F387908

General Info

Members Datasets Scaffolds Average Seq Length
287 191 574 414

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100056253|Ga0070693_1000562531
Length 459
Sequence LAAFLRGVGRPPGDHALFVWNNQDAAVAAAHSVDPDRWWRSFGAVIDRIAPRFSRYEPVRHAAGLMLGMLSGLDRKNCWTIAEHRGDLTPDGLQHLLSRARWDADAVRDDLRDYVVEAFGDPGAILVADETGDVKKGTATVGVQRQYSGTAGRIENSQVAVFLTYAAPRGHALIDRALYVPTSWCEDPQRCDGAGIPADSREFATKPALARTLIDRAMAAKVPAAWVAGDEVYGADPALRAAIRSHRLGYVLAVAANRRVPTAAGPIRVDEIPALLPVRVWQKYSAGAGAKGHRRYSWAXITLQPEDDTDTGCHHLLVRRNDATGELAYLRCYSPRPVTLKTLVRVSGQRWRIEESFQAAKGLTGLDQHQVRRWTSWHRWTTLAMLAHAFLAVTTADQRDINRCPEGLITLTVNEFRHLFDALLLGARQRLTTLLHWSTWRRRHQHRSRQCHYRRREHQ

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
125 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
188 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
189 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
190 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
191 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 6.97
Rhizosphere 90.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100056253 3300005547 Bacteria 2270
2 JGI24739J22299_10043318 3300001989 Bacteria 1489
3 JGI24738J21930_10018887 3300002075 Bacteria 1439
4 JGI24744J21845_10016820 3300002077 Bacteria 1455
5 rootL2_10068467 3300003322 Bacteria 6056
6 Ga0070690_100157952 3300005330 Bacteria 1552
7 Ga0068868_100122218 3300005338 Bacteria 2125
8 Ga0068868_100194356 3300005338 Bacteria 1688
9 Ga0070691_10080234 3300005341 Bacteria 1596
10 Ga0070668_100180611 3300005347 Bacteria 1723
11 Ga0070668_100194026 3300005347 Bacteria 1664
12 Ga0070668_100217174 3300005347 Bacteria 1575
13 Ga0070675_100313509 3300005354 Bacteria 1384
14 Ga0070674_100135481 3300005356 Bacteria 1841
15 Ga0070688_100054738 3300005365 Bacteria 2500
16 Ga0070667_100256804 3300005367 Bacteria 1564
17 Ga0070709_10037816 3300005434 Bacteria 2950
18 Ga0070709_10141895 3300005434 Bacteria 1651
19 Ga0070714_100131011 3300005435 Bacteria 2241
20 Ga0070714_100290480 3300005435 Bacteria 1521
21 Ga0070713_100132865 3300005436 Bacteria 2196
22 Ga0070713_100141093 3300005436 Bacteria 2135
23 Ga0070710_10136731 3300005437 Bacteria 1499
24 Ga0070705_100108934 3300005440 Bacteria 1765
25 Ga0070705_100143743 3300005440 Bacteria 1573
26 Ga0070700_100032399 3300005441 Bacteria 3140
27 Ga0070708_100119946 3300005445 Bacteria 2425
28 Ga0070663_100163106 3300005455 Bacteria 1717
29 Ga0070706_100027820 3300005467 Bacteria 5201
30 Ga0070706_100040748 3300005467 Bacteria 4287
31 Ga0070707_100003248 3300005468 Bacteria 15405
32 Ga0070707_100081526 3300005468 Bacteria 3124
33 Ga0070698_100069274 3300005471 Bacteria 3542
34 Ga0070699_100050931 3300005518 Bacteria 3585
35 Ga0070697_100121358 3300005536 Bacteria 2186
36 Ga0070695_100116512 3300005545 Bacteria 1821
37 Ga0070696_100147448 3300005546 Bacteria 1724
38 Ga0070693_100074802 3300005547 Bacteria 2004
39 Ga0070693_100122178 3300005547 Bacteria 1616
40 Ga0070665_100331741 3300005548 Bacteria 1526
41 Ga0070704_100083618 3300005549 Bacteria 2357
42 Ga0070704_100217937 3300005549 Bacteria 1550
43 Ga0068857_100160087 3300005577 Bacteria 2042
44 Ga0068856_100270595 3300005614 Bacteria 1715
45 Ga0070702_100134209 3300005615 Bacteria 1568
46 Ga0068866_10005971 3300005718 Bacteria 5066
47 Ga0068866_10112708 3300005718 Bacteria 1520
48 Ga0068861_100144296 3300005719 Bacteria 1946
49 Ga0068860_100151583 3300005843 Bacteria 2232
50 Ga0068860_100304926 3300005843 Bacteria 1561
51 Ga0068862_100112172 3300005844 Bacteria 2394
52 Ga0068862_100176314 3300005844 Bacteria 1916
53 Ga0081538_10003538 3300005981 Bacteria 14694
54 Ga0070717_10041482 3300006028 Bacteria 3751
55 Ga0070715_10050727 3300006163 Bacteria 1782
56 Ga0070716_100065838 3300006173 Bacteria 2111
57 Ga0070712_100152720 3300006175 Bacteria 1775
58 Ga0068871_100129634 3300006358 Bacteria 2137
59 Ga0075428_100364662 3300006844 Bacteria 1550
60 Ga0075431_100398238 3300006847 Bacteria 1378
61 Ga0075433_10240026 3300006852 Bacteria 1609
62 Ga0075434_100002209 3300006871 Bacteria 16968
63 Ga0075434_100291025 3300006871 Bacteria 1653
64 Ga0068865_100130749 3300006881 Bacteria 1881
65 Ga0068865_100204564 3300006881 Bacteria 1535
66 Ga0075436_100139778 3300006914 Bacteria 1701
67 Ga0075435_100034057 3300007076 Bacteria 4032
68 Ga0075435_100079991 3300007076 Bacteria 2683
69 Ga0075435_100133473 3300007076 Bacteria 2078
70 Ga0105250_10026877 3300009092 Bacteria 2319
71 Ga0111539_10343809 3300009094 Bacteria 1736
72 Ga0105245_10276251 3300009098 Bacteria 1640
73 Ga0105245_10285157 3300009098 Bacteria 1616
74 Ga0114129_10043687 3300009147 Bacteria 6305
75 Ga0114129_10445445 3300009147 Bacteria 1699
76 Ga0105243_10053662 3300009148 Bacteria 3198
77 Ga0105243_10144398 3300009148 Bacteria 2034
78 Ga0105243_10197395 3300009148 Bacteria 1762
79 Ga0105243_10265370 3300009148 Bacteria 1539
80 Ga0105242_10116850 3300009176 Bacteria 2283
81 Ga0105242_10133320 3300009176 Bacteria 2147
82 Ga0105248_10111919 3300009177 Bacteria 3079
83 Ga0105248_10446725 3300009177 Bacteria 1457
84 Ga0105237_10182324 3300009545 Bacteria 2099
85 Ga0105237_10253240 3300009545 Bacteria 1763
86 Ga0105249_10207272 3300009553 Bacteria 1921
87 Ga0105239_10189913 3300010375 Bacteria 2299
88 Ga0157374_10103734 3300013296 Bacteria 2729
89 Ga0157378_10213597 3300013297 Bacteria 1830
90 Ga0157378_10253125 3300013297 Bacteria 1687
91 Ga0163162_10297784 3300013306 Bacteria 1745
92 Ga0157372_10310457 3300013307 Bacteria 1835
93 Ga0163163_10294657 3300014325 Bacteria 1675
94 Ga0224572_1012619 3300024225 Bacteria 1608
95 Ga0207692_10122729 3300025898 Bacteria 1457
96 Ga0207642_10094662 3300025899 Bacteria 1484
97 Ga0207688_10046405 3300025901 Bacteria 2426
98 Ga0207688_10114754 3300025901 Bacteria 1567
99 Ga0207645_10109441 3300025907 Bacteria 1788
100 Ga0207684_10130415 3300025910 Bacteria 2158
101 Ga0207671_10177631 3300025914 Bacteria 1656
102 Ga0207671_10184419 3300025914 Bacteria 1625
103 Ga0207693_10004057 3300025915 Bacteria 12449
104 Ga0207663_10156949 3300025916 Bacteria 1602
105 Ga0207657_10052410 3300025919 Bacteria 3541
106 Ga0207646_10006610 3300025922 Bacteria 11970
107 Ga0207646_10168066 3300025922 Bacteria 1980
108 Ga0207659_10193128 3300025926 Bacteria 1621
109 Ga0207687_10222921 3300025927 Bacteria 1486
110 Ga0207687_10232376 3300025927 Bacteria 1457
111 Ga0207700_10306853 3300025928 Bacteria 1372
112 Ga0207664_10000752 3300025929 Bacteria 22041
113 Ga0207664_10124354 3300025929 Bacteria 2163
114 Ga0207664_10149913 3300025929 Bacteria 1980
115 Ga0207706_10010434 3300025933 Bacteria 8489
116 Ga0207706_10049888 3300025933 Bacteria 3699
117 Ga0207709_10151830 3300025935 Bacteria 1605
118 Ga0207704_10173287 3300025938 Bacteria 1550
119 Ga0207704_10204939 3300025938 Bacteria 1447
120 Ga0207665_10085629 3300025939 Bacteria 2176
121 Ga0207665_10129462 3300025939 Bacteria 1790
122 Ga0207711_10158778 3300025941 Bacteria 2045
123 Ga0207689_10083841 3300025942 Bacteria 2620
124 Ga0207661_10252007 3300025944 Bacteria 1569
125 Ga0207679_10236907 3300025945 Bacteria 1544
126 Ga0207712_10207569 3300025961 Bacteria 1558
127 Ga0207678_10019519 3300026067 Bacteria 5956
128 Ga0207678_10210475 3300026067 Bacteria 1663
129 Ga0207708_10085654 3300026075 Bacteria 2424
130 Ga0207702_10290725 3300026078 Bacteria 1548
131 Ga0207648_10244104 3300026089 Bacteria 1600
132 Ga0207676_10293961 3300026095 Bacteria 1480
133 Ga0207674_10174985 3300026116 Bacteria 2099
134 Ga0207675_100139895 3300026118 Bacteria 2299
135 Ga0207683_10214363 3300026121 Bacteria 1753
136 Ga0268266_10301019 3300028379 Bacteria 1496
137 Ga0268264_10279188 3300028381 Bacteria 1564
138 Ga0268264_10322059 3300028381 Bacteria 1462
139 Ga0307508_10145251 3300031616 Bacteria 1976
140 Ga0307405_10087844 3300031731 Bacteria 2050
141 Ga0307405_10106164 3300031731 Bacteria 1893
142 Ga0307410_10167603 3300031852 Bacteria 1652
143 Ga0307410_10203080 3300031852 Bacteria 1514
144 Ga0307406_10122543 3300031901 Bacteria 1810
145 Ga0307406_10184886 3300031901 Bacteria 1520
146 Ga0307407_10031180 3300031903 Bacteria 2884
147 Ga0307409_100283081 3300031995 Bacteria 1533
148 Ga0307409_100302484 3300031995 Bacteria 1489
149 Ga0307414_10231092 3300032004 Bacteria 1525
150 Ga0307415_100215038 3300032126 Bacteria 1536
151 Ga0373926_0000934 3300035083 Bacteria 8442
152 Ga0373944_0025095 3300035089 Bacteria 1752
153 Ga0373923_0018910 3300035111 Bacteria 2660
154 Ga0373923_0099288 3300035111 Bacteria 1282
155 Ga0373945_0043602 3300035116 Bacteria 1628
156 Ga0373956_0069824 3300035119 Bacteria 1602
157 Ga0373943_0014523 3300035170 Bacteria 3567
158 Ga0373943_0057189 3300035170 Bacteria 1937
159 Ga0373946_0024123 3300035171 Bacteria 2380
160 Ga0373946_0074992 3300035171 Bacteria 1469
161 Ga0373955_0126453 3300035172 Bacteria 1489
162 Ga0373935_0071105 3300035692 Bacteria 2244
163 Ga0373935_0095715 3300035692 Bacteria 1950
164 Ga0373927_0132718 3300035695 Bacteria 1627
165 Ga0373947_0043975 3300035725 Bacteria 2669
166 Ga0373947_0051122 3300035725 Bacteria 2486
167 Ga0373947_0064027 3300035725 Bacteria 2241
168 Ga0373947_0115896 3300035725 Bacteria 1698
169 Ga0373947_0185082 3300035725 Bacteria 1357
170 Ga0373947_0234117 3300035725 Bacteria 1210
171 Ga0373925_0167638 3300037068 Bacteria 1732
172 Ga0373925_0167960 3300037068 Bacteria 1731
173 Ga0373925_0168447 3300037068 Bacteria 1728
174 Ga0373925_0203101 3300037068 Bacteria 1576
175 Ga0373925_0248018 3300037068 Bacteria 1427
176 Ga0395905_0262039 3300037471 Bacteria 1614
177 Ga0436364_1311490 3300037853 Bacteria 1695
178 Ga0395901_0148411 3300038443 Bacteria 2464
179 Ga0436360_0740982 3300039438 Bacteria 1759
180 Ga0439450_008227 3300042008 Bacteria 1940
181 Ga0439440_0004749 3300042993 Bacteria 2678
182 Ga0466963_0120292 3300044694 Bacteria 1806
183 Ga0466963_0152198 3300044694 Bacteria 1607
184 Ga0466957_0160855 3300044842 Bacteria 1458
185 Ga0466967_0002099 3300045976 Bacteria 12217
186 Ga0466967_0233756 3300045976 Bacteria 1751
187 Ga0495592_0149322 3300046454 Bacteria 1618
188 Ga0495603_0114765 3300046455 Bacteria 1570
189 Ga0495603_0125875 3300046455 Bacteria 1493
190 Ga0495629_0054154 3300046459 Bacteria 2806
191 Ga0495653_0168870 3300046463 Bacteria 1512
192 Ga0495653_0216092 3300046463 Bacteria 1292
193 Ga0495580_0073609 3300046472 Bacteria 2385
194 Ga0495580_0121658 3300046472 Bacteria 1812
195 Ga0495582_0095068 3300046473 Bacteria 1664
196 Ga0495639_0087827 3300046475 Bacteria 1455
197 Ga0495662_0023982 3300046476 Bacteria 2944
198 Ga0495664_0081415 3300046477 Bacteria 1941
199 Ga0495594_0069223 3300046499 Bacteria 1960
200 Ga0495618_0123072 3300046514 Bacteria 1661
201 Ga0495630_0159335 3300046517 Bacteria 1718
202 Ga0495630_0160110 3300046517 Bacteria 1714
203 Ga0495630_0206264 3300046517 Bacteria 1500
204 Ga0495652_0102645 3300046529 Bacteria 2316
205 Ga0495652_0200364 3300046529 Bacteria 1515
206 Ga0495652_0207026 3300046529 Bacteria 1484
207 Ga0495665_0062592 3300046531 Bacteria 1964
208 Ga0495640_0188086 3300046533 Bacteria 1313
209 Ga0495586_0140549 3300046535 Bacteria 1355
210 Ga0495587_0114727 3300046536 Bacteria 1545
211 Ga0495645_0090460 3300046543 Bacteria 2187
212 Ga0495645_0155902 3300046543 Bacteria 1582
213 Ga0495667_0078629 3300046559 Bacteria 2144
214 Ga0495667_0082266 3300046559 Bacteria 2092
215 Ga0495667_0093363 3300046559 Bacteria 1948
216 Ga0495667_0113731 3300046559 Bacteria 1749
217 Ga0495634_0078967 3300046642 Bacteria 2155
218 Ga0495635_0121502 3300046663 Bacteria 1781
219 Ga0495635_0143973 3300046663 Bacteria 1623
220 Ga0495657_0128756 3300046675 Bacteria 1587
221 Ga0495599_0125943 3300046678 Bacteria 1592
222 Ga0495646_0073866 3300046680 Bacteria 2002
223 Ga0495613_0227514 3300046689 Bacteria 1307
224 Ga0495581_0059122 3300047315 Bacteria 2214
225 Ga0495674_0185015 3300047319 Bacteria 1733
226 Ga0495674_0219162 3300047319 Bacteria 1573
227 Ga0495680_0152378 3300047322 Bacteria 1684
228 Ga0495680_0187698 3300047322 Bacteria 1488
229 Ga0495684_0168655 3300047471 Bacteria 1629
230 Ga0495684_0187993 3300047471 Bacteria 1528
231 Ga0495593_0026148 3300047673 Bacteria 3225
232 Ga0495593_0062861 3300047673 Bacteria 1940
233 Ga0495602_0101753 3300048088 Bacteria 2356
234 Ga0495602_0103975 3300048088 Bacteria 2324
235 Ga0495614_0080241 3300048089 Bacteria 1413
236 Ga0496100_0173596 3300048903 Bacteria 1554
237 Ga0496100_0202808 3300048903 Bacteria 1446
238 Ga0496101_0109361 3300048904 Bacteria 2079
239 Ga0496101_0165237 3300048904 Bacteria 1699
240 Ga0496102_0000094 3300048905 Bacteria 125159
241 Ga0496102_0192605 3300048905 Bacteria 1921
242 Ga0496103_0000042 3300048906 Bacteria 168701
243 Ga0496103_0040654 3300048906 Bacteria 2857
244 Ga0496105_0240482 3300048908 Bacteria 1469
245 Ga0496106_0201132 3300048909 Bacteria 1585
246 Ga0496106_0228821 3300048909 Bacteria 1484
247 Ga0496108_0191756 3300048911 Bacteria 1771
248 Ga0496108_0224248 3300048911 Bacteria 1633
249 Ga0496109_0232861 3300048912 Bacteria 1733
250 Ga0496111_0008530 3300048914 Bacteria 6790
251 Ga0496112_0290954 3300048915 Bacteria 1579
252 Ga0496114_0117053 3300048917 Bacteria 2289
253 Ga0496114_0159827 3300048917 Bacteria 1958
254 Ga0496115_0132521 3300048918 Bacteria 2054
255 Ga0496115_0208315 3300048918 Bacteria 1615
256 Ga0496121_0061127 3300048924 Bacteria 3093
257 Ga0501034_0204301 3300049571 Bacteria 1932
258 Ga0501042_0030629 3300049578 Bacteria 3801
259 Ga0501044_0231053 3300049823 Bacteria 1797
260 nmdc:mga05p37_25431_c1 3300050507 Bacteria 7200
261 nmdc:mga05p37_378351_c1 3300050507 Bacteria 1660
262 nmdc:mga06r32_314809_c1 3300050510 Bacteria 1551
263 nmdc:mga08y16_127037_c1 3300050511 Bacteria 2652
264 nmdc:mga0n895_239074_c1 3300050512 Bacteria 1843
265 nmdc:mga0n895_343283_c1 3300050512 Bacteria 1512
266 nmdc:mga0n895_366576_c1 3300050512 Bacteria 1459
267 nmdc:mga0n895_414322_c1 3300050512 Bacteria 1362
268 nmdc:mga0rr50_126465_c1 3300050513 Bacteria 2042
269 nmdc:mga0rr50_214063_c1 3300050513 Bacteria 1589
270 nmdc:mga0rr50_77043_c1 3300050513 Bacteria 2561
271 nmdc:mga08x19_121861_c1 3300050514 Bacteria 1749
272 nmdc:mga08x19_143177_c1 3300050514 Bacteria 1616
273 nmdc:mga0a205_259937_c1 3300050515 Bacteria 1614
274 nmdc:mga0a205_93115_c1 3300050515 Bacteria 2912
275 Ga0495601_0148621 3300053077 Bacteria 1529
276 Ga0495619_0160952 3300053085 Bacteria 1550
277 Ga0500644_0018823 3300053088 Bacteria 2029
278 Ga0500561_0023268 3300053137 Bacteria 1483
279 2515759785 2515154137 Bacteria 5711575
280 2515759801 2515154137 Bacteria 5711575
281 2623587031 2622736626 Bacteria 7181580
282 2623587613 2622736626 Bacteria 7181580
283 2623588093 2622736626 Bacteria 7181580
284 2623588360 2622736626 Bacteria 7181580
285 2623590520 2622736626 Bacteria 7181580
286 2996228236 2996221748 Bacteria 6799777
287 8054473049 8054472261 Bacteria 7464355
288 Ga0070693_100056253
289 JGI24739J22299_10043318
290 JGI24738J21930_10018887
291 JGI24744J21845_10016820
292 rootL2_10068467
293 Ga0070690_100157952
294 Ga0068868_100122218
295 Ga0068868_100194356
296 Ga0070691_10080234
297 Ga0070668_100180611
298 Ga0070668_100194026
299 Ga0070668_100217174
300 Ga0070675_100313509
301 Ga0070674_100135481
302 Ga0070688_100054738
303 Ga0070667_100256804
304 Ga0070709_10037816
305 Ga0070709_10141895
306 Ga0070714_100131011
307 Ga0070714_100290480
308 Ga0070713_100132865
309 Ga0070713_100141093
310 Ga0070710_10136731
311 Ga0070705_100108934
312 Ga0070705_100143743
313 Ga0070700_100032399
314 Ga0070708_100119946
315 Ga0070663_100163106
316 Ga0070706_100027820
317 Ga0070706_100040748
318 Ga0070707_100003248
319 Ga0070707_100081526
320 Ga0070698_100069274
321 Ga0070699_100050931
322 Ga0070697_100121358
323 Ga0070695_100116512
324 Ga0070696_100147448
325 Ga0070693_100074802
326 Ga0070693_100122178
327 Ga0070665_100331741
328 Ga0070704_100083618
329 Ga0070704_100217937
330 Ga0068857_100160087
331 Ga0068856_100270595
332 Ga0070702_100134209
333 Ga0068866_10005971
334 Ga0068866_10112708
335 Ga0068861_100144296
336 Ga0068860_100151583
337 Ga0068860_100304926
338 Ga0068862_100112172
339 Ga0068862_100176314
340 Ga0081538_10003538
341 Ga0070717_10041482
342 Ga0070715_10050727
343 Ga0070716_100065838
344 Ga0070712_100152720
345 Ga0068871_100129634
346 Ga0075428_100364662
347 Ga0075431_100398238
348 Ga0075433_10240026
349 Ga0075434_100002209
350 Ga0075434_100291025
351 Ga0068865_100130749
352 Ga0068865_100204564
353 Ga0075436_100139778
354 Ga0075435_100034057
355 Ga0075435_100079991
356 Ga0075435_100133473
357 Ga0105250_10026877
358 Ga0111539_10343809
359 Ga0105245_10276251
360 Ga0105245_10285157
361 Ga0114129_10043687
362 Ga0114129_10445445
363 Ga0105243_10053662
364 Ga0105243_10144398
365 Ga0105243_10197395
366 Ga0105243_10265370
367 Ga0105242_10116850
368 Ga0105242_10133320
369 Ga0105248_10111919
370 Ga0105248_10446725
371 Ga0105237_10182324
372 Ga0105237_10253240
373 Ga0105249_10207272
374 Ga0105239_10189913
375 Ga0157374_10103734
376 Ga0157378_10213597
377 Ga0157378_10253125
378 Ga0163162_10297784
379 Ga0157372_10310457
380 Ga0163163_10294657
381 Ga0224572_1012619
382 Ga0207692_10122729
383 Ga0207642_10094662
384 Ga0207688_10046405
385 Ga0207688_10114754
386 Ga0207645_10109441
387 Ga0207684_10130415
388 Ga0207671_10177631
389 Ga0207671_10184419
390 Ga0207693_10004057
391 Ga0207663_10156949
392 Ga0207657_10052410
393 Ga0207646_10006610
394 Ga0207646_10168066
395 Ga0207659_10193128
396 Ga0207687_10222921
397 Ga0207687_10232376
398 Ga0207700_10306853
399 Ga0207664_10000752
400 Ga0207664_10124354
401 Ga0207664_10149913
402 Ga0207706_10010434
403 Ga0207706_10049888
404 Ga0207709_10151830
405 Ga0207704_10173287
406 Ga0207704_10204939
407 Ga0207665_10085629
408 Ga0207665_10129462
409 Ga0207711_10158778
410 Ga0207689_10083841
411 Ga0207661_10252007
412 Ga0207679_10236907
413 Ga0207712_10207569
414 Ga0207678_10019519
415 Ga0207678_10210475
416 Ga0207708_10085654
417 Ga0207702_10290725
418 Ga0207648_10244104
419 Ga0207676_10293961
420 Ga0207674_10174985
421 Ga0207675_100139895
422 Ga0207683_10214363
423 Ga0268266_10301019
424 Ga0268264_10279188
425 Ga0268264_10322059
426 Ga0307508_10145251
427 Ga0307405_10087844
428 Ga0307405_10106164
429 Ga0307410_10167603
430 Ga0307410_10203080
431 Ga0307406_10122543
432 Ga0307406_10184886
433 Ga0307407_10031180
434 Ga0307409_100283081
435 Ga0307409_100302484
436 Ga0307414_10231092
437 Ga0307415_100215038
438 Ga0373926_0000934
439 Ga0373944_0025095
440 Ga0373923_0018910
441 Ga0373923_0099288
442 Ga0373945_0043602
443 Ga0373956_0069824
444 Ga0373943_0014523
445 Ga0373943_0057189
446 Ga0373946_0024123
447 Ga0373946_0074992
448 Ga0373955_0126453
449 Ga0373935_0071105
450 Ga0373935_0095715
451 Ga0373927_0132718
452 Ga0373947_0043975
453 Ga0373947_0051122
454 Ga0373947_0064027
455 Ga0373947_0115896
456 Ga0373947_0185082
457 Ga0373947_0234117
458 Ga0373925_0167638
459 Ga0373925_0167960
460 Ga0373925_0168447
461 Ga0373925_0203101
462 Ga0373925_0248018
463 Ga0395905_0262039
464 Ga0436364_1311490
465 Ga0395901_0148411
466 Ga0436360_0740982
467 Ga0439450_008227
468 Ga0439440_0004749
469 Ga0466963_0120292
470 Ga0466963_0152198
471 Ga0466957_0160855
472 Ga0466967_0002099
473 Ga0466967_0233756
474 Ga0495592_0149322
475 Ga0495603_0114765
476 Ga0495603_0125875
477 Ga0495629_0054154
478 Ga0495653_0168870
479 Ga0495653_0216092
480 Ga0495580_0073609
481 Ga0495580_0121658
482 Ga0495582_0095068
483 Ga0495639_0087827
484 Ga0495662_0023982
485 Ga0495664_0081415
486 Ga0495594_0069223
487 Ga0495618_0123072
488 Ga0495630_0159335
489 Ga0495630_0160110
490 Ga0495630_0206264
491 Ga0495652_0102645
492 Ga0495652_0200364
493 Ga0495652_0207026
494 Ga0495665_0062592
495 Ga0495640_0188086
496 Ga0495586_0140549
497 Ga0495587_0114727
498 Ga0495645_0090460
499 Ga0495645_0155902
500 Ga0495667_0078629
501 Ga0495667_0082266
502 Ga0495667_0093363
503 Ga0495667_0113731
504 Ga0495634_0078967
505 Ga0495635_0121502
506 Ga0495635_0143973
507 Ga0495657_0128756
508 Ga0495599_0125943
509 Ga0495646_0073866
510 Ga0495613_0227514
511 Ga0495581_0059122
512 Ga0495674_0185015
513 Ga0495674_0219162
514 Ga0495680_0152378
515 Ga0495680_0187698
516 Ga0495684_0168655
517 Ga0495684_0187993
518 Ga0495593_0026148
519 Ga0495593_0062861
520 Ga0495602_0101753
521 Ga0495602_0103975
522 Ga0495614_0080241
523 Ga0496100_0173596
524 Ga0496100_0202808
525 Ga0496101_0109361
526 Ga0496101_0165237
527 Ga0496102_0000094
528 Ga0496102_0192605
529 Ga0496103_0000042
530 Ga0496103_0040654
531 Ga0496105_0240482
532 Ga0496106_0201132
533 Ga0496106_0228821
534 Ga0496108_0191756
535 Ga0496108_0224248
536 Ga0496109_0232861
537 Ga0496111_0008530
538 Ga0496112_0290954
539 Ga0496114_0117053
540 Ga0496114_0159827
541 Ga0496115_0132521
542 Ga0496115_0208315
543 Ga0496121_0061127
544 Ga0501034_0204301
545 Ga0501042_0030629
546 Ga0501044_0231053
547 nmdc:mga05p37_25431_c1
548 nmdc:mga05p37_378351_c1
549 nmdc:mga06r32_314809_c1
550 nmdc:mga08y16_127037_c1
551 nmdc:mga0n895_239074_c1
552 nmdc:mga0n895_343283_c1
553 nmdc:mga0n895_366576_c1
554 nmdc:mga0n895_414322_c1
555 nmdc:mga0rr50_126465_c1
556 nmdc:mga0rr50_214063_c1
557 nmdc:mga0rr50_77043_c1
558 nmdc:mga08x19_121861_c1
559 nmdc:mga08x19_143177_c1
560 nmdc:mga0a205_259937_c1
561 nmdc:mga0a205_93115_c1
562 Ga0495601_0148621
563 Ga0495619_0160952
564 Ga0500644_0018823
565 Ga0500561_0023268
566 2515759785
567 2515759801
568 2623587031
569 2623587613
570 2623588093
571 2623588360
572 2623590520
573 2996228236
574 8054473049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13546

DDE_5

DDE superfamily endonuclease

48

271

0.95

PF01609

DDE_Tnp_1

Transposase DDE domain

191

390

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jca-assembly1.cif.gz_S nadp(h) bound nadh-dependent ferredoxin:nadp oxidoreductase (nfni) from pyrococcus furiosus 0.7255 183 240
1asv-assembly1.cif.gz_A avian sarcoma virus integrase catalytic core domain 0.673 95 222
3o4q-assembly1.cif.gz_A-2 crystal structure of the rous associated virus integrase catalytic domain a182t in citrate buffer ph 6.2 0.6721 95 222
3ecp-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with 5' phosphorylated transposon end dna 0.6452 13 342
1mus-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with resolved outside end dna 0.6443 13 343
ID Description Score Start End Superfamily
af_O53342_111_299_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7144 196 225 3.40.50.720
af_Q8I535_139_271_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7107 180 224 3.40.50.980
af_A0A1D8PN68_2_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6591 195 227 3.40.50.720
af_P9WNX9_1_452_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6568 184 229 3.40.605.10
af_A0A0R0E6K5_147_221_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6463 97 193 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4R3DKE5-F1-model_v4 deleted 0.9584 185 329
AF-A0A7W5YNG4-F1-model_v4 Transposase IS701-like DDE domain-containing protein 0.9553 203 318
AF-A0A4R3DKE5-F1-model_v4 deleted 0.9456 185 329
AF-A0A640T4W4-F1-model_v4 Transposase IS701-like DDE domain-containing protein 0.9346 176 321
AF-A0A656WPT6-F1-model_v4 deleted 0.9313 10 96

Map