F387932

General Info

Members Datasets Scaffolds Average Seq Length
287 187 287 268

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10088412|Ga0081455_100884122
Length 299
Sequence VSATPVTPVAPLQEVKGPSALGGGSRRFFDLLWLISVTEFKRVYFGTVLGYLWSLIRPLLLFGVLLLVFTQVFRVGSEKVEHYPVFLLMGIVLYTFFSESTSNAVTSVVSQEGVVRKTQFPRAVIPLATTITAAFNLTPTWTWLLFPVCLLFLFIGAAGTSMALSALYVRYRDTAIIWVVAAQVLLYLTPILYPVNALGEETKERLLMVNPLSVIFEQVRVWVLHEPAAPTAVDAAGGWLGLLPAAVIFFGVIGGAMTFGLVGVFLGPTLLAVVYKLIQDWLVTTPKMVSSPTEPPLKP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 8.71
Rhizosphere 83.62
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000332 3300001977 Bacteria 6796
2 JGI24748J21848_1000531 3300002074 Bacteria 4158
3 JGI24034J26672_10000095 3300002239 Bacteria 15947
4 JGI24742J22300_10001109 3300002244 Bacteria 4171
5 JGI25406J46586_10035388 3300003203 Bacteria 1823
6 rootH2_10031028 3300003320 Bacteria 2218
7 Ga0070670_100024099 3300005331 Bacteria 5235
8 Ga0070666_10022667 3300005335 Bacteria 4080
9 Ga0070682_100000040 3300005337 Bacteria 143944
10 Ga0070682_100158927 3300005337 Bacteria 1559
11 Ga0070691_10007663 3300005341 Bacteria 4948
12 Ga0070661_100234541 3300005344 Bacteria 1411
13 Ga0070692_10051239 3300005345 Bacteria 2146
14 Ga0070668_100002688 3300005347 Bacteria 13077
15 Ga0070674_100000016 3300005356 Bacteria 91058
16 Ga0070688_100000151 3300005365 Bacteria 37674
17 Ga0070688_100000258 3300005365 Bacteria 27791
18 Ga0070659_100113577 3300005366 Bacteria 2188
19 Ga0070659_100160135 3300005366 Bacteria 1840
20 Ga0070667_100005305 3300005367 Bacteria 10770
21 Ga0070713_100000055 3300005436 Bacteria 70759
22 Ga0070713_100026581 3300005436 Bacteria 4546
23 Ga0070711_100056755 3300005439 Bacteria 2709
24 Ga0070663_100000101 3300005455 Bacteria 39196
25 Ga0070663_100078316 3300005455 Bacteria 2423
26 Ga0070678_100000713 3300005456 Bacteria 16488
27 Ga0068867_100261836 3300005459 Unclassified 1410
28 Ga0070685_10000092 3300005466 Bacteria 55484
29 Ga0070685_10000360 3300005466 Bacteria 27792
30 Ga0070679_100000784 3300005530 Bacteria 27643
31 Ga0070684_100032648 3300005535 Bacteria 4438
32 Ga0070693_100215911 3300005547 Bacteria 1254
33 Ga0070665_100029059 3300005548 Bacteria 5565
34 Ga0070665_100036005 3300005548 Bacteria 4980
35 Ga0070664_100085313 3300005564 Bacteria 2727
36 Ga0070664_100171154 3300005564 Bacteria 1927
37 Ga0068857_100129875 3300005577 Bacteria 2272
38 Ga0068854_100000123 3300005578 Bacteria 53446
39 Ga0068856_100001659 3300005614 Bacteria 23332
40 Ga0068856_100003489 3300005614 Bacteria 15873
41 Ga0068856_100149261 3300005614 Unclassified 2346
42 Ga0068856_100340849 3300005614 Bacteria 1517
43 Ga0070702_100280830 3300005615 Unclassified 1143
44 Ga0068852_100000195 3300005616 Bacteria 41405
45 Ga0068852_100262446 3300005616 Bacteria 1659
46 Ga0068864_100000035 3300005618 Bacteria 195218
47 Ga0068851_10000138 3300005834 Bacteria 39261
48 Ga0068851_10063315 3300005834 Bacteria 1899
49 Ga0068858_100003595 3300005842 Bacteria 15344
50 Ga0068858_100139515 3300005842 Bacteria 2275
51 Ga0068858_100533006 3300005842 Unclassified 1136
52 Ga0068860_100055333 3300005843 Bacteria 3772
53 Ga0068862_100002457 3300005844 Bacteria 16420
54 Ga0081455_10005106 3300005937 Bacteria 14474
55 Ga0081455_10054809 3300005937 Bacteria 3396
56 Ga0081455_10067763 3300005937 Bacteria 2973
57 Ga0081455_10088412 3300005937 Bacteria 2517
58 Ga0081538_10003063 3300005981 Bacteria 15925
59 Ga0081538_10016023 3300005981 Bacteria 5768
60 Ga0081540_1000419 3300005983 Bacteria 41957
61 Ga0081539_10000615 3300005985 Bacteria 72134
62 Ga0070712_100000142 3300006175 Bacteria 37397
63 Ga0097621_100426589 3300006237 Unclassified 1191
64 Ga0068865_100000009 3300006881 Bacteria 168291
65 Ga0111539_10653688 3300009094 Unclassified 1224
66 Ga0105245_10000012 3300009098 Bacteria 267151
67 Ga0105245_10192803 3300009098 Bacteria 1953
68 Ga0105245_10262350 3300009098 Unclassified 1682
69 Ga0105247_10000110 3300009101 Bacteria 83499
70 Ga0105247_10111326 3300009101 Bacteria 1763
71 Ga0105247_10124398 3300009101 Bacteria 1674
72 Ga0105241_10176536 3300009174 Bacteria 1769
73 Ga0105242_10000010 3300009176 Bacteria 151649
74 Ga0105242_10007661 3300009176 Bacteria 8309
75 Ga0105242_10125683 3300009176 Bacteria 2207
76 Ga0105248_10000307 3300009177 Bacteria 58221
77 Ga0105238_10469443 3300009551 Bacteria 1257
78 Ga0105249_10003023 3300009553 Bacteria 14514
79 Ga0157371_10006368 3300013102 Bacteria 9763
80 Ga0157370_10007054 3300013104 Bacteria 12266
81 Ga0157370_10020731 3300013104 Bacteria 6559
82 Ga0157369_10000222 3300013105 Bacteria 78413
83 Ga0157374_10045649 3300013296 Bacteria 4055
84 Ga0157374_10635469 3300013296 Bacteria 1079
85 Ga0157378_10133703 3300013297 Bacteria 2298
86 Ga0157378_10188411 3300013297 Unclassified 1944
87 Ga0163162_10052178 3300013306 Bacteria 4107
88 Ga0163162_10616904 3300013306 Unclassified 1210
89 Ga0157372_10000150 3300013307 Bacteria 75963
90 Ga0157375_10004632 3300013308 Bacteria 11949
91 Ga0157380_10000096 3300014326 Bacteria 48405
92 Ga0163161_10053118 3300017792 Bacteria 2938
93 Ga0163161_10222571 3300017792 Unclassified 1462
94 Ga0206356_10903912 3300020070 Bacteria 2204
95 Ga0207656_10003856 3300025321 Bacteria 5199
96 Ga0207656_10043822 3300025321 Bacteria 1909
97 Ga0207710_10000138 3300025900 Bacteria 83652
98 Ga0207710_10063300 3300025900 Bacteria 1683
99 Ga0207680_10002641 3300025903 Bacteria 8377
100 Ga0207693_10002124 3300025915 Bacteria 17299
101 Ga0207663_10014855 3300025916 Bacteria 4279
102 Ga0207649_10117782 3300025920 Bacteria 1786
103 Ga0207652_10000303 3300025921 Bacteria 50549
104 Ga0207694_10448459 3300025924 Unclassified 1077
105 Ga0207650_10052602 3300025925 Bacteria 3017
106 Ga0207687_10000011 3300025927 Bacteria 388349
107 Ga0207700_10000009 3300025928 Bacteria 314953
108 Ga0207700_10073287 3300025928 Bacteria 2644
109 Ga0207690_10028794 3300025932 Bacteria 3524
110 Ga0207686_10000107 3300025934 Bacteria 67766
111 Ga0207686_10001420 3300025934 Bacteria 13574
112 Ga0207686_10015440 3300025934 Bacteria 4270
113 Ga0207669_10000037 3300025937 Bacteria 77494
114 Ga0207704_10000009 3300025938 Bacteria 198266
115 Ga0207711_10000024 3300025941 Bacteria 293596
116 Ga0207679_10103565 3300025945 Bacteria 2231
117 Ga0207679_10279355 3300025945 Unclassified 1431
118 Ga0207712_10004536 3300025961 Bacteria 8766
119 Ga0207668_10002906 3300025972 Bacteria 10052
120 Ga0207640_10000040 3300025981 Bacteria 106134
121 Ga0207658_10024437 3300025986 Bacteria 4228
122 Ga0207658_10080755 3300025986 Bacteria 2491
123 Ga0207703_10000028 3300026035 Bacteria 208682
124 Ga0207703_10028153 3300026035 Bacteria 4427
125 Ga0207678_10000174 3300026067 Bacteria 54529
126 Ga0207678_10107052 3300026067 Bacteria 2385
127 Ga0207702_10000027 3300026078 Bacteria 183792
128 Ga0207702_10006973 3300026078 Bacteria 9671
129 Ga0207702_10056878 3300026078 Bacteria 3322
130 Ga0207702_10278298 3300026078 Unclassified 1581
131 Ga0207702_10401591 3300026078 Bacteria 1322
132 Ga0207648_10201299 3300026089 Bacteria 1766
133 Ga0207676_10000026 3300026095 Bacteria 248593
134 Ga0207674_10133380 3300026116 Bacteria 2446
135 Ga0207683_10002711 3300026121 Bacteria 15470
136 Ga0207698_10000009 3300026142 Bacteria 281300
137 Ga0268266_10001090 3300028379 Bacteria 34068
138 Ga0268266_10009287 3300028379 Bacteria 8675
139 Ga0268266_10456486 3300028379 Bacteria 1215
140 Ga0268265_10005289 3300028380 Bacteria 8840
141 Ga0268264_10052744 3300028381 Bacteria 3391
142 Ga0265319_1000227 3300028563 Bacteria 42176
143 Ga0265338_10000383 3300028800 Bacteria 79248
144 Ga0373937_0237333 3300036401 Bacteria 1717
145 Ga0451807_2346686 3300041486 Bacteria 1563
146 Ga0466963_0006324 3300044694 Bacteria 7003
147 Ga0466963_0067706 3300044694 Bacteria 2397
148 Ga0466957_0131630 3300044842 Bacteria 1603
149 Ga0495592_0167592 3300046454 Unclassified 1506
150 Ga0495603_0000022 3300046455 Bacteria 64108
151 Ga0495603_0000825 3300046455 Bacteria 17802
152 Ga0495629_0001233 3300046459 Bacteria 20100
153 Ga0495653_0315803 3300046463 Bacteria 1014
154 Ga0495662_0010679 3300046476 Bacteria 4492
155 Ga0495606_0000219 3300046507 Bacteria 101614
156 Ga0495608_0000001 3300046511 Bacteria 411278
157 Ga0495628_0002027 3300046516 Bacteria 18361
158 Ga0495628_0003567 3300046516 Bacteria 13932
159 Ga0495628_0039415 3300046516 Bacteria 3779
160 Ga0495628_0041799 3300046516 Bacteria 3659
161 Ga0495628_0134374 3300046516 Bacteria 1891
162 Ga0495630_0000115 3300046517 Bacteria 63124
163 Ga0495630_0000141 3300046517 Bacteria 55652
164 Ga0495652_0007748 3300046529 Bacteria 9875
165 Ga0495640_0001957 3300046533 Bacteria 16433
166 Ga0495656_0000195 3300046615 Bacteria 21694
167 Ga0495634_0030157 3300046642 Bacteria 3748
168 Ga0495634_0040454 3300046642 Bacteria 3171
169 Ga0495625_0000154 3300046660 Bacteria 105083
170 Ga0495657_0000002 3300046675 Bacteria 411958
171 Ga0495657_0058477 3300046675 Unclassified 2560
172 Ga0495599_0123075 3300046678 Bacteria 1612
173 Ga0495647_0000492 3300046681 Bacteria 11492
174 Ga0495658_0005468 3300046683 Bacteria 6247
175 Ga0495613_0000175 3300046689 Bacteria 62391
176 Ga0495624_0000149 3300046690 Bacteria 51112
177 Ga0495600_0013630 3300046809 Bacteria 5114
178 Ga0495604_0002829 3300047317 Bacteria 13928
179 Ga0495676_0002845 3300047321 Bacteria 15595
180 Ga0495676_0081128 3300047321 Bacteria 2460
181 Ga0495680_0040706 3300047322 Bacteria 3701
182 Ga0495680_0346798 3300047322 Bacteria 1034
183 Ga0495675_0000104 3300047444 Bacteria 60748
184 Ga0495675_0044576 3300047444 Bacteria 2825
185 Ga0495593_0019252 3300047673 Bacteria 3828
186 Ga0495602_0000063 3300048088 Bacteria 104915
187 Ga0496102_0208459 3300048905 Bacteria 1843
188 Ga0496103_0013192 3300048906 Bacteria 4899
189 Ga0496104_0000002 3300048907 Bacteria 686017
190 Ga0496104_0000243 3300048907 Bacteria 48237
191 Ga0496105_0000001 3300048908 Bacteria 1328178
192 Ga0496105_0000622 3300048908 Bacteria 23722
193 Ga0496105_0006026 3300048908 Bacteria 9268
194 Ga0496105_0178366 3300048908 Bacteria 1740
195 Ga0496108_0000012 3300048911 Bacteria 258433
196 Ga0496108_0000492 3300048911 Bacteria 31518
197 Ga0496108_0067813 3300048911 Bacteria 3009
198 Ga0496109_0000057 3300048912 Bacteria 120274
199 Ga0496109_0000058 3300048912 Bacteria 118556
200 Ga0496109_0305752 3300048912 Unclassified 1500
201 Ga0496110_0000170 3300048913 Bacteria 39947
202 Ga0496110_0035303 3300048913 Bacteria 4337
203 Ga0496111_0000001 3300048914 Bacteria 194837
204 Ga0496111_0010953 3300048914 Bacteria 6101
205 Ga0496112_0006122 3300048915 Bacteria 10518
206 Ga0496113_0000010 3300048916 Bacteria 86561
207 Ga0496114_0000080 3300048917 Bacteria 68701
208 Ga0496114_0077464 3300048917 Bacteria 2803
209 Ga0496115_0000004 3300048918 Bacteria 319734
210 Ga0496115_0000104 3300048918 Bacteria 79824
211 Ga0496116_0000500 3300048919 Bacteria 53809
212 Ga0496117_0001638 3300048920 Bacteria 31520
213 Ga0496118_0001976 3300048921 Bacteria 29112
214 Ga0496119_0001539 3300048922 Bacteria 27538
215 Ga0496119_0011330 3300048922 Bacteria 7403
216 Ga0496119_0018675 3300048922 Bacteria 5146
217 Ga0496119_0034914 3300048922 Bacteria 3302
218 Ga0496119_0077875 3300048922 Bacteria 1919
219 Ga0496120_0000528 3300048923 Bacteria 59001
220 Ga0496121_0049557 3300048924 Bacteria 3560
221 Ga0496125_0035474 3300048928 Bacteria 4373
222 Ga0496126_0005533 3300048929 Bacteria 14380
223 Ga0496126_0005630 3300048929 Bacteria 14246
224 Ga0496126_0006214 3300048929 Bacteria 13364
225 Ga0496126_0067672 3300048929 Bacteria 3191
226 Ga0496126_0325218 3300048929 Bacteria 1263
227 Ga0501031_0000326 3300049568 Bacteria 27423
228 Ga0501032_0000701 3300049569 Bacteria 27295
229 Ga0501033_0000890 3300049570 Bacteria 27318
230 Ga0501034_0003994 3300049571 Bacteria 16563
231 Ga0501034_0004977 3300049571 Bacteria 14620
232 Ga0501036_0000131 3300049572 Bacteria 48019
233 Ga0501037_0000621 3300049573 Bacteria 27506
234 Ga0501038_0000835 3300049574 Bacteria 27413
235 Ga0501039_0053002 3300049575 Bacteria 3139
236 Ga0501040_0125048 3300049576 Bacteria 1806
237 Ga0501042_0480935 3300049578 Bacteria 901
238 Ga0501043_0000841 3300049579 Bacteria 27283
239 Ga0501046_0001019 3300049580 Bacteria 27339
240 Ga0501047_0000177 3300049581 Bacteria 78448
241 Ga0501047_0001093 3300049581 Bacteria 26985
242 Ga0501048_0000094 3300049582 Bacteria 48036
243 Ga0501067_0132357 3300049583 Bacteria 1388
244 Ga0501069_0000132 3300049585 Bacteria 32575
245 Ga0501070_0000184 3300049586 Bacteria 58715
246 Ga0501070_0003280 3300049586 Bacteria 14043
247 Ga0501070_0084556 3300049586 Bacteria 2627
248 Ga0501071_0020509 3300049587 Bacteria 4594
249 Ga0501072_0154300 3300049588 Bacteria 1831
250 Ga0501072_0547066 3300049588 Unclassified 914
251 Ga0501073_0004127 3300049589 Bacteria 10904
252 Ga0501074_0024004 3300049590 Bacteria 4431
253 Ga0501074_0026778 3300049590 Bacteria 4181
254 Ga0501076_0055331 3300049592 Bacteria 3147
255 Ga0501076_0464826 3300049592 Bacteria 1042
256 Ga0501080_0005156 3300049742 Bacteria 11635
257 Ga0501080_0118327 3300049742 Bacteria 2456
258 Ga0501083_0000414 3300049744 Bacteria 27277
259 Ga0501083_0001778 3300049744 Bacteria 14725
260 Ga0501083_0063806 3300049744 Bacteria 2456
261 Ga0501035_0000246 3300049822 Bacteria 65227
262 Ga0501044_0003897 3300049823 Bacteria 16720
263 Ga0501044_0004276 3300049823 Bacteria 16022
264 Ga0501044_0411810 3300049823 Unclassified 1263
265 Ga0501045_0330891 3300049824 Bacteria 1134
266 nmdc:mga00v17_129796_c1 3300050491 Bacteria 1610
267 nmdc:mga0yw44_129860_c1 3300050492 Bacteria 1630
268 Ga0495601_0000041 3300053077 Bacteria 79353
269 Ga0495601_0005254 3300053077 Bacteria 7537
270 Ga0495601_0111984 3300053077 Unclassified 1768
271 Ga0495612_0007952 3300053078 Bacteria 4321
272 Ga0495612_0044949 3300053078 Bacteria 1808
273 Ga0495655_0000012 3300053083 Bacteria 92485
274 Ga0495655_0000710 3300053083 Bacteria 5329
275 Ga0495595_0000001 3300053084 Bacteria 495226
276 Ga0495619_0000018 3300053085 Bacteria 209943
277 Ga0495619_0000041 3300053085 Bacteria 112824
278 Ga0495619_0000094 3300053085 Bacteria 67416
279 Ga0495619_0000745 3300053085 Bacteria 21209
280 Ga0495619_0007231 3300053085 Bacteria 7033
281 Ga0495619_0054315 3300053085 Bacteria 2651
282 Ga0495619_0077628 3300053085 Bacteria 2231
283 Ga0495619_0119190 3300053085 Unclassified 1809
284 Ga0500566_0004132 3300053094 Bacteria 8660
285 Ga0500641_0002411 3300053096 Bacteria 6634
286 Ga0500628_000014 3300053129 Bacteria 102838
287 Ga0501082_0005208 3300060353 Bacteria 11305

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0480935 Ga0501042_0480935_10_753 222
2 3300048922 Ga0496119_0034914 Ga0496119_0034914_215_1117 231
3 3300048923 Ga0496120_0000528 Ga0496120_0000528_27784_28686 231
4 3300046459 Ga0495629_0001233 Ga0495629_0001233_19114_19971 232
5 3300048908 Ga0496105_0006026 Ga0496105_0006026_5022_5873 232
6 3300048917 Ga0496114_0077464 Ga0496114_0077464_314_1198 232
7 3300048918 Ga0496115_0000004 Ga0496115_0000004_116584_117468 232
8 3300053094 Ga0500566_0004132 Ga0500566_0004132_2399_3256 232
9 3300005436 Ga0070713_100026581 Ga0070713_1000265812 233
10 3300025928 Ga0207700_10073287 Ga0207700_100732872 233
11 3300046476 Ga0495662_0010679 Ga0495662_0010679_3505_4356 233
12 3300048929 Ga0496126_0325218 Ga0496126_0325218_165_1040 233
13 3300005439 Ga0070711_100056755 Ga0070711_1000567552 234
14 3300009176 Ga0105242_10007661 Ga0105242_100076613 235
15 3300009176 Ga0105242_10125683 Ga0105242_101256832 235
16 3300025934 Ga0207686_10001420 Ga0207686_100014206 235
17 3300005347 Ga0070668_100002688 Ga0070668_1000026884 238
18 3300005367 Ga0070667_100005305 Ga0070667_1000053051 238
19 3300005842 Ga0068858_100139515 Ga0068858_1001395152 238
20 3300005843 Ga0068860_100055333 Ga0068860_1000553333 238
21 3300005844 Ga0068862_100002457 Ga0068862_10000245710 238
22 3300009553 Ga0105249_10003023 Ga0105249_1000302311 238
23 3300013306 Ga0163162_10052178 Ga0163162_100521781 238
24 3300025961 Ga0207712_10004536 Ga0207712_100045364 238
25 3300025972 Ga0207668_10002906 Ga0207668_100029068 238
26 3300025986 Ga0207658_10080755 Ga0207658_100807552 238
27 3300026035 Ga0207703_10028153 Ga0207703_100281533 238
28 3300028380 Ga0268265_10005289 Ga0268265_100052894 238
29 3300028381 Ga0268264_10052744 Ga0268264_100527443 238
30 3300046511 Ga0495608_0000001 Ga0495608_0000001_333596_334447 238
31 3300046675 Ga0495657_0000002 Ga0495657_0000002_334276_335127 238
32 3300047444 Ga0495675_0000104 Ga0495675_0000104_16782_17633 238
33 3300048907 Ga0496104_0000002 Ga0496104_0000002_270276_271151 238
34 3300048908 Ga0496105_0000001 Ga0496105_0000001_1057028_1057903 238
35 3300048922 Ga0496119_0018675 Ga0496119_0018675_2979_3854 238
36 3300053084 Ga0495595_0000001 Ga0495595_0000001_76832_77683 238
37 3300053085 Ga0495619_0000094 Ga0495619_0000094_23501_24352 238
38 3300013296 Ga0157374_10045649 Ga0157374_100456493 239
39 3300013297 Ga0157378_10133703 Ga0157378_101337032 239
40 3300048924 Ga0496121_0049557 Ga0496121_0049557_456_1331 239
41 3300049586 Ga0501070_0003280 Ga0501070_0003280_1977_2858 239
42 3300005564 Ga0070664_100085313 Ga0070664_1000853132 240
43 3300025945 Ga0207679_10103565 Ga0207679_101035652 240
44 3300053096 Ga0500641_0002411 Ga0500641_0002411_2986_3849 241
45 3300046455 Ga0495603_0000022 Ga0495603_0000022_23101_23958 242
46 3300046517 Ga0495630_0000115 Ga0495630_0000115_42478_43341 242
47 3300005356 Ga0070674_100000016 Ga0070674_10000001681 243
48 3300005614 Ga0068856_100003489 Ga0068856_10000348910 243
49 3300005937 Ga0081455_10067763 Ga0081455_100677632 243
50 3300005981 Ga0081538_10016023 Ga0081538_100160233 243
51 3300025916 Ga0207663_10014855 Ga0207663_100148552 243
52 3300025934 Ga0207686_10015440 Ga0207686_100154402 243
53 3300025937 Ga0207669_10000037 Ga0207669_100000379 243
54 3300026078 Ga0207702_10006973 Ga0207702_100069733 243
55 3300044694 Ga0466963_0067706 Ga0466963_0067706_316_1179 243
56 3300046455 Ga0495603_0000825 Ga0495603_0000825_519_1364 243
57 3300046517 Ga0495630_0000141 Ga0495630_0000141_39048_39899 243
58 3300046675 Ga0495657_0058477 Ga0495657_0058477_1370_2221 243
59 3300047321 Ga0495676_0081128 Ga0495676_0081128_356_1207 243
60 3300053085 Ga0495619_0119190 Ga0495619_0119190_599_1450 243
61 3300005365 Ga0070688_100000151 Ga0070688_10000015135 245
62 3300005466 Ga0070685_10000360 Ga0070685_100003604 245
63 3300053078 Ga0495612_0044949 Ga0495612_0044949_274_1140 245
64 3300005548 Ga0070665_100036005 Ga0070665_1000360055 246
65 3300005345 Ga0070692_10051239 Ga0070692_100512392 248
66 3300005365 Ga0070688_100000258 Ga0070688_10000025823 248
67 3300005466 Ga0070685_10000092 Ga0070685_1000009231 248
68 3300050492 nmdc:mga0yw44_129860_c1 nmdc:mga0yw44_129860_c1_381_1238 248
69 3300046463 Ga0495653_0315803 Ga0495653_0315803_90_986 249
70 3300047673 Ga0495593_0019252 Ga0495593_0019252_1384_2244 250
71 3300005614 Ga0068856_100149261 Ga0068856_1001492613 251
72 3300026078 Ga0207702_10056878 Ga0207702_100568783 251
73 3300046660 Ga0495625_0000154 Ga0495625_0000154_75358_76224 251
74 3300009098 Ga0105245_10000012 Ga0105245_10000012197 252
75 3300025927 Ga0207687_10000011 Ga0207687_10000011251 252
76 3300009094 Ga0111539_10653688 Ga0111539_106536881 253
77 3300013105 Ga0157369_10000222 Ga0157369_100002229 253
78 3300044694 Ga0466963_0006324 Ga0466963_0006324_1356_2204 254
79 3300048929 Ga0496126_0006214 Ga0496126_0006214_10775_11635 254
80 3300005616 Ga0068852_100000195 Ga0068852_10000019520 255
81 3300009177 Ga0105248_10000307 Ga0105248_1000030732 255
82 3300013297 Ga0157378_10188411 Ga0157378_101884112 255
83 3300013308 Ga0157375_10004632 Ga0157375_100046324 255
84 3300025941 Ga0207711_10000024 Ga0207711_1000002414 255
85 3300026142 Ga0207698_10000009 Ga0207698_10000009148 255
86 3300048922 Ga0496119_0077875 Ga0496119_0077875_610_1476 255
87 3300006175 Ga0070712_100000142 Ga0070712_10000014220 257
88 3300025915 Ga0207693_10002124 Ga0207693_1000212420 257
89 3300028563 Ga0265319_1000227 Ga0265319_10002273 257
90 3300028800 Ga0265338_10000383 Ga0265338_1000038335 257
91 3300053083 Ga0495655_0000710 Ga0495655_0000710_1644_2507 257
92 3300026089 Ga0207648_10201299 Ga0207648_102012993 258
93 3300005834 Ga0068851_10063315 Ga0068851_100633152 259
94 3300009101 Ga0105247_10000110 Ga0105247_1000011034 259
95 3300025321 Ga0207656_10043822 Ga0207656_100438222 259
96 3300025900 Ga0207710_10000138 Ga0207710_1000013862 259
97 3300046642 Ga0495634_0040454 Ga0495634_0040454_486_1337 259
98 3300053077 Ga0495601_0005254 Ga0495601_0005254_6539_7390 259
99 3300053085 Ga0495619_0007231 Ga0495619_0007231_5098_5949 259
100 3300009098 Ga0105245_10192803 Ga0105245_101928032 260
101 3300048905 Ga0496102_0208459 Ga0496102_0208459_500_1411 260
102 3300048906 Ga0496103_0013192 Ga0496103_0013192_570_1481 260
103 3300048920 Ga0496117_0001638 Ga0496117_0001638_6699_7610 260
104 3300048921 Ga0496118_0001976 Ga0496118_0001976_22520_23431 260
105 3300049568 Ga0501031_0000326 Ga0501031_0000326_9523_10383 260
106 3300049569 Ga0501032_0000701 Ga0501032_0000701_9483_10343 260
107 3300049570 Ga0501033_0000890 Ga0501033_0000890_9508_10368 260
108 3300049571 Ga0501034_0003994 Ga0501034_0003994_9539_10399 260
109 3300049572 Ga0501036_0000131 Ga0501036_0000131_30215_31075 260
110 3300049573 Ga0501037_0000621 Ga0501037_0000621_16991_17851 260
111 3300049574 Ga0501038_0000835 Ga0501038_0000835_16992_17852 260
112 3300049575 Ga0501039_0053002 Ga0501039_0053002_2241_3101 260
113 3300049576 Ga0501040_0125048 Ga0501040_0125048_730_1590 260
114 3300049579 Ga0501043_0000841 Ga0501043_0000841_16947_17807 260
115 3300049580 Ga0501046_0001019 Ga0501046_0001019_16964_17824 260
116 3300049581 Ga0501047_0000177 Ga0501047_0000177_60570_61430 260
117 3300049582 Ga0501048_0000094 Ga0501048_0000094_30219_31079 260
118 3300049586 Ga0501070_0000184 Ga0501070_0000184_16948_17808 260
119 3300049588 Ga0501072_0154300 Ga0501072_0154300_866_1726 260
120 3300049589 Ga0501073_0004127 Ga0501073_0004127_9506_10366 260
121 3300049590 Ga0501074_0026778 Ga0501074_0026778_1909_2769 260
122 3300049592 Ga0501076_0464826 Ga0501076_0464826_81_941 260
123 3300049742 Ga0501080_0005156 Ga0501080_0005156_6365_7225 260
124 3300049744 Ga0501083_0000414 Ga0501083_0000414_9472_10332 260
125 3300049822 Ga0501035_0000246 Ga0501035_0000246_58203_59063 260
126 3300049823 Ga0501044_0003897 Ga0501044_0003897_9702_10562 260
127 3300060353 Ga0501082_0005208 Ga0501082_0005208_10404_11264 260
128 3300013296 Ga0157374_10635469 Ga0157374_106354692 261
129 3300014326 Ga0157380_10000096 Ga0157380_1000009633 261
130 3300017792 Ga0163161_10053118 Ga0163161_100531182 261
131 3300047322 Ga0495680_0040706 Ga0495680_0040706_1699_2559 261
132 3300005456 Ga0070678_100000713 Ga0070678_1000007134 262
133 3300013104 Ga0157370_10007054 Ga0157370_100070544 262
134 3300026121 Ga0207683_10002711 Ga0207683_100027113 262
135 3300046507 Ga0495606_0000219 Ga0495606_0000219_12091_12945 262
136 3300048913 Ga0496110_0035303 Ga0496110_0035303_1942_2796 262
137 3300048919 Ga0496116_0000500 Ga0496116_0000500_5832_6680 262
138 3300048922 Ga0496119_0001539 Ga0496119_0001539_5830_6678 262
139 3300053083 Ga0495655_0000012 Ga0495655_0000012_65255_66106 262
140 3300053129 Ga0500628_000014 Ga0500628_000014_85919_86770 262
141 3300005366 Ga0070659_100160135 Ga0070659_1001601351 263
142 3300005459 Ga0068867_100261836 Ga0068867_1002618362 263
143 3300005564 Ga0070664_100171154 Ga0070664_1001711542 263
144 3300025945 Ga0207679_10279355 Ga0207679_102793552 263
145 3300046516 Ga0495628_0003567 Ga0495628_0003567_7603_8415 263
146 3300049824 Ga0501045_0330891 Ga0501045_0330891_101_946 263
147 3300005455 Ga0070663_100000101 Ga0070663_10000010117 264
148 3300005530 Ga0070679_100000784 Ga0070679_10000078418 264
149 3300005578 Ga0068854_100000123 Ga0068854_10000012333 264
150 3300005937 Ga0081455_10005106 Ga0081455_100051069 264
151 3300025921 Ga0207652_10000303 Ga0207652_1000030317 264
152 3300025981 Ga0207640_10000040 Ga0207640_1000004068 264
153 3300026067 Ga0207678_10000174 Ga0207678_1000017417 264
154 3300003320 rootH2_10031028 rootH2_100310282 265
155 3300049581 Ga0501047_0001093 Ga0501047_0001093_17395_18252 265
156 3300049586 Ga0501070_0084556 Ga0501070_0084556_1020_1877 265
157 3300050491 nmdc:mga00v17_129796_c1 nmdc:mga00v17_129796_c1_556_1416 265
158 3300005614 Ga0068856_100001659 Ga0068856_1000016598 266
159 3300005937 Ga0081455_10088412 Ga0081455_100884122 266
160 3300026078 Ga0207702_10000027 Ga0207702_100000278 266
161 3300009098 Ga0105245_10262350 Ga0105245_102623502 267
162 3300026078 Ga0207702_10401591 Ga0207702_104015912 267
163 3300046454 Ga0495592_0167592 Ga0495592_0167592_599_1483 267
164 3300046516 Ga0495628_0134374 Ga0495628_0134374_448_1332 267
165 3300046529 Ga0495652_0007748 Ga0495652_0007748_6294_7178 267
166 3300048912 Ga0496109_0305752 Ga0496109_0305752_72_926 267
167 3300048914 Ga0496111_0010953 Ga0496111_0010953_5179_6033 267
168 3300049592 Ga0501076_0055331 Ga0501076_0055331_61_915 267
169 3300053077 Ga0495601_0111984 Ga0495601_0111984_819_1703 267
170 3300005983 Ga0081540_1000419 Ga0081540_100041933 268
171 3300047321 Ga0495676_0002845 Ga0495676_0002845_2450_3310 268
172 3300049583 Ga0501067_0132357 Ga0501067_0132357_440_1294 268
173 3300009101 Ga0105247_10111326 Ga0105247_101113262 269
174 3300047322 Ga0495680_0346798 Ga0495680_0346798_136_987 269
175 3300048907 Ga0496104_0000243 Ga0496104_0000243_23845_24711 269
176 3300048908 Ga0496105_0000622 Ga0496105_0000622_9546_10412 269
177 3300048908 Ga0496105_0178366 Ga0496105_0178366_52_915 269
178 3300048922 Ga0496119_0011330 Ga0496119_0011330_6417_7280 269
179 3300048929 Ga0496126_0005630 Ga0496126_0005630_1952_2812 269
180 3300049744 Ga0501083_0001778 Ga0501083_0001778_7938_8801 270
181 3300005547 Ga0070693_100215911 Ga0070693_1002159112 271
182 3300005937 Ga0081455_10054809 Ga0081455_100548093 271
183 3300049585 Ga0501069_0000132 Ga0501069_0000132_6423_7283 271
184 3300049587 Ga0501071_0020509 Ga0501071_0020509_2431_3291 271
185 3300049590 Ga0501074_0024004 Ga0501074_0024004_3013_3873 271
186 3300049742 Ga0501080_0118327 Ga0501080_0118327_301_1161 271
187 3300049744 Ga0501083_0063806 Ga0501083_0063806_1032_1892 271
188 3300049823 Ga0501044_0004276 Ga0501044_0004276_6285_7145 271
189 3300005614 Ga0068856_100340849 Ga0068856_1003408492 272
190 3300005615 Ga0070702_100280830 Ga0070702_1002808301 272
191 3300005981 Ga0081538_10003063 Ga0081538_100030639 272
192 3300009176 Ga0105242_10000010 Ga0105242_1000001059 272
193 3300025934 Ga0207686_10000107 Ga0207686_1000010756 272
194 3300026078 Ga0207702_10278298 Ga0207702_102782982 272
195 3300005455 Ga0070663_100078316 Ga0070663_1000783162 273
196 3300026067 Ga0207678_10107052 Ga0207678_101070522 273
197 3300048929 Ga0496126_0005533 Ga0496126_0005533_10440_11324 273
198 3300049571 Ga0501034_0004977 Ga0501034_0004977_1349_2224 274
199 3300049823 Ga0501044_0411810 Ga0501044_0411810_238_1113 274
200 3300005344 Ga0070661_100234541 Ga0070661_1002345412 276
201 3300005535 Ga0070684_100032648 Ga0070684_1000326484 276
202 3300005577 Ga0068857_100129875 Ga0068857_1001298752 276
203 3300005616 Ga0068852_100262446 Ga0068852_1002624462 276
204 3300005842 Ga0068858_100533006 Ga0068858_1005330062 276
205 3300025920 Ga0207649_10117782 Ga0207649_101177822 276
206 3300025932 Ga0207690_10028794 Ga0207690_100287942 276
207 3300026116 Ga0207674_10133380 Ga0207674_101333802 276
208 3300017792 Ga0163161_10222571 Ga0163161_102225711 277
209 3300041486 Ga0451807_2346686 Ga0451807_2346686_49_906 277
210 3300046516 Ga0495628_0039415 Ga0495628_0039415_239_1087 277
211 3300046615 Ga0495656_0000195 Ga0495656_0000195_15605_16456 277
212 3300046809 Ga0495600_0013630 Ga0495600_0013630_3739_4653 277
213 3300048911 Ga0496108_0000492 Ga0496108_0000492_359_1213 277
214 3300048912 Ga0496109_0000058 Ga0496109_0000058_56272_57126 277
215 3300053085 Ga0495619_0000041 Ga0495619_0000041_64921_65769 277
216 3300005341 Ga0070691_10007663 Ga0070691_100076633 278
217 3300005436 Ga0070713_100000055 Ga0070713_10000005513 278
218 3300005842 Ga0068858_100003595 Ga0068858_10000359512 278
219 3300025928 Ga0207700_10000009 Ga0207700_10000009302 278
220 3300026035 Ga0207703_10000028 Ga0207703_1000002881 278
221 3300005331 Ga0070670_100024099 Ga0070670_1000240993 279
222 3300005618 Ga0068864_100000035 Ga0068864_10000003531 279
223 3300013104 Ga0157370_10020731 Ga0157370_100207314 279
224 3300025925 Ga0207650_10052602 Ga0207650_100526023 279
225 3300026095 Ga0207676_10000026 Ga0207676_10000026149 279
226 3300036401 Ga0373937_0237333 Ga0373937_0237333_356_1204 279
227 3300046516 Ga0495628_0041799 Ga0495628_0041799_1515_2363 279
228 3300046683 Ga0495658_0005468 Ga0495658_0005468_3701_4567 279
229 3300048911 Ga0496108_0000012 Ga0496108_0000012_126066_126932 279
230 3300048912 Ga0496109_0000057 Ga0496109_0000057_98380_99246 279
231 3300048915 Ga0496112_0006122 Ga0496112_0006122_3646_4506 279
232 3300048916 Ga0496113_0000010 Ga0496113_0000010_66379_67239 279
233 3300048928 Ga0496125_0035474 Ga0496125_0035474_1602_2447 279
234 3300053078 Ga0495612_0007952 Ga0495612_0007952_1773_2621 279
235 3300053085 Ga0495619_0077628 Ga0495619_0077628_1288_2136 279
236 3300002074 JGI24748J21848_1000531 JGI24748J21848_10005313 280
237 3300002239 JGI24034J26672_10000095 JGI24034J26672_1000009511 280
238 3300002244 JGI24742J22300_10001109 JGI24742J22300_100011093 280
239 3300046678 Ga0495599_0123075 Ga0495599_0123075_281_1147 280
240 3300046690 Ga0495624_0000149 Ga0495624_0000149_33938_34804 280
241 3300048911 Ga0496108_0067813 Ga0496108_0067813_2043_2900 280
242 3300049588 Ga0501072_0547066 Ga0501072_0547066_27_875 280
243 3300005366 Ga0070659_100113577 Ga0070659_1001135772 281
244 3300005834 Ga0068851_10000138 Ga0068851_1000013821 281
245 3300006237 Ga0097621_100426589 Ga0097621_1004265892 281
246 3300006881 Ga0068865_100000009 Ga0068865_10000000969 281
247 3300013102 Ga0157371_10006368 Ga0157371_100063689 281
248 3300025321 Ga0207656_10003856 Ga0207656_100038565 281
249 3300025938 Ga0207704_10000009 Ga0207704_10000009174 281
250 3300046681 Ga0495647_0000492 Ga0495647_0000492_928_1806 281
251 3300053085 Ga0495619_0000745 Ga0495619_0000745_20259_21113 281
252 3300003203 JGI25406J46586_10035388 JGI25406J46586_100353882 282
253 3300005337 Ga0070682_100000040 Ga0070682_10000004079 282
254 3300005985 Ga0081539_10000615 Ga0081539_1000061557 282
255 3300013306 Ga0163162_10616904 Ga0163162_106169042 282
256 3300013307 Ga0157372_10000150 Ga0157372_1000015048 282
257 3300046516 Ga0495628_0002027 Ga0495628_0002027_11412_12266 282
258 3300046533 Ga0495640_0001957 Ga0495640_0001957_5995_6846 282
259 3300046642 Ga0495634_0030157 Ga0495634_0030157_1036_1896 282
260 3300047444 Ga0495675_0044576 Ga0495675_0044576_714_1604 282
261 3300048913 Ga0496110_0000170 Ga0496110_0000170_21210_22064 282
262 3300048914 Ga0496111_0000001 Ga0496111_0000001_61087_61941 282
263 3300053085 Ga0495619_0000018 Ga0495619_0000018_31397_32251 282
264 3300005337 Ga0070682_100158927 Ga0070682_1001589272 283
265 3300009551 Ga0105238_10469443 Ga0105238_104694431 283
266 3300020070 Ga0206356_10903912 Ga0206356_109039122 283
267 3300028379 Ga0268266_10456486 Ga0268266_104564862 283
268 3300048917 Ga0496114_0000080 Ga0496114_0000080_7909_8766 283
269 3300048918 Ga0496115_0000104 Ga0496115_0000104_50132_50989 283
270 3300053085 Ga0495619_0054315 Ga0495619_0054315_1563_2417 283
271 3300001977 JGI24746J21847_1000332 JGI24746J21847_10003324 284
272 3300005335 Ga0070666_10022667 Ga0070666_100226673 284
273 3300005548 Ga0070665_100029059 Ga0070665_1000290595 284
274 3300009101 Ga0105247_10124398 Ga0105247_101243982 284
275 3300009174 Ga0105241_10176536 Ga0105241_101765362 284
276 3300025900 Ga0207710_10063300 Ga0207710_100633002 284
277 3300025903 Ga0207680_10002641 Ga0207680_100026418 284
278 3300025924 Ga0207694_10448459 Ga0207694_104484592 284
279 3300025986 Ga0207658_10024437 Ga0207658_100244373 284
280 3300028379 Ga0268266_10001090 Ga0268266_1000109015 284
281 3300028379 Ga0268266_10009287 Ga0268266_100092876 284
282 3300044842 Ga0466957_0131630 Ga0466957_0131630_223_1089 284
283 3300046689 Ga0495613_0000175 Ga0495613_0000175_21980_22855 284
284 3300047317 Ga0495604_0002829 Ga0495604_0002829_7742_8617 284
285 3300048088 Ga0495602_0000063 Ga0495602_0000063_83891_84766 284
286 3300048929 Ga0496126_0067672 Ga0496126_0067672_47_922 284
287 3300053077 Ga0495601_0000041 Ga0495601_0000041_57235_58110 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

123

224

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8811 27 284
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8745 27 284
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8627 27 282
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8503 27 282
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.845 24 282
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6137 81 268 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5856 82 272 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5749 81 272 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4388 81 268 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4304 81 272 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A0E4H489-F1-model_v4 Transport permease protein 0.9413 22 284 GO:0005886
GO:0015920
GO:0140359
AF-A0A4T2GWK7-F1-model_v4 Transport permease protein 0.9372 27 284 GO:0005886
GO:0015920
GO:0140359
AF-A0A3A1Y3I8-F1-model_v4 LPS ABC transporter 0.9366 81 284 GO:0005886
GO:0015920
GO:0140359
AF-A0A6M1I7H6-F1-model_v4 deleted 0.9361 80 207
AF-A0A7L4WF67-F1-model_v4 Transport permease protein 0.935 25 284 GO:0005886
GO:0015920
GO:0016740
GO:0140359

Feature Viewer

pLDDT pTM Quality
85.98 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map