_1294 | 268 |
| 173 | 3300009101 | Ga0105247_10111326 | Ga0105247_101113262 | 269 |
| 174 | 3300047322 | Ga0495680_0346798 | Ga0495680_0346798_136_987 | 269 |
| 175 | 3300048907 | Ga0496104_0000243 | Ga0496104_0000243_23845_24711 | 269 |
| 176 | 3300048908 | Ga0496105_0000622 | Ga0496105_0000622_9546_10412 | 269 |
| 177 | 3300048908 | Ga0496105_0178366 | Ga0496105_0178366_52_915 | 269 |
| 178 | 3300048922 | Ga0496119_0011330 | Ga0496119_0011330_6417_7280 | 269 |
| 179 | 3300048929 | Ga0496126_0005630 | Ga0496126_0005630_1952_2812 | 269 |
| 180 | 3300049744 | Ga0501083_0001778 | Ga0501083_0001778_7938_8801 | 270 |
| 181 | 3300005547 | Ga0070693_100215911 | Ga0070693_1002159112 | 271 |
| 182 | 3300005937 | Ga0081455_10054809 | Ga0081455_100548093 | 271 |
| 183 | 3300049585 | Ga0501069_0000132 | Ga0501069_0000132_6423_7283 | 271 |
| 184 | 3300049587 | Ga0501071_0020509 | Ga0501071_0020509_2431_3291 | 271 |
| 185 | 3300049590 | Ga0501074_0024004 | Ga0501074_0024004_3013_3873 | 271 |
| 186 | 3300049742 | Ga0501080_0118327 | Ga0501080_0118327_301_1161 | 271 |
| 187 | 3300049744 | Ga0501083_0063806 | Ga0501083_0063806_1032_1892 | 271 |
| 188 | 3300049823 | Ga0501044_0004276 | Ga0501044_0004276_6285_7145 | 271 |
| 189 | 3300005614 | Ga0068856_100340849 | Ga0068856_1003408492 | 272 |
| 190 | 3300005615 | Ga0070702_100280830 | Ga0070702_1002808301 | 272 |
| 191 | 3300005981 | Ga0081538_10003063 | Ga0081538_100030639 | 272 |
| 192 | 3300009176 | Ga0105242_10000010 | Ga0105242_1000001059 | 272 |
| 193 | 3300025934 | Ga0207686_10000107 | Ga0207686_1000010756 | 272 |
| 194 | 3300026078 | Ga0207702_10278298 | Ga0207702_102782982 | 272 |
| 195 | 3300005455 | Ga0070663_100078316 | Ga0070663_1000783162 | 273 |
| 196 | 3300026067 | Ga0207678_10107052 | Ga0207678_101070522 | 273 |
| 197 | 3300048929 | Ga0496126_0005533 | Ga0496126_0005533_10440_11324 | 273 |
| 198 | 3300049571 | Ga0501034_0004977 | Ga0501034_0004977_1349_2224 | 274 |
| 199 | 3300049823 | Ga0501044_0411810 | Ga0501044_0411810_238_1113 | 274 |
| 200 | 3300005344 | Ga0070661_100234541 | Ga0070661_1002345412 | 276 |
| 201 | 3300005535 | Ga0070684_100032648 | Ga0070684_1000326484 | 276 |
| 202 | 3300005577 | Ga0068857_100129875 | Ga0068857_1001298752 | 276 |
| 203 | 3300005616 | Ga0068852_100262446 | Ga0068852_1002624462 | 276 |
| 204 | 3300005842 | Ga0068858_100533006 | Ga0068858_1005330062 | 276 |
| 205 | 3300025920 | Ga0207649_10117782 | Ga0207649_101177822 | 276 |
| 206 | 3300025932 | Ga0207690_10028794 | Ga0207690_100287942 | 276 |
| 207 | 3300026116 | Ga0207674_10133380 | Ga0207674_101333802 | 276 |
| 208 | 3300017792 | Ga0163161_10222571 | Ga0163161_102225711 | 277 |
| 209 | 3300041486 | Ga0451807_2346686 | Ga0451807_2346686_49_906 | 277 |
| 210 | 3300046516 | Ga0495628_0039415 | Ga0495628_0039415_239_1087 | 277 |
| 211 | 3300046615 | Ga0495656_0000195 | Ga0495656_0000195_15605_16456 | 277 |
| 212 | 3300046809 | Ga0495600_0013630 | Ga0495600_0013630_3739_4653 | 277 |
| 213 | 3300048911 | Ga0496108_0000492 | Ga0496108_0000492_359_1213 | 277 |
| 214 | 3300048912 | Ga0496109_0000058 | Ga0496109_0000058_56272_57126 | 277 |
| 215 | 3300053085 | Ga0495619_0000041 | Ga0495619_0000041_64921_65769 | 277 |
| 216 | 3300005341 | Ga0070691_10007663 | Ga0070691_100076633 | 278 |
| 217 | 3300005436 | Ga0070713_100000055 | Ga0070713_10000005513 | 278 |
| 218 | 3300005842 | Ga0068858_100003595 | Ga0068858_10000359512 | 278 |
| 219 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009302 | 278 |
| 220 | 3300026035 | Ga0207703_10000028 | Ga0207703_1000002881 | 278 |
| 221 | 3300005331 | Ga0070670_100024099 | Ga0070670_1000240993 | 279 |
| 222 | 3300005618 | Ga0068864_100000035 | Ga0068864_10000003531 | 279 |
| 223 | 3300013104 | Ga0157370_10020731 | Ga0157370_100207314 | 279 |
| 224 | 3300025925 | Ga0207650_10052602 | Ga0207650_100526023 | 279 |
| 225 | 3300026095 | Ga0207676_10000026 | Ga0207676_10000026149 | 279 |
| 226 | 3300036401 | Ga0373937_0237333 | Ga0373937_0237333_356_1204 | 279 |
| 227 | 3300046516 | Ga0495628_0041799 | Ga0495628_0041799_1515_2363 | 279 |
| 228 | 3300046683 | Ga0495658_0005468 | Ga0495658_0005468_3701_4567 | 279 |
| 229 | 3300048911 | Ga0496108_0000012 | Ga0496108_0000012_126066_126932 | 279 |
| 230 | 3300048912 | Ga0496109_0000057 | Ga0496109_0000057_98380_99246 | 279 |
| 231 | 3300048915 | Ga0496112_0006122 | Ga0496112_0006122_3646_4506 | 279 |
| 232 | 3300048916 | Ga0496113_0000010 | Ga0496113_0000010_66379_67239 | 279 |
| 233 | 3300048928 | Ga0496125_0035474 | Ga0496125_0035474_1602_2447 | 279 |
| 234 | 3300053078 | Ga0495612_0007952 | Ga0495612_0007952_1773_2621 | 279 |
| 235 | 3300053085 | Ga0495619_0077628 | Ga0495619_0077628_1288_2136 | 279 |
| 236 | 3300002074 | JGI24748J21848_1000531 | JGI24748J21848_10005313 | 280 |
| 237 | 3300002239 | JGI24034J26672_10000095 | JGI24034J26672_1000009511 | 280 |
| 238 | 3300002244 | JGI24742J22300_10001109 | JGI24742J22300_100011093 | 280 |
| 239 | 3300046678 | Ga0495599_0123075 | Ga0495599_0123075_281_1147 | 280 |
| 240 | 3300046690 | Ga0495624_0000149 | Ga0495624_0000149_33938_34804 | 280 |
| 241 | 3300048911 | Ga0496108_0067813 | Ga0496108_0067813_2043_2900 | 280 |
| 242 | 3300049588 | Ga0501072_0547066 | Ga0501072_0547066_27_875 | 280 |
| 243 | 3300005366 | Ga0070659_100113577 | Ga0070659_1001135772 | 281 |
| 244 | 3300005834 | Ga0068851_10000138 | Ga0068851_1000013821 | 281 |
| 245 | 3300006237 | Ga0097621_100426589 | Ga0097621_1004265892 | 281 |
| 246 | 3300006881 | Ga0068865_100000009 | Ga0068865_10000000969 | 281 |
| 247 | 3300013102 | Ga0157371_10006368 | Ga0157371_100063689 | 281 |
| 248 | 3300025321 | Ga0207656_10003856 | Ga0207656_100038565 | 281 |
| 249 | 3300025938 | Ga0207704_10000009 | Ga0207704_10000009174 | 281 |
| 250 | 3300046681 | Ga0495647_0000492 | Ga0495647_0000492_928_1806 | 281 |
| 251 | 3300053085 | Ga0495619_0000745 | Ga0495619_0000745_20259_21113 | 281 |
| 252 | 3300003203 | JGI25406J46586_10035388 | JGI25406J46586_100353882 | 282 |
| 253 | 3300005337 | Ga0070682_100000040 | Ga0070682_10000004079 | 282 |
| 254 | 3300005985 | Ga0081539_10000615 | Ga0081539_1000061557 | 282 |
| 255 | 3300013306 | Ga0163162_10616904 | Ga0163162_106169042 | 282 |
| 256 | 3300013307 | Ga0157372_10000150 | Ga0157372_1000015048 | 282 |
| 257 | 3300046516 | Ga0495628_0002027 | Ga0495628_0002027_11412_12266 | 282 |
| 258 | 3300046533 | Ga0495640_0001957 | Ga0495640_0001957_5995_6846 | 282 |
| 259 | 3300046642 | Ga0495634_0030157 | Ga0495634_0030157_1036_1896 | 282 |
| 260 | 3300047444 | Ga0495675_0044576 | Ga0495675_0044576_714_1604 | 282 |
| 261 | 3300048913 | Ga0496110_0000170 | Ga0496110_0000170_21210_22064 | 282 |
| 262 | 3300048914 | Ga0496111_0000001 | Ga0496111_0000001_61087_61941 | 282 |
| 263 | 3300053085 | Ga0495619_0000018 | Ga0495619_0000018_31397_32251 | 282 |
| 264 | 3300005337 | Ga0070682_100158927 | Ga0070682_1001589272 | 283 |
| 265 | 3300009551 | Ga0105238_10469443 | Ga0105238_104694431 | 283 |
| 266 | 3300020070 | Ga0206356_10903912 | Ga0206356_109039122 | 283 |
| 267 | 3300028379 | Ga0268266_10456486 | Ga0268266_104564862 | 283 |
| 268 | 3300048917 | Ga0496114_0000080 | Ga0496114_0000080_7909_8766 | 283 |
| 269 | 3300048918 | Ga0496115_0000104 | Ga0496115_0000104_50132_50989 | 283 |
| 270 | 3300053085 | Ga0495619_0054315 | Ga0495619_0054315_1563_2417 | 283 |
| 271 | 3300001977 | JGI24746J21847_1000332 | JGI24746J21847_10003324 | 284 |
| 272 | 3300005335 | Ga0070666_10022667 | Ga0070666_100226673 | 284 |
| 273 | 3300005548 | Ga0070665_100029059 | Ga0070665_1000290595 | 284 |
| 274 | 3300009101 | Ga0105247_10124398 | Ga0105247_101243982 | 284 |
| 275 | 3300009174 | Ga0105241_10176536 | Ga0105241_101765362 | 284 |
| 276 | 3300025900 | Ga0207710_10063300 | Ga0207710_100633002 | 284 |
| 277 | 3300025903 | Ga0207680_10002641 | Ga0207680_100026418 | 284 |
| 278 | 3300025924 | Ga0207694_10448459 | Ga0207694_104484592 | 284 |
| 279 | 3300025986 | Ga0207658_10024437 | Ga0207658_100244373 | 284 |
| 280 | 3300028379 | Ga0268266_10001090 | Ga0268266_1000109015 | 284 |
| 281 | 3300028379 | Ga0268266_10009287 | Ga0268266_100092876 | 284 |
| 282 | 3300044842 | Ga0466957_0131630 | Ga0466957_0131630_223_1089 | 284 |
| 283 | 3300046689 | Ga0495613_0000175 | Ga0495613_0000175_21980_22855 | 284 |
| 284 | 3300047317 | Ga0495604_0002829 | Ga0495604_0002829_7742_8617 | 284 |
| 285 | 3300048088 | Ga0495602_0000063 | Ga0495602_0000063_83891_84766 | 284 |
| 286 | 3300048929 | Ga0496126_0067672 | Ga0496126_0067672_47_922 | 284 |
| 287 | 3300053077 | Ga0495601_0000041 | Ga0495601_0000041_57235_58110 | 284 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.8811 | 27 | 284 |
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.8745 | 27 | 284 |
| 8dku-assembly1.cif.gz_B | cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen | 0.8627 | 27 | 282 |
| 8dku-assembly1.cif.gz_B | cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen | 0.8503 | 27 | 282 |
| 6jbh-assembly1.cif.gz_D | cryo-em structure and transport mechanism of a wall teichoic acid abc transporter | 0.845 | 24 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6137 | 81 | 268 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5856 | 82 | 272 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5749 | 81 | 272 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4388 | 81 | 268 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4304 | 81 | 272 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E4H489-F1-model_v4 | Transport permease protein | 0.9413 | 22 | 284 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A4T2GWK7-F1-model_v4 | Transport permease protein | 0.9372 | 27 | 284 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A3A1Y3I8-F1-model_v4 | LPS ABC transporter | 0.9366 | 81 | 284 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A6M1I7H6-F1-model_v4 | deleted | 0.9361 | 80 | 207 |
|
| AF-A0A7L4WF67-F1-model_v4 | Transport permease protein | 0.935 | 25 | 284 |
GO:0005886
GO:0015920 GO:0016740 GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar