F387842

General Info

Members Datasets Scaffolds Average Seq Length
287 163 260 133

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_101197952|Ga0070660_1011979522
Length 152
Sequence MIHEPLTPRQMSPTPKSWAMLHTKCPRCRRGSMFSGGTYNLGSNKIHEHCPHCNLHFEIEPGYFYAAMYVSYALNVAEAFCIVALTYLLTHNSDSPWLYSGTILAGCLLLSPLNFRYSRVFLLYWLSPKINYQPHLDIDDTTPYLFFKRTGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2739367656 Pedobacter sp. CF523 Isolate Unclassified
9 2739367663 Pedobacter sp. YR510 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
20 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
21 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
22 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
23 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
24 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
27 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
28 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
108 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
109 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
110 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
158 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
161 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
162 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.24
Metatranscriptomes 0.35
Isolates 9.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 0
Rhizoplane 1.74
Rhizosphere 75.61
Stem 0
Stem Tuber 0
Unclassified 10.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1948121 2162886007 Bacteria 77420
2 SwRhRL2b_contig_2653925 2162886007 Bacteria 1028
3 SwRhRL2b_contig_3050470 2162886007 Bacteria 1439
4 JGI24741J21665_1028544 3300001915 Bacteria 841
5 JGI24739J22299_10019431 3300001989 Bacteria 2432
6 JGI24737J22298_10000384 3300001990 Bacteria 15070
7 JGI24737J22298_10000621 3300001990 Bacteria 12491
8 JGI24735J21928_10000002 3300002067 Bacteria 624895
9 JGI24735J21928_10000003 3300002067 Bacteria 385983
10 JGI25162J39368_1003251 3300002737 Bacteria 4970
11 JGI25164J39214_1001374 3300002772 Bacteria 5851
12 JGI25164J39214_1001394 3300002772 Bacteria 5754
13 JGI25152J39213_1000050 3300002773 Bacteria 79659
14 JGI25150J39212_1000003 3300002774 Bacteria 508651
15 JGI25151J46595_10000002 3300003187 Bacteria 731381
16 JGI25165J46597_1000657 3300003214 Bacteria 28325
17 JGI25153J46596_10000030 3300003215 Bacteria 200879
18 rootH2_10015286 3300003320 Bacteria 4264
19 rootH2_10122632 3300003320 Bacteria 2010
20 rootH2_10198426 3300003320 Bacteria 2710
21 rootH2_10212417 3300003320 Bacteria 1686
22 rootH2_10231543 3300003320 Bacteria 6041
23 rootH2_10240595 3300003320 Bacteria 2318
24 rootL2_10237375 3300003322 Bacteria 3904
25 rootH1_10004106 3300003323 Bacteria 40486
26 rootH1_10103003 3300003323 Bacteria 3191
27 rootH1_10110641 3300003323 Bacteria 4865
28 rootH1_10113579 3300003323 Bacteria 9394
29 Ga0055536_1000010 3300003781 Bacteria 304614
30 Ga0055530_10001828 3300003791 Bacteria 14689
31 Ga0065714_10002223 3300005288 Bacteria 65955
32 Ga0065714_10002398 3300005288 Bacteria 45890
33 Ga0065714_10002497 3300005288 Bacteria 28272
34 Ga0065714_10003517 3300005288 Bacteria 14276
35 Ga0065714_10068399 3300005288 Bacteria 4754
36 Ga0065714_10086042 3300005288 Bacteria 2120
37 Ga0065714_10098688 3300005288 Bacteria 1691
38 Ga0065704_10070196 3300005289 Bacteria 94899
39 Ga0065704_10084452 3300005289 Bacteria 3333
40 Ga0065704_10086284 3300005289 Bacteria 3136
41 Ga0065704_10152884 3300005289 Bacteria 1411
42 Ga0070660_100003098 3300005339 Bacteria 11425
43 Ga0070660_101197952 3300005339 Bacteria 644
44 Ga0070659_100000199 3300005366 Bacteria 46342
45 Ga0070684_101026058 3300005535 Bacteria 774
46 Ga0068855_100000098 3300005563 Bacteria 105977
47 Ga0068855_100086502 3300005563 Bacteria 3625
48 Ga0068857_100078838 3300005577 Bacteria 2940
49 Ga0068857_100497142 3300005577 Bacteria 1144
50 Ga0068854_100017497 3300005578 Bacteria 4796
51 Ga0068856_100000120 3300005614 Bacteria 78280
52 Ga0068856_100764311 3300005614 Bacteria 986
53 Ga0068852_100131027 3300005616 Bacteria 2309
54 Ga0068864_101778149 3300005618 Unclassified 621
55 Ga0068858_100075677 3300005842 Bacteria 3127
56 Ga0075366_10093129 3300006195 Bacteria 1806
57 Ga0075370_10243925 3300006353 Bacteria 1064
58 Ga0068871_101516619 3300006358 Bacteria 633
59 Ga0105240_10000371 3300009093 Bacteria 84390
60 Ga0105240_10259190 3300009093 Unclassified 2007
61 Ga0105240_10582682 3300009093 Bacteria 1234
62 Ga0105240_10639413 3300009093 Bacteria 1167
63 Ga0105240_11984857 3300009093 Bacteria 605
64 Ga0105241_10000733 3300009174 Bacteria 24893
65 Ga0105241_10025697 3300009174 Bacteria 4377
66 Ga0105241_10878636 3300009174 Bacteria 831
67 Ga0105237_10000072 3300009545 Bacteria 135507
68 Ga0105237_10002461 3300009545 Bacteria 22986
69 Ga0105237_10021894 3300009545 Bacteria 6565
70 Ga0105237_10586560 3300009545 Bacteria 1121
71 Ga0105237_10846917 3300009545 Bacteria 921
72 Ga0105238_10142338 3300009551 Unclassified 2375
73 Ga0105238_10230707 3300009551 Bacteria 1828
74 Ga0105238_11871090 3300009551 Bacteria 633
75 Ga0105239_10000012 3300010375 Bacteria 332279
76 Ga0105239_10000049 3300010375 Bacteria 177578
77 Ga0105239_10000086 3300010375 Bacteria 129798
78 Ga0105239_10000547 3300010375 Bacteria 53884
79 Ga0105239_10001074 3300010375 Bacteria 37985
80 Ga0105239_10001768 3300010375 Bacteria 28424
81 Ga0105239_10002795 3300010375 Bacteria 21842
82 Ga0157373_10000125 3300013100 Bacteria 59653
83 Ga0157373_10012786 3300013100 Bacteria 6167
84 Ga0157373_10177328 3300013100 Bacteria 1500
85 Ga0157373_10459648 3300013100 Bacteria 917
86 Ga0157371_10000143 3300013102 Bacteria 103796
87 Ga0157371_10000575 3300013102 Bacteria 43514
88 Ga0157371_10002309 3300013102 Bacteria 18350
89 Ga0157370_10000125 3300013104 Bacteria 91078
90 Ga0157370_10009756 3300013104 Bacteria 10193
91 Ga0157370_10018164 3300013104 Bacteria 7077
92 Ga0157370_10034592 3300013104 Bacteria 4917
93 Ga0157370_10045619 3300013104 Bacteria 4204
94 Ga0157370_10073745 3300013104 Bacteria 3220
95 Ga0157370_10104830 3300013104 Bacteria 2647
96 Ga0157369_10000023 3300013105 Bacteria 226955
97 Ga0157369_10003292 3300013105 Bacteria 19216
98 Ga0157374_12828948 3300013296 Bacteria 513
99 Ga0157378_10030943 3300013297 Bacteria 4725
100 Ga0157378_10046222 3300013297 Bacteria 3870
101 Ga0163162_10005211 3300013306 Bacteria 12536
102 Ga0157372_10000190 3300013307 Bacteria 67909
103 Ga0157372_10002106 3300013307 Bacteria 21657
104 Ga0157375_11293012 3300013308 Bacteria 857
105 Ga0157375_12564866 3300013308 Bacteria 609
106 Ga0182008_10000002 3300014497 Bacteria 480216
107 Ga0182008_10000122 3300014497 Bacteria 58755
108 Ga0157376_11315256 3300014969 Bacteria 753
109 Ga0182006_1000064 3300015261 Bacteria 153418
110 Ga0182006_1000089 3300015261 Bacteria 110375
111 Ga0182006_1000870 3300015261 Bacteria 20258
112 Ga0182006_1203899 3300015261 Bacteria 655
113 Ga0182007_10000009 3300015262 Bacteria 316298
114 Ga0183373_1009 3300015682 Bacteria 210158
115 Ga0163161_10000090 3300017792 Bacteria 90964
116 Ga0163161_10000877 3300017792 Bacteria 23421
117 Ga0163161_10018221 3300017792 Bacteria 4922
118 Ga0163161_10040258 3300017792 Bacteria 3356
119 Ga0163161_11990188 3300017792 Bacteria 517
120 Ga0206351_10928506 3300020077 Bacteria 1452
121 Ga0207427_100131 3300025231 Bacteria 93947
122 Ga0209437_100048 3300025233 Bacteria 405107
123 Ga0209437_100102 3300025233 Bacteria 224216
124 Ga0209437_100299 3300025233 Bacteria 69659
125 Ga0207425_1000003 3300025245 Bacteria 1145342
126 Ga0209026_1000683 3300025250 Bacteria 20446
127 Ga0209026_1001195 3300025250 Bacteria 12026
128 Ga0209129_1000014 3300025258 Bacteria 509018
129 Ga0209129_1012036 3300025258 Bacteria 2018
130 Ga0209233_1000029 3300025261 Bacteria 641642
131 Ga0209233_1005686 3300025261 Bacteria 4114
132 Ga0209676_1000009 3300025292 Bacteria 981719
133 Ga0209025_1000007 3300025294 Bacteria 1145109
134 Ga0209758_1000012 3300025297 Bacteria 949866
135 Ga0209050_1000190 3300025298 Bacteria 138532
136 Ga0207647_10099079 3300025904 Bacteria 1731
137 Ga0207647_10142545 3300025904 Bacteria 1404
138 Ga0207654_10010794 3300025911 Bacteria 4650
139 Ga0207654_10015784 3300025911 Bacteria 3925
140 Ga0207654_10273614 3300025911 Bacteria 1140
141 Ga0207695_10000055 3300025913 Bacteria 382776
142 Ga0207695_10000142 3300025913 Bacteria 214715
143 Ga0207695_10488475 3300025913 Bacteria 1113
144 Ga0207671_10000110 3300025914 Bacteria 126480
145 Ga0207671_10000451 3300025914 Bacteria 56763
146 Ga0207671_10000653 3300025914 Bacteria 45335
147 Ga0207671_10003258 3300025914 Bacteria 16326
148 Ga0207671_10007886 3300025914 Bacteria 9142
149 Ga0207671_10050616 3300025914 Bacteria 3076
150 Ga0207671_11001632 3300025914 Bacteria 658
151 Ga0207657_10011218 3300025919 Bacteria 8909
152 Ga0207694_10084740 3300025924 Unclassified 2493
153 Ga0207694_10424541 3300025924 Bacteria 1108
154 Ga0207690_10000744 3300025932 Bacteria 21044
155 Ga0207667_10000014 3300025949 Bacteria 421261
156 Ga0207667_10142832 3300025949 Bacteria 2465
157 Ga0207640_10029925 3300025981 Bacteria 3349
158 Ga0207640_10097285 3300025981 Bacteria 2054
159 Ga0207640_10141533 3300025981 Bacteria 1754
160 Ga0207703_10143270 3300026035 Bacteria 2076
161 Ga0207639_10832122 3300026041 Bacteria 861
162 Ga0207702_10000195 3300026078 Bacteria 71757
163 Ga0207702_10066745 3300026078 Bacteria 3085
164 Ga0207702_10716467 3300026078 Bacteria 986
165 Ga0207676_11780829 3300026095 Unclassified 614
166 Ga0207674_10374081 3300026116 Bacteria 1377
167 Ga0207674_10505179 3300026116 Bacteria 1168
168 Ga0207698_10109598 3300026142 Bacteria 2311
169 Ga0307515_10001810 3300028794 Bacteria 47689
170 Ga0307515_10002270 3300028794 Bacteria 42110
171 Ga0265338_10151738 3300028800 Bacteria 1800
172 Ga0316177_1192918 3300030731 Bacteria 4722
173 Ga0316176_1017512 3300030732 Bacteria 17610
174 Ga0314311_1049659 3300030733 Bacteria 1585
175 Ga0316183_1098725 3300030742 Bacteria 33143
176 Ga0316181_1138456 3300030744 Bacteria 2772
177 Ga0265327_10405896 3300031251 Unclassified 591
178 Ga0307513_10361702 3300031456 Bacteria 1196
179 Ga0307408_100001017 3300031548 Bacteria 21563
180 Ga0307408_100002150 3300031548 Bacteria 14103
181 Ga0307405_10000008 3300031731 Bacteria 264953
182 Ga0307405_10000022 3300031731 Bacteria 148522
183 Ga0307407_10000012 3300031903 Bacteria 172479
184 Ga0307407_10000037 3300031903 Bacteria 71023
185 Ga0307412_10000038 3300031911 Bacteria 187857
186 Ga0307412_10002200 3300031911 Bacteria 10824
187 Ga0307409_100076868 3300031995 Bacteria 2679
188 Ga0307409_100078217 3300031995 Bacteria 2660
189 Ga0307416_100000024 3300032002 Bacteria 186924
190 Ga0307416_100000048 3300032002 Bacteria 120194
191 Ga0307414_10000281 3300032004 Bacteria 30115
192 Ga0307414_10006226 3300032004 Bacteria 6636
193 Ga0307414_10057178 3300032004 Bacteria 2740
194 Ga0307414_10136811 3300032004 Bacteria 1911
195 Ga0307414_10438082 3300032004 Bacteria 1143
196 Ga0307414_10909992 3300032004 Bacteria 807
197 Ga0307414_11809744 3300032004 Bacteria 570
198 Ga0307411_10321370 3300032005 Bacteria 1250
199 Ga0395899_0000001 3300037312 Bacteria 1750322
200 Ga0395899_0000027 3300037312 Bacteria 337387
201 Ga0395899_0000325 3300037312 Bacteria 60438
202 Ga0451793_0454772 3300041452 Bacteria 566
203 Ga0451800_0235336 3300041459 Bacteria 608
204 Ga0451800_0272329 3300041459 Bacteria 738
205 Ga0466969_0017153 3300044656 Bacteria 3784
206 Ga0466966_0027709 3300044684 Bacteria 3693
207 Ga0466961_0044549 3300044693 Bacteria 2839
208 Ga0466968_0322669 3300044735 Unclassified 746
209 Ga0466959_0633750 3300045049 Unclassified 718
210 Ga0466958_0030761 3300045836 Bacteria 3190
211 Ga0495638_0671521 3300046460 Unclassified 502
212 Ga0495651_0088041 3300046462 Bacteria 2334
213 Ga0495651_0196780 3300046462 Bacteria 1414
214 Ga0495585_0000014 3300046492 Bacteria 187513
215 Ga0495606_0024838 3300046507 Bacteria 4307
216 Ga0495608_0886645 3300046511 Bacteria 523
217 Ga0495610_0000062 3300046512 Bacteria 128923
218 Ga0495610_0000144 3300046512 Bacteria 78253
219 Ga0495610_0000289 3300046512 Bacteria 52803
220 Ga0495610_0003081 3300046512 Bacteria 13312
221 Ga0495616_0332446 3300046513 Unclassified 636
222 Ga0495632_0427773 3300046519 Bacteria 576
223 Ga0495637_0114900 3300046520 Unclassified 1040
224 Ga0495652_0082831 3300046529 Bacteria 2642
225 Ga0495652_0217792 3300046529 Bacteria 1437
226 Ga0495633_0000026 3300046558 Bacteria 204722
227 Ga0495633_0003714 3300046558 Bacteria 10063
228 Ga0495633_0144027 3300046558 Bacteria 1101
229 Ga0495668_0000054 3300046616 Bacteria 203960
230 Ga0495668_0603868 3300046616 Bacteria 606
231 Ga0495625_0000168 3300046660 Bacteria 102626
232 Ga0495625_0043159 3300046660 Bacteria 3272
233 Ga0495625_0081483 3300046660 Unclassified 2252
234 Ga0495625_0267533 3300046660 Bacteria 1104
235 Ga0495661_0009169 3300046665 Bacteria 6800
236 Ga0495671_0031685 3300046692 Bacteria 2703
237 Ga0495589_0072951 3300046794 Unclassified 1676
238 Ga0495683_0069878 3300047323 Bacteria 1725
239 Ga0495687_000385 3300047443 Bacteria 54684
240 Ga0495686_0000319 3300047472 Bacteria 79929
241 Ga0495686_0000524 3300047472 Bacteria 55256
242 Ga0495686_0000643 3300047472 Bacteria 48144
243 Ga0495686_0058223 3300047472 Bacteria 2409
244 Ga0495686_0085279 3300047472 Bacteria 1924
245 Ga0495614_0014940 3300048089 Bacteria 3392
246 Ga0496115_0073901 3300048918 Bacteria 2768
247 Ga0495678_024842 3300049459 Bacteria 2582
248 Ga0501249_040184 3300049679 Bacteria 1059
249 Ga0501241_003581 3300049758 Bacteria 2931
250 Ga0501241_140432 3300049758 Bacteria 550
251 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
252 nmdc:mga0k408_84580_c1 3300050493 Bacteria 1861
253 nmdc:mga07m45_45494_c1 3300050496 Bacteria 1744
254 Ga0500635_0001757 3300053080 Bacteria 5283
255 Ga0500651_0000188 3300053093 Bacteria 39379
256 Ga0500618_000191 3300053125 Bacteria 50316
257 Ga0500652_019422 3300053131 Bacteria 2525
258 Ga0500564_101707 3300053138 Bacteria 1269
259 Ga0500577_0267688 3300053142 Bacteria 744
260 Ga0500622_0000430 3300053156 Bacteria 39891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_11871090 Ga0105238_118710902 105
2 3300044735 Ga0466968_0322669 Ga0466968_0322669_282_623 107
3 3300003320 rootH2_10198426 rootH2_101984262 116
4 iso_pu_bacteria 2599185184 2599478133 116
5 3300003323 rootH1_10004106 rootH1_1000410613 118
6 3300010375 Ga0105239_10001074 Ga0105239_1000107429 118
7 3300025914 Ga0207671_11001632 Ga0207671_110016322 118
8 3300001915 JGI24741J21665_1028544 JGI24741J21665_10285442 119
9 3300001990 JGI24737J22298_10000384 JGI24737J22298_1000038415 119
10 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003104 119
11 3300003320 rootH2_10231543 rootH2_102315435 119
12 3300005577 Ga0068857_100078838 Ga0068857_1000788386 119
13 3300025261 Ga0209233_1005686 Ga0209233_10056866 119
14 3300025904 Ga0207647_10142545 Ga0207647_101425452 119
15 3300026116 Ga0207674_10374081 Ga0207674_103740813 119
16 3300028794 Ga0307515_10002270 Ga0307515_1000227051 119
17 3300046492 Ga0495585_0000014 Ga0495585_0000014_5915_6292 119
18 3300046512 Ga0495610_0003081 Ga0495610_0003081_11315_11692 119
19 3300047323 Ga0495683_0069878 Ga0495683_0069878_362_739 119
20 3300001989 JGI24739J22299_10019431 JGI24739J22299_100194312 120
21 3300001990 JGI24737J22298_10000621 JGI24737J22298_100006215 120
22 3300002067 JGI24735J21928_10000002 JGI24735J21928_1000000285 120
23 3300003320 rootH2_10122632 rootH2_101226322 120
24 3300003320 rootH2_10240595 rootH2_102405952 120
25 3300003322 rootL2_10237375 rootL2_102373753 120
26 3300003323 rootH1_10103003 rootH1_101030032 120
27 3300005563 Ga0068855_100086502 Ga0068855_1000865023 120
28 3300005616 Ga0068852_100131027 Ga0068852_1001310273 120
29 3300020077 Ga0206351_10928506 Ga0206351_109285062 120
30 3300025250 Ga0209026_1001195 Ga0209026_10011957 120
31 3300025904 Ga0207647_10099079 Ga0207647_100990792 120
32 3300025911 Ga0207654_10273614 Ga0207654_102736142 120
33 3300025914 Ga0207671_10003258 Ga0207671_100032585 120
34 3300025949 Ga0207667_10142832 Ga0207667_101428322 120
35 3300026041 Ga0207639_10832122 Ga0207639_108321221 120
36 3300026142 Ga0207698_10109598 Ga0207698_101095983 120
37 3300028800 Ga0265338_10151738 Ga0265338_101517384 120
38 3300046520 Ga0495637_0114900 Ga0495637_0114900_17_415 120
39 3300046616 Ga0495668_0603868 Ga0495668_0603868_99_506 120
40 3300046660 Ga0495625_0043159 Ga0495625_0043159_531_929 120
41 3300046692 Ga0495671_0031685 Ga0495671_0031685_25_423 120
42 3300053131 Ga0500652_019422 Ga0500652_019422_641_1039 120
43 3300006195 Ga0075366_10093129 Ga0075366_100931294 121
44 3300013100 Ga0157373_10177328 Ga0157373_101773283 122
45 3300046512 Ga0495610_0000062 Ga0495610_0000062_92341_92766 122
46 3300046519 Ga0495632_0427773 Ga0495632_0427773_77_502 122
47 3300046558 Ga0495633_0003714 Ga0495633_0003714_305_730 122
48 3300046665 Ga0495661_0009169 Ga0495661_0009169_4662_5087 122
49 3300047472 Ga0495686_0085279 Ga0495686_0085279_1123_1530 122
50 3300049459 Ga0495678_024842 Ga0495678_024842_1182_1607 122
51 3300053080 Ga0500635_0001757 Ga0500635_0001757_3410_3817 122
52 iso_pu_bacteria 2842903701 2842904826 124
53 iso_pu_bacteria 2919437846 2919440285 124
54 3300003320 rootH2_10015286 rootH2_100152864 125
55 3300005577 Ga0068857_100497142 Ga0068857_1004971422 125
56 3300009093 Ga0105240_10000371 Ga0105240_1000037147 125
57 3300009093 Ga0105240_10259190 Ga0105240_102591903 125
58 3300009093 Ga0105240_11984857 Ga0105240_119848571 125
59 3300009174 Ga0105241_10000733 Ga0105241_100007338 125
60 3300009545 Ga0105237_10846917 Ga0105237_108469172 125
61 3300010375 Ga0105239_10001768 Ga0105239_100017686 125
62 3300014969 Ga0157376_11315256 Ga0157376_113152562 125
63 3300025911 Ga0207654_10010794 Ga0207654_100107946 125
64 3300025913 Ga0207695_10000142 Ga0207695_1000014236 125
65 3300025914 Ga0207671_10000110 Ga0207671_1000011016 125
66 3300025924 Ga0207694_10424541 Ga0207694_104245412 125
67 3300025981 Ga0207640_10141533 Ga0207640_101415332 125
68 3300026116 Ga0207674_10505179 Ga0207674_105051792 125
69 iso_pu_bacteria 2884933994 2884936139 125
70 iso_pu_bacteria 2895498888 2895501770 125
71 iso_pu_bacteria 2919437846 2919442548 125
72 iso_pu_bacteria 2928078545 2928080089 125
73 iso_pu_bacteria 2977232053 2977235648 125
74 2162886007 SwRhRL2b_contig_3050470 SwRhRL2b_0665.00005860 126
75 3300005289 Ga0065704_10086284 Ga0065704_100862845 126
76 3300013307 Ga0157372_10002106 Ga0157372_100021068 126
77 3300017792 Ga0163161_10018221 Ga0163161_100182212 126
78 3300025233 Ga0209437_100102 Ga0209437_1001029 126
79 3300025914 Ga0207671_10007886 Ga0207671_100078869 126
80 3300025914 Ga0207671_10050616 Ga0207671_100506162 126
81 3300025981 Ga0207640_10029925 Ga0207640_100299253 126
82 3300028794 Ga0307515_10001810 Ga0307515_1000181014 126
83 3300030731 Ga0316177_1192918 Ga0316177_11929185 126
84 3300030732 Ga0316176_1017512 Ga0316176_101751212 126
85 3300030733 Ga0314311_1049659 Ga0314311_10496592 126
86 3300030742 Ga0316183_1098725 Ga0316183_109872527 126
87 3300030744 Ga0316181_1138456 Ga0316181_11384563 126
88 3300031456 Ga0307513_10361702 Ga0307513_103617022 126
89 3300031548 Ga0307408_100001017 Ga0307408_10000101718 126
90 3300031548 Ga0307408_100002150 Ga0307408_1000021506 126
91 3300031911 Ga0307412_10002200 Ga0307412_100022003 126
92 3300031995 Ga0307409_100078217 Ga0307409_1000782173 126
93 3300037312 Ga0395899_0000027 Ga0395899_0000027_51443_51847 126
94 3300041459 Ga0451800_0272329 Ga0451800_0272329_220_624 126
95 3300046462 Ga0495651_0196780 Ga0495651_0196780_945_1349 126
96 3300046511 Ga0495608_0886645 Ga0495608_0886645_77_481 126
97 3300046529 Ga0495652_0217792 Ga0495652_0217792_498_902 126
98 3300046558 Ga0495633_0000026 Ga0495633_0000026_101890_102294 126
99 3300046616 Ga0495668_0000054 Ga0495668_0000054_71471_71875 126
100 3300046660 Ga0495625_0000168 Ga0495625_0000168_98753_99157 126
101 3300047472 Ga0495686_0000524 Ga0495686_0000524_49673_50077 126
102 3300048089 Ga0495614_0014940 Ga0495614_0014940_2231_2635 126
103 3300050493 nmdc:mga0k408_82_c1 nmdc:mga0k408_82_c1_42919_43323 126
104 3300002737 JGI25162J39368_1003251 JGI25162J39368_10032514 127
105 3300002772 JGI25164J39214_1001374 JGI25164J39214_10013747 127
106 3300002772 JGI25164J39214_1001394 JGI25164J39214_10013944 127
107 3300003214 JGI25165J46597_1000657 JGI25165J46597_100065715 127
108 3300003323 rootH1_10110641 rootH1_101106411 127
109 3300005339 Ga0070660_100003098 Ga0070660_10000309813 127
110 3300005339 Ga0070660_101197952 Ga0070660_1011979522 127
111 3300005366 Ga0070659_100000199 Ga0070659_10000019918 127
112 3300005535 Ga0070684_101026058 Ga0070684_1010260581 127
113 3300005563 Ga0068855_100000098 Ga0068855_1000000984 127
114 3300005578 Ga0068854_100017497 Ga0068854_1000174975 127
115 3300005614 Ga0068856_100000120 Ga0068856_10000012053 127
116 3300005614 Ga0068856_100764311 Ga0068856_1007643113 127
117 3300005618 Ga0068864_101778149 Ga0068864_1017781491 127
118 3300005842 Ga0068858_100075677 Ga0068858_1000756773 127
119 3300006353 Ga0075370_10243925 Ga0075370_102439252 127
120 3300006358 Ga0068871_101516619 Ga0068871_1015166192 127
121 3300009093 Ga0105240_10582682 Ga0105240_105826822 127
122 3300009093 Ga0105240_10639413 Ga0105240_106394132 127
123 3300009174 Ga0105241_10878636 Ga0105241_108786361 127
124 3300009545 Ga0105237_10002461 Ga0105237_1000246114 127
125 3300009545 Ga0105237_10021894 Ga0105237_100218943 127
126 3300009545 Ga0105237_10586560 Ga0105237_105865602 127
127 3300009551 Ga0105238_10230707 Ga0105238_102307073 127
128 3300010375 Ga0105239_10000012 Ga0105239_10000012117 127
129 3300010375 Ga0105239_10000049 Ga0105239_1000004919 127
130 3300010375 Ga0105239_10000086 Ga0105239_1000008696 127
131 3300010375 Ga0105239_10002795 Ga0105239_1000279520 127
132 3300013104 Ga0157370_10104830 Ga0157370_101048304 127
133 3300013105 Ga0157369_10003292 Ga0157369_1000329216 127
134 3300013296 Ga0157374_12828948 Ga0157374_128289481 127
135 3300013297 Ga0157378_10030943 Ga0157378_100309432 127
136 3300013297 Ga0157378_10046222 Ga0157378_100462223 127
137 3300013306 Ga0163162_10005211 Ga0163162_1000521113 127
138 3300013307 Ga0157372_10000190 Ga0157372_1000019041 127
139 3300025231 Ga0207427_100131 Ga0207427_10013117 127
140 3300025233 Ga0209437_100048 Ga0209437_10004893 127
141 3300025233 Ga0209437_100299 Ga0209437_10029960 127
142 3300025250 Ga0209026_1000683 Ga0209026_100068317 127
143 3300025258 Ga0209129_1012036 Ga0209129_10120362 127
144 3300025261 Ga0209233_1000029 Ga0209233_1000029284 127
145 3300025913 Ga0207695_10488475 Ga0207695_104884752 127
146 3300025914 Ga0207671_10000653 Ga0207671_1000065315 127
147 3300025919 Ga0207657_10011218 Ga0207657_1001121811 127
148 3300025932 Ga0207690_10000744 Ga0207690_1000074411 127
149 3300025949 Ga0207667_10000014 Ga0207667_10000014109 127
150 3300025981 Ga0207640_10097285 Ga0207640_100972852 127
151 3300026035 Ga0207703_10143270 Ga0207703_101432703 127
152 3300026078 Ga0207702_10000195 Ga0207702_1000019517 127
153 3300026078 Ga0207702_10066745 Ga0207702_100667453 127
154 3300026078 Ga0207702_10716467 Ga0207702_107164673 127
155 3300026095 Ga0207676_11780829 Ga0207676_117808292 127
156 3300037312 Ga0395899_0000001 Ga0395899_0000001_821686_822102 127
157 3300037312 Ga0395899_0000325 Ga0395899_0000325_46586_46993 127
158 3300041452 Ga0451793_0454772 Ga0451793_0454772_116_523 127
159 3300044656 Ga0466969_0017153 Ga0466969_0017153_2822_3229 127
160 3300044684 Ga0466966_0027709 Ga0466966_0027709_435_842 127
161 3300044693 Ga0466961_0044549 Ga0466961_0044549_1202_1609 127
162 3300045049 Ga0466959_0633750 Ga0466959_0633750_259_666 127
163 3300045836 Ga0466958_0030761 Ga0466958_0030761_251_658 127
164 3300046460 Ga0495638_0671521 Ga0495638_0671521_58_465 127
165 3300046462 Ga0495651_0088041 Ga0495651_0088041_569_976 127
166 3300046507 Ga0495606_0024838 Ga0495606_0024838_1533_1940 127
167 3300046513 Ga0495616_0332446 Ga0495616_0332446_101_526 127
168 3300046529 Ga0495652_0082831 Ga0495652_0082831_1328_1735 127
169 3300046660 Ga0495625_0081483 Ga0495625_0081483_279_704 127
170 3300046660 Ga0495625_0267533 Ga0495625_0267533_623_1030 127
171 3300046794 Ga0495589_0072951 Ga0495589_0072951_169_594 127
172 3300047443 Ga0495687_000385 Ga0495687_000385_49303_49728 127
173 3300047472 Ga0495686_0000319 Ga0495686_0000319_39961_40368 127
174 3300047472 Ga0495686_0000643 Ga0495686_0000643_33926_34351 127
175 3300047472 Ga0495686_0058223 Ga0495686_0058223_558_992 127
176 3300050493 nmdc:mga0k408_84580_c1 nmdc:mga0k408_84580_c1_860_1267 127
177 3300050496 nmdc:mga07m45_45494_c1 nmdc:mga07m45_45494_c1_842_1249 127
178 3300053125 Ga0500618_000191 Ga0500618_000191_10974_11399 127
179 3300053138 Ga0500564_101707 Ga0500564_101707_198_623 127
180 3300053156 Ga0500622_0000430 Ga0500622_0000430_12122_12547 127
181 iso_pu_bacteria 2739367663 2739646488 127
182 iso_pu_bacteria 2857627736 2857629907 127
183 3300013100 Ga0157373_10012786 Ga0157373_100127867 128
184 3300031251 Ga0265327_10405896 Ga0265327_104058961 128
185 iso_pu_bacteria 2585427687 2586208239 128
186 iso_pu_bacteria 2738541284 2738761876 128
187 iso_pu_bacteria 2738541302 2738856341 128
188 iso_pu_bacteria 2738543023 2739302201 128
189 iso_pu_bacteria 2739367651 2739587770 128
190 iso_pu_bacteria 2739367656 2739614543 128
191 iso_pu_bacteria 2775506987 2776615479 128
192 iso_pu_bacteria 2818991437 2819545671 128
193 iso_pu_bacteria 2842722452 2842724443 128
194 iso_pu_bacteria 2842909656 2842912063 128
195 iso_pu_bacteria 2852627209 2852631144 128
196 iso_pu_bacteria 2904445276 2904448356 128
197 iso_pu_bacteria 2919186247 2919188745 128
198 iso_pu_bacteria 2939664404 2939667100 128
199 iso_pu_bacteria 2945997725 2945998709 128
200 iso_pu_bacteria 2954016120 2954021160 128
201 3300002773 JGI25152J39213_1000050 JGI25152J39213_100005031 129
202 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003131 129
203 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002131 129
204 3300003215 JGI25153J46596_10000030 JGI25153J46596_10000030121 129
205 3300003320 rootH2_10212417 rootH2_102124172 129
206 3300003781 Ga0055536_1000010 Ga0055536_1000010266 129
207 3300003791 Ga0055530_10001828 Ga0055530_100018285 129
208 3300009174 Ga0105241_10025697 Ga0105241_100256972 129
209 3300009545 Ga0105237_10000072 Ga0105237_1000007279 129
210 3300009551 Ga0105238_10142338 Ga0105238_101423383 129
211 3300010375 Ga0105239_10000547 Ga0105239_1000054730 129
212 3300013100 Ga0157373_10459648 Ga0157373_104596482 129
213 3300013104 Ga0157370_10000125 Ga0157370_1000012521 129
214 3300013308 Ga0157375_12564866 Ga0157375_125648662 129
215 3300015261 Ga0182006_1203899 Ga0182006_12038992 129
216 3300015682 Ga0183373_1009 Ga0183373_100989 129
217 3300025245 Ga0207425_1000003 Ga0207425_1000003707 129
218 3300025258 Ga0209129_1000014 Ga0209129_1000014126 129
219 3300025292 Ga0209676_1000009 Ga0209676_1000009612 129
220 3300025294 Ga0209025_1000007 Ga0209025_1000007706 129
221 3300025297 Ga0209758_1000012 Ga0209758_1000012707 129
222 3300025298 Ga0209050_1000190 Ga0209050_100019045 129
223 3300025911 Ga0207654_10015784 Ga0207654_100157843 129
224 3300025913 Ga0207695_10000055 Ga0207695_10000055169 129
225 3300025914 Ga0207671_10000451 Ga0207671_1000045128 129
226 3300025924 Ga0207694_10084740 Ga0207694_100847402 129
227 3300031731 Ga0307405_10000008 Ga0307405_1000000878 129
228 3300031903 Ga0307407_10000037 Ga0307407_1000003735 129
229 3300032002 Ga0307416_100000048 Ga0307416_10000004833 129
230 3300046558 Ga0495633_0144027 Ga0495633_0144027_434_823 129
231 3300048918 Ga0496115_0073901 Ga0496115_0073901_453_848 129
232 iso_pu_bacteria 2849281842 2849285622 129
233 3300005288 Ga0065714_10002223 Ga0065714_1000222332 130
234 3300005288 Ga0065714_10003517 Ga0065714_100035172 130
235 3300013102 Ga0157371_10000143 Ga0157371_1000014359 130
236 3300013104 Ga0157370_10009756 Ga0157370_100097569 130
237 3300013104 Ga0157370_10073745 Ga0157370_100737453 130
238 3300013105 Ga0157369_10000023 Ga0157369_10000023180 130
239 3300013308 Ga0157375_11293012 Ga0157375_112930122 130
240 3300014497 Ga0182008_10000122 Ga0182008_1000012225 130
241 3300015261 Ga0182006_1000064 Ga0182006_1000064111 130
242 3300015261 Ga0182006_1000089 Ga0182006_100008971 130
243 3300015262 Ga0182007_10000009 Ga0182007_10000009272 130
244 3300017792 Ga0163161_10000090 Ga0163161_1000009019 130
245 3300017792 Ga0163161_10000877 Ga0163161_1000087714 130
246 3300017792 Ga0163161_10040258 Ga0163161_100402583 130
247 3300017792 Ga0163161_11990188 Ga0163161_119901881 130
248 3300031731 Ga0307405_10000022 Ga0307405_10000022103 130
249 3300031903 Ga0307407_10000012 Ga0307407_1000001299 130
250 3300031995 Ga0307409_100076868 Ga0307409_1000768683 130
251 3300032002 Ga0307416_100000024 Ga0307416_10000002425 130
252 3300032004 Ga0307414_10006226 Ga0307414_100062265 130
253 3300032004 Ga0307414_10909992 Ga0307414_109099922 130
254 3300041459 Ga0451800_0235336 Ga0451800_0235336_144_542 130
255 3300046512 Ga0495610_0000144 Ga0495610_0000144_14353_14751 130
256 3300046512 Ga0495610_0000289 Ga0495610_0000289_46048_46446 130
257 3300049679 Ga0501249_040184 Ga0501249_040184_330_728 130
258 2162886007 SwRhRL2b_contig_1948121 SwRhRL2b_0659.00008580 132
259 2162886007 SwRhRL2b_contig_2653925 SwRhRL2b_0128.00002180 132
260 3300003323 rootH1_10113579 rootH1_101135794 132
261 3300005288 Ga0065714_10002398 Ga0065714_1000239836 132
262 3300005288 Ga0065714_10002497 Ga0065714_1000249717 132
263 3300005288 Ga0065714_10068399 Ga0065714_100683993 132
264 3300005288 Ga0065714_10086042 Ga0065714_100860424 132
265 3300005288 Ga0065714_10098688 Ga0065714_100986882 132
266 3300005289 Ga0065704_10070196 Ga0065704_1007019610 132
267 3300005289 Ga0065704_10084452 Ga0065704_100844522 132
268 3300005289 Ga0065704_10152884 Ga0065704_101528842 132
269 3300013100 Ga0157373_10000125 Ga0157373_1000012517 132
270 3300013102 Ga0157371_10000575 Ga0157371_1000057533 132
271 3300013102 Ga0157371_10002309 Ga0157371_100023099 132
272 3300013104 Ga0157370_10018164 Ga0157370_100181643 132
273 3300013104 Ga0157370_10034592 Ga0157370_100345923 132
274 3300013104 Ga0157370_10045619 Ga0157370_100456193 132
275 3300014497 Ga0182008_10000002 Ga0182008_10000002203 132
276 3300015261 Ga0182006_1000870 Ga0182006_100087010 132
277 3300031911 Ga0307412_10000038 Ga0307412_10000038155 132
278 3300032004 Ga0307414_10000281 Ga0307414_1000028122 132
279 3300032004 Ga0307414_10057178 Ga0307414_100571783 132
280 3300032004 Ga0307414_10136811 Ga0307414_101368112 132
281 3300032004 Ga0307414_10438082 Ga0307414_104380822 132
282 3300032004 Ga0307414_11809744 Ga0307414_118097442 132
283 3300032005 Ga0307411_10321370 Ga0307411_103213702 132
284 3300049758 Ga0501241_003581 Ga0501241_003581_1628_2026 132
285 3300049758 Ga0501241_140432 Ga0501241_140432_91_492 132
286 3300053093 Ga0500651_0000188 Ga0500651_0000188_25382_25780 132
287 3300053142 Ga0500577_0267688 Ga0500577_0267688_67_474 132

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aid-assembly1.cif.gz_A crystal structure of the mep2 mutant delta442 from candida albicans 0.5318 53 118
6s3s-assembly1.cif.gz_H structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.4609 49 107
6s3r-assembly1.cif.gz_G structure of the flipqr complex from the flagellar type 3 secretion system of pseudomonas savastanoi. 0.4575 49 107
7zm8-assembly1.cif.gz_X cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) - membrane arm 0.4319 28 122
6z1u-assembly1.cif.gz_P bovine atp synthase f1c8-peripheral stalk domain, state 3 0.4317 52 118
ID Description Score Start End Superfamily
af_A0A0P0WEK2_1_130_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8194 53 114 1.10.1760.20
2fsiB04 Mainly Alpha;Orthogonal Bundle;Helical scaffold and wing domains of SecA;Helical scaffold and wing domains of SecA 0.5941 52 115 1.10.3060.10
af_Q5NBD8_1_100_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5778 45 130 1.10.10.1740
af_Q4E629_19_142_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5347 47 113 1.50.40.10
af_Q2RBN4_1_316_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.5275 53 118 1.10.3430.10
ID Description Score Start End GO Terms
AF-A0A0Q0VI75-F1-model_v4 DUF983 domain-containing protein 0.9719 1 132 GO:0016020
AF-A0A1I2DIA4-F1-model_v4 DUF983 domain-containing protein 0.9686 1 132 GO:0016020
AF-A0A5D8YUD2-F1-model_v4 DUF983 domain-containing protein 0.9645 2 132 GO:0016020
AF-A0A519VD55-F1-model_v4 DUF983 domain-containing protein 0.9618 4 131 GO:0016020
AF-A0A1I2DIA4-F1-model_v4 DUF983 domain-containing protein 0.9615 1 132 GO:0016020

Feature Viewer

pLDDT pTM Quality
82.97 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map