F387816

General Info

Members Datasets Scaffolds Average Seq Length
287 160 574 506

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100087645|Ga0070683_1000876452
Length 557
Sequence MRIVDQRLVRRARPVRHLLVLDSLLGALSAVLVLVQAVLIAKIVVSAFSGSSLTDVSTELVLLALAFAARGVLTWGFEVAGRRAASTVLSELRLELVETRLRRQPLALDGAEAGEIAATAVQGVDGLEAYFARYLPQVVLAIIVPVAVLGLVLVIDPISAGVMLLTLPLVPVFMWLIGRYTEERTRERWLALRLLSTHFLDVVRGLPTLRAFNRGRAQAEVLDRIGDQYRKTTMGTLRVAFLSGAVLELAATLGVALVAVTAGVRLVDGGLGFQAALTVLVLAPELYFPLRQLAAQFHASADGLAVAERMLELLDEPVSVSGGKLVAPSPRDVPVRFESVSFAYPSRPGLVLDGLDFELHADETVALIGPSGSGKTTVASLLLRFVDPVHGRVSVGGIDLAHCRADLWREQLAWVPQKPTIFHGTIADNIRLGDPGATVRAVRDAAVLAGADRFIQALPFGYETFVGDGGRPLSAGESRRIALARAFVRNAPLVILDEPTADLDRTSAGVVAEAVERLRTGRMVLLIAHRPELVEHADRVVLLEDGKGRTQVRDEVA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
98 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 10.45
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100087645 3300005329 Bacteria 2920
2 JGI25407J50210_10002742 3300003373 Bacteria 4187
3 Ga0070683_100006626 3300005329 Bacteria 9724
4 Ga0070683_100052676 3300005329 Bacteria 3771
5 Ga0070683_100079955 3300005329 Bacteria 3060
6 Ga0068869_100054227 3300005334 Bacteria 2918
7 Ga0070682_100020963 3300005337 Bacteria 3851
8 Ga0068868_100020858 3300005338 Bacteria 4931
9 Ga0070691_10001751 3300005341 Bacteria 9435
10 Ga0070661_100022498 3300005344 Bacteria 4514
11 Ga0070692_10001803 3300005345 Bacteria 8005
12 Ga0070692_10018728 3300005345 Bacteria 3333
13 Ga0070675_100011413 3300005354 Bacteria 6953
14 Ga0070673_100034028 3300005364 Bacteria 3852
15 Ga0070659_100144213 3300005366 Bacteria 1940
16 Ga0070659_100159158 3300005366 Bacteria 1846
17 Ga0070709_10017485 3300005434 Bacteria 4114
18 Ga0070705_100004779 3300005440 Bacteria 6593
19 Ga0070700_100030128 3300005441 Bacteria 3240
20 Ga0070694_100033340 3300005444 Bacteria 3388
21 Ga0070663_100065341 3300005455 Bacteria 2633
22 Ga0070678_100008330 3300005456 Bacteria 6208
23 Ga0070662_100004077 3300005457 Bacteria 9176
24 Ga0070684_100008382 3300005535 Bacteria 8075
25 Ga0070684_100020129 3300005535 Bacteria 5536
26 Ga0068853_100030793 3300005539 Bacteria 4533
27 Ga0070693_100027768 3300005547 Bacteria 3070
28 Ga0070693_100028482 3300005547 Bacteria 3037
29 Ga0070704_100071221 3300005549 Bacteria 2525
30 Ga0068855_100064853 3300005563 Bacteria 4259
31 Ga0068855_100100618 3300005563 Bacteria 3328
32 Ga0070664_100055265 3300005564 Bacteria 3370
33 Ga0070664_100113975 3300005564 Bacteria 2361
34 Ga0068857_100068625 3300005577 Bacteria 3156
35 Ga0068854_100007422 3300005578 Bacteria 7002
36 Ga0068854_100034595 3300005578 Bacteria 3531
37 Ga0068856_100090961 3300005614 Bacteria 3036
38 Ga0068856_100103682 3300005614 Bacteria 2838
39 Ga0070702_100008266 3300005615 Bacteria 5031
40 Ga0070702_100034945 3300005615 Bacteria 2774
41 Ga0070702_100040203 3300005615 Bacteria 2615
42 Ga0068852_100033143 3300005616 Bacteria 4286
43 Ga0068852_100064975 3300005616 Bacteria 3182
44 Ga0068864_100035928 3300005618 Bacteria 4220
45 Ga0068861_100062865 3300005719 Bacteria 2852
46 Ga0068861_100078539 3300005719 Bacteria 2578
47 Ga0068860_100107601 3300005843 Bacteria 2665
48 Ga0068862_100062817 3300005844 Bacteria 3195
49 Ga0081455_10005876 3300005937 Bacteria 13335
50 Ga0081455_10014272 3300005937 Bacteria 7796
51 Ga0081455_10018504 3300005937 Bacteria 6632
52 Ga0081455_10027438 3300005937 Bacteria 5218
53 Ga0081455_10055858 3300005937 Bacteria 3356
54 Ga0081538_10000148 3300005981 Bacteria 73051
55 Ga0081538_10000183 3300005981 Bacteria 68671
56 Ga0081538_10000634 3300005981 Bacteria 38949
57 Ga0081540_1011957 3300005983 Bacteria 5756
58 Ga0070717_10015352 3300006028 Bacteria 5914
59 Ga0075365_10029578 3300006038 Bacteria 3503
60 Ga0075432_10002690 3300006058 Bacteria 5941
61 Ga0075432_10011758 3300006058 Bacteria 2975
62 Ga0070712_100011405 3300006175 Bacteria 5634
63 Ga0070712_100065355 3300006175 Bacteria 2582
64 Ga0097621_100167359 3300006237 Bacteria 1893
65 Ga0075428_100043287 3300006844 Bacteria 4949
66 Ga0075428_100171603 3300006844 Bacteria 2350
67 Ga0075431_100001809 3300006847 Bacteria 20185
68 Ga0075431_100118989 3300006847 Bacteria 2725
69 Ga0075434_100001386 3300006871 Bacteria 20336
70 Ga0075434_100031939 3300006871 Bacteria 5191
71 Ga0075434_100181402 3300006871 Bacteria 2125
72 Ga0068865_100046088 3300006881 Bacteria 2990
73 Ga0075436_100012378 3300006914 Bacteria 5848
74 Ga0075435_100023810 3300007076 Bacteria 4743
75 Ga0111539_10006860 3300009094 Bacteria 14632
76 Ga0111539_10026479 3300009094 Bacteria 7089
77 Ga0111539_10044504 3300009094 Bacteria 5318
78 Ga0111539_10050375 3300009094 Bacteria 4961
79 Ga0111539_10065886 3300009094 Bacteria 4279
80 Ga0105245_10011224 3300009098 Bacteria 7798
81 Ga0105245_10032608 3300009098 Bacteria 4611
82 Ga0114129_10016452 3300009147 Bacteria 10527
83 Ga0114129_10126073 3300009147 Bacteria 3520
84 Ga0114129_10181186 3300009147 Bacteria 2866
85 Ga0105243_10004176 3300009148 Bacteria 11451
86 Ga0105243_10004963 3300009148 Bacteria 10425
87 Ga0105243_10174398 3300009148 Bacteria 1865
88 Ga0105242_10023331 3300009176 Bacteria 4876
89 Ga0105242_10041605 3300009176 Bacteria 3707
90 Ga0105248_10010620 3300009177 Bacteria 10153
91 Ga0105238_10005921 3300009551 Bacteria 12119
92 Ga0105249_10059305 3300009553 Bacteria 3510
93 Ga0105239_10011278 3300010375 Bacteria 9969
94 Ga0105239_10041264 3300010375 Bacteria 5057
95 Ga0105246_10011494 3300011119 Bacteria 5494
96 Ga0157371_10026068 3300013102 Bacteria 4254
97 Ga0157378_10116380 3300013297 Bacteria 2458
98 Ga0163162_10175071 3300013306 Bacteria 2271
99 Ga0157372_10004058 3300013307 Bacteria 15695
100 Ga0157375_10008377 3300013308 Bacteria 9054
101 Ga0157380_10007251 3300014326 Bacteria 7864
102 Ga0157377_10007892 3300014745 Bacteria 5162
103 Ga0157377_10032867 3300014745 Bacteria 2828
104 Ga0157379_10115760 3300014968 Bacteria 2410
105 Ga0157376_10052855 3300014969 Bacteria 3380
106 Ga0207688_10005993 3300025901 Bacteria 6615
107 Ga0207693_10007570 3300025915 Bacteria 8923
108 Ga0207693_10017735 3300025915 Bacteria 5676
109 Ga0207657_10007290 3300025919 Bacteria 11346
110 Ga0207694_10039788 3300025924 Bacteria 3618
111 Ga0207659_10018785 3300025926 Bacteria 4537
112 Ga0207690_10095815 3300025932 Bacteria 2109
113 Ga0207706_10061758 3300025933 Bacteria 3300
114 Ga0207686_10020378 3300025934 Bacteria 3788
115 Ga0207709_10029319 3300025935 Bacteria 3190
116 Ga0207665_10008558 3300025939 Bacteria 6733
117 Ga0207691_10051526 3300025940 Bacteria 3763
118 Ga0207689_10036280 3300025942 Bacteria 4094
119 Ga0207689_10100521 3300025942 Bacteria 2376
120 Ga0207661_10016221 3300025944 Bacteria 5494
121 Ga0207661_10109251 3300025944 Bacteria 2336
122 Ga0207661_10203087 3300025944 Bacteria 1743
123 Ga0207679_10053070 3300025945 Bacteria 2976
124 Ga0207677_10025528 3300026023 Bacteria 3688
125 Ga0207678_10007786 3300026067 Bacteria 9463
126 Ga0207678_10035670 3300026067 Bacteria 4330
127 Ga0207678_10057805 3300026067 Bacteria 3338
128 Ga0207648_10005667 3300026089 Bacteria 12536
129 Ga0207648_10016609 3300026089 Bacteria 6719
130 Ga0207674_10000884 3300026116 Bacteria 39178
131 Ga0207675_100005966 3300026118 Bacteria 11607
132 Ga0207675_100060532 3300026118 Bacteria 3535
133 Ga0207683_10007267 3300026121 Bacteria 9493
134 Ga0207683_10025353 3300026121 Bacteria 5114
135 Ga0207683_10068672 3300026121 Bacteria 3129
136 Ga0207698_10032289 3300026142 Bacteria 3791
137 Ga0207698_10049420 3300026142 Bacteria 3201
138 Ga0207698_10131035 3300026142 Bacteria 2142
139 Ga0207428_10006489 3300027907 Bacteria 10798
140 Ga0207428_10114029 3300027907 Bacteria 2077
141 Ga0207428_10125247 3300027907 Bacteria 1968
142 Ga0316575_10018712 3300031665 Bacteria 2643
143 Ga0316588_1006217 3300033528 Bacteria 2375
144 Ga0316584_0067121 3300036712 Bacteria 2688
145 Ga0395899_0003219 3300037312 Bacteria 12950
146 Ga0395899_0008947 3300037312 Bacteria 7705
147 Ga0395899_0019744 3300037312 Bacteria 5117
148 Ga0395899_0043894 3300037312 Bacteria 3332
149 Ga0395899_0098929 3300037312 Bacteria 2108
150 Ga0395900_0005303 3300037418 Bacteria 13511
151 Ga0395900_0008673 3300037418 Bacteria 10443
152 Ga0395900_0019417 3300037418 Bacteria 6929
153 Ga0395900_0065890 3300037418 Bacteria 3721
154 Ga0395900_0096870 3300037418 Bacteria 3031
155 Ga0395898_0001644 3300037466 Bacteria 30233
156 Ga0395898_0007751 3300037466 Bacteria 11400
157 Ga0395898_0009235 3300037466 Bacteria 10374
158 Ga0395898_0017483 3300037466 Bacteria 7321
159 Ga0395905_0007144 3300037471 Bacteria 11164
160 Ga0395905_0053163 3300037471 Bacteria 3791
161 Ga0395905_0057705 3300037471 Bacteria 3631
162 Ga0395901_0001203 3300038443 Bacteria 27494
163 Ga0395901_0006560 3300038443 Bacteria 11765
164 Ga0395901_0006678 3300038443 Bacteria 11663
165 Ga0395901_0069853 3300038443 Bacteria 3658
166 Ga0451835_0023365 3300041492 Bacteria 8434
167 Ga0451839_0674609 3300041496 Bacteria 5970
168 Ga0451853_0001880 3300041512 Bacteria 7417
169 Ga0451853_1157141 3300041512 Bacteria 8248
170 Ga0466958_0039429 3300045836 Bacteria 2838
171 Ga0466967_0015822 3300045976 Bacteria 5927
172 Ga0495592_0011093 3300046454 Bacteria 6803
173 Ga0495603_0014153 3300046455 Bacteria 4827
174 Ga0495653_0037218 3300046463 Bacteria 3825
175 Ga0495582_0003521 3300046473 Bacteria 8824
176 Ga0495582_0030463 3300046473 Bacteria 2962
177 Ga0495584_0043727 3300046491 Bacteria 2261
178 Ga0495584_0053407 3300046491 Bacteria 2034
179 Ga0495652_0069371 3300046529 Bacteria 2951
180 Ga0495609_0037161 3300046538 Bacteria 2197
181 Ga0495635_0096649 3300046663 Bacteria 2019
182 Ga0495613_0017076 3300046689 Bacteria 5403
183 Ga0495581_0001432 3300047315 Bacteria 13242
184 Ga0495680_0043443 3300047322 Bacteria 3558
185 Ga0496100_0021092 3300048903 Bacteria 3918
186 Ga0496100_0053217 3300048903 Bacteria 2635
187 Ga0496101_0020868 3300048904 Bacteria 4494
188 Ga0496101_0026218 3300048904 Bacteria 4052
189 Ga0496101_0051268 3300048904 Bacteria 2973
190 Ga0496101_0102869 3300048904 Bacteria 2140
191 Ga0496102_0001070 3300048905 Bacteria 25310
192 Ga0496102_0220628 3300048905 Bacteria 1787
193 Ga0496104_0000826 3300048907 Bacteria 26702
194 Ga0496104_0004458 3300048907 Bacteria 12200
195 Ga0496104_0014423 3300048907 Bacteria 7140
196 Ga0496106_0019096 3300048909 Bacteria 5081
197 Ga0496106_0126581 3300048909 Bacteria 2001
198 Ga0496107_0011200 3300048910 Bacteria 6243
199 Ga0496107_0099770 3300048910 Bacteria 2128
200 Ga0496108_0036794 3300048911 Bacteria 4074
201 Ga0496109_0001697 3300048912 Bacteria 18359
202 Ga0496109_0005423 3300048912 Bacteria 10671
203 Ga0496109_0008970 3300048912 Bacteria 8518
204 Ga0496109_0078753 3300048912 Bacteria 3035
205 Ga0496109_0095062 3300048912 Bacteria 2759
206 Ga0496110_0002619 3300048913 Bacteria 13540
207 Ga0496110_0029380 3300048913 Bacteria 4731
208 Ga0496110_0057356 3300048913 Bacteria 3428
209 Ga0496111_0021409 3300048914 Bacteria 4515
210 Ga0496112_0011907 3300048915 Bacteria 7967
211 Ga0496113_0012637 3300048916 Bacteria 5682
212 Ga0496113_0162246 3300048916 Bacteria 1767
213 Ga0496114_0001305 3300048917 Bacteria 18876
214 Ga0496114_0065707 3300048917 Bacteria 3039
215 Ga0501031_0065400 3300049568 Bacteria 2369
216 Ga0501032_0006150 3300049569 Bacteria 8835
217 Ga0501036_0049698 3300049572 Bacteria 3551
218 Ga0501036_0057109 3300049572 Bacteria 3306
219 Ga0501037_0013724 3300049573 Bacteria 5967
220 Ga0501037_0022735 3300049573 Bacteria 4636
221 Ga0501039_0022097 3300049575 Bacteria 4882
222 Ga0501039_0045888 3300049575 Bacteria 3377
223 Ga0501039_0100746 3300049575 Bacteria 2254
224 Ga0501040_0005202 3300049576 Bacteria 8408
225 Ga0501040_0095104 3300049576 Bacteria 2073
226 Ga0501040_0106986 3300049576 Bacteria 1954
227 Ga0501041_0002615 3300049577 Bacteria 10265
228 Ga0501041_0003763 3300049577 Bacteria 8725
229 Ga0501041_0013922 3300049577 Bacteria 4770
230 Ga0501042_0027666 3300049578 Bacteria 3987
231 Ga0501042_0029294 3300049578 Bacteria 3883
232 Ga0501046_0114119 3300049580 Bacteria 2061
233 Ga0501048_0011338 3300049582 Bacteria 6649
234 Ga0501068_0058171 3300049584 Bacteria 2345
235 Ga0501068_0062033 3300049584 Bacteria 2272
236 Ga0501069_0007357 3300049585 Bacteria 5777
237 Ga0501069_0009512 3300049585 Bacteria 5130
238 Ga0501070_0032434 3300049586 Bacteria 4372
239 Ga0501071_0000552 3300049587 Bacteria 19297
240 Ga0501071_0001349 3300049587 Bacteria 14036
241 Ga0501071_0028191 3300049587 Bacteria 3955
242 Ga0501072_0001831 3300049588 Bacteria 15828
243 Ga0501072_0004893 3300049588 Bacteria 10189
244 Ga0501072_0007506 3300049588 Bacteria 8277
245 Ga0501072_0043978 3300049588 Bacteria 3511
246 Ga0501072_0053529 3300049588 Bacteria 3178
247 Ga0501074_0038874 3300049590 Bacteria 3446
248 Ga0501074_0087766 3300049590 Bacteria 2227
249 Ga0501075_0011333 3300049591 Bacteria 6308
250 Ga0501075_0012227 3300049591 Bacteria 6093
251 Ga0501075_0030245 3300049591 Bacteria 4010
252 Ga0501076_0004863 3300049592 Bacteria 9600
253 Ga0501076_0063576 3300049592 Bacteria 2940
254 Ga0501077_0006748 3300049593 Bacteria 7064
255 Ga0501077_0015417 3300049593 Bacteria 4812
256 Ga0501077_0025835 3300049593 Bacteria 3727
257 Ga0501079_0042905 3300049741 Bacteria 3491
258 Ga0501080_0072151 3300049742 Bacteria 3212
259 Ga0501081_0002285 3300049743 Bacteria 12066
260 Ga0501081_0006726 3300049743 Bacteria 7477
261 Ga0501081_0007973 3300049743 Bacteria 6872
262 Ga0501035_0022177 3300049822 Bacteria 5833
263 Ga0501045_0001893 3300049824 Bacteria 14173
264 Ga0501045_0006631 3300049824 Bacteria 8024
265 Ga0501045_0030805 3300049824 Bacteria 3883
266 nmdc:mga0yw44_28297_c1 3300050492 Bacteria 3222
267 nmdc:mga05p37_145913_c1 3300050507 Bacteria 2898
268 nmdc:mga0qj67_96646_c1 3300050509 Bacteria 2378
269 nmdc:mga06r32_119863_c1 3300050510 Bacteria 2594
270 nmdc:mga06r32_76248_c1 3300050510 Bacteria 3256
271 nmdc:mga08y16_171722_c1 3300050511 Bacteria 2252
272 nmdc:mga08y16_21432_c1 3300050511 Bacteria 6825
273 nmdc:mga08y16_3940_c1 3300050511 Bacteria 15462
274 nmdc:mga08y16_41103_c1 3300050511 Bacteria 4844
275 nmdc:mga08y16_52501_c1 3300050511 Bacteria 4265
276 nmdc:mga0n895_175953_c1 3300050512 Bacteria 2171
277 nmdc:mga0a205_13405_c1 3300050515 Bacteria 7633
278 nmdc:mga0a205_38861_c1 3300050515 Bacteria 4580
279 Ga0495619_0036083 3300053085 Bacteria 3218
280 Ga0495619_0101663 3300053085 Bacteria 1957
281 Ga0495619_0109806 3300053085 Bacteria 1884
282 Ga0501084_0007157 3300054114 Bacteria 9192
283 Ga0501084_0019465 3300054114 Bacteria 5655
284 Ga0501084_0070709 3300054114 Bacteria 2921
285 Ga0501082_0014225 3300060353 Bacteria 6848
286 Ga0501082_0022463 3300060353 Bacteria 5434
287 Ga0530510_0120768 3300061734 Bacteria 1923
288 Ga0070683_100087645
289 JGI25407J50210_10002742
290 Ga0070683_100006626
291 Ga0070683_100052676
292 Ga0070683_100079955
293 Ga0068869_100054227
294 Ga0070682_100020963
295 Ga0068868_100020858
296 Ga0070691_10001751
297 Ga0070661_100022498
298 Ga0070692_10001803
299 Ga0070692_10018728
300 Ga0070675_100011413
301 Ga0070673_100034028
302 Ga0070659_100144213
303 Ga0070659_100159158
304 Ga0070709_10017485
305 Ga0070705_100004779
306 Ga0070700_100030128
307 Ga0070694_100033340
308 Ga0070663_100065341
309 Ga0070678_100008330
310 Ga0070662_100004077
311 Ga0070684_100008382
312 Ga0070684_100020129
313 Ga0068853_100030793
314 Ga0070693_100027768
315 Ga0070693_100028482
316 Ga0070704_100071221
317 Ga0068855_100064853
318 Ga0068855_100100618
319 Ga0070664_100055265
320 Ga0070664_100113975
321 Ga0068857_100068625
322 Ga0068854_100007422
323 Ga0068854_100034595
324 Ga0068856_100090961
325 Ga0068856_100103682
326 Ga0070702_100008266
327 Ga0070702_100034945
328 Ga0070702_100040203
329 Ga0068852_100033143
330 Ga0068852_100064975
331 Ga0068864_100035928
332 Ga0068861_100062865
333 Ga0068861_100078539
334 Ga0068860_100107601
335 Ga0068862_100062817
336 Ga0081455_10005876
337 Ga0081455_10014272
338 Ga0081455_10018504
339 Ga0081455_10027438
340 Ga0081455_10055858
341 Ga0081538_10000148
342 Ga0081538_10000183
343 Ga0081538_10000634
344 Ga0081540_1011957
345 Ga0070717_10015352
346 Ga0075365_10029578
347 Ga0075432_10002690
348 Ga0075432_10011758
349 Ga0070712_100011405
350 Ga0070712_100065355
351 Ga0097621_100167359
352 Ga0075428_100043287
353 Ga0075428_100171603
354 Ga0075431_100001809
355 Ga0075431_100118989
356 Ga0075434_100001386
357 Ga0075434_100031939
358 Ga0075434_100181402
359 Ga0068865_100046088
360 Ga0075436_100012378
361 Ga0075435_100023810
362 Ga0111539_10006860
363 Ga0111539_10026479
364 Ga0111539_10044504
365 Ga0111539_10050375
366 Ga0111539_10065886
367 Ga0105245_10011224
368 Ga0105245_10032608
369 Ga0114129_10016452
370 Ga0114129_10126073
371 Ga0114129_10181186
372 Ga0105243_10004176
373 Ga0105243_10004963
374 Ga0105243_10174398
375 Ga0105242_10023331
376 Ga0105242_10041605
377 Ga0105248_10010620
378 Ga0105238_10005921
379 Ga0105249_10059305
380 Ga0105239_10011278
381 Ga0105239_10041264
382 Ga0105246_10011494
383 Ga0157371_10026068
384 Ga0157378_10116380
385 Ga0163162_10175071
386 Ga0157372_10004058
387 Ga0157375_10008377
388 Ga0157380_10007251
389 Ga0157377_10007892
390 Ga0157377_10032867
391 Ga0157379_10115760
392 Ga0157376_10052855
393 Ga0207688_10005993
394 Ga0207693_10007570
395 Ga0207693_10017735
396 Ga0207657_10007290
397 Ga0207694_10039788
398 Ga0207659_10018785
399 Ga0207690_10095815
400 Ga0207706_10061758
401 Ga0207686_10020378
402 Ga0207709_10029319
403 Ga0207665_10008558
404 Ga0207691_10051526
405 Ga0207689_10036280
406 Ga0207689_10100521
407 Ga0207661_10016221
408 Ga0207661_10109251
409 Ga0207661_10203087
410 Ga0207679_10053070
411 Ga0207677_10025528
412 Ga0207678_10007786
413 Ga0207678_10035670
414 Ga0207678_10057805
415 Ga0207648_10005667
416 Ga0207648_10016609
417 Ga0207674_10000884
418 Ga0207675_100005966
419 Ga0207675_100060532
420 Ga0207683_10007267
421 Ga0207683_10025353
422 Ga0207683_10068672
423 Ga0207698_10032289
424 Ga0207698_10049420
425 Ga0207698_10131035
426 Ga0207428_10006489
427 Ga0207428_10114029
428 Ga0207428_10125247
429 Ga0316575_10018712
430 Ga0316588_1006217
431 Ga0316584_0067121
432 Ga0395899_0003219
433 Ga0395899_0008947
434 Ga0395899_0019744
435 Ga0395899_0043894
436 Ga0395899_0098929
437 Ga0395900_0005303
438 Ga0395900_0008673
439 Ga0395900_0019417
440 Ga0395900_0065890
441 Ga0395900_0096870
442 Ga0395898_0001644
443 Ga0395898_0007751
444 Ga0395898_0009235
445 Ga0395898_0017483
446 Ga0395905_0007144
447 Ga0395905_0053163
448 Ga0395905_0057705
449 Ga0395901_0001203
450 Ga0395901_0006560
451 Ga0395901_0006678
452 Ga0395901_0069853
453 Ga0451835_0023365
454 Ga0451839_0674609
455 Ga0451853_0001880
456 Ga0451853_1157141
457 Ga0466958_0039429
458 Ga0466967_0015822
459 Ga0495592_0011093
460 Ga0495603_0014153
461 Ga0495653_0037218
462 Ga0495582_0003521
463 Ga0495582_0030463
464 Ga0495584_0043727
465 Ga0495584_0053407
466 Ga0495652_0069371
467 Ga0495609_0037161
468 Ga0495635_0096649
469 Ga0495613_0017076
470 Ga0495581_0001432
471 Ga0495680_0043443
472 Ga0496100_0021092
473 Ga0496100_0053217
474 Ga0496101_0020868
475 Ga0496101_0026218
476 Ga0496101_0051268
477 Ga0496101_0102869
478 Ga0496102_0001070
479 Ga0496102_0220628
480 Ga0496104_0000826
481 Ga0496104_0004458
482 Ga0496104_0014423
483 Ga0496106_0019096
484 Ga0496106_0126581
485 Ga0496107_0011200
486 Ga0496107_0099770
487 Ga0496108_0036794
488 Ga0496109_0001697
489 Ga0496109_0005423
490 Ga0496109_0008970
491 Ga0496109_0078753
492 Ga0496109_0095062
493 Ga0496110_0002619
494 Ga0496110_0029380
495 Ga0496110_0057356
496 Ga0496111_0021409
497 Ga0496112_0011907
498 Ga0496113_0012637
499 Ga0496113_0162246
500 Ga0496114_0001305
501 Ga0496114_0065707
502 Ga0501031_0065400
503 Ga0501032_0006150
504 Ga0501036_0049698
505 Ga0501036_0057109
506 Ga0501037_0013724
507 Ga0501037_0022735
508 Ga0501039_0022097
509 Ga0501039_0045888
510 Ga0501039_0100746
511 Ga0501040_0005202
512 Ga0501040_0095104
513 Ga0501040_0106986
514 Ga0501041_0002615
515 Ga0501041_0003763
516 Ga0501041_0013922
517 Ga0501042_0027666
518 Ga0501042_0029294
519 Ga0501046_0114119
520 Ga0501048_0011338
521 Ga0501068_0058171
522 Ga0501068_0062033
523 Ga0501069_0007357
524 Ga0501069_0009512
525 Ga0501070_0032434
526 Ga0501071_0000552
527 Ga0501071_0001349
528 Ga0501071_0028191
529 Ga0501072_0001831
530 Ga0501072_0004893
531 Ga0501072_0007506
532 Ga0501072_0043978
533 Ga0501072_0053529
534 Ga0501074_0038874
535 Ga0501074_0087766
536 Ga0501075_0011333
537 Ga0501075_0012227
538 Ga0501075_0030245
539 Ga0501076_0004863
540 Ga0501076_0063576
541 Ga0501077_0006748
542 Ga0501077_0015417
543 Ga0501077_0025835
544 Ga0501079_0042905
545 Ga0501080_0072151
546 Ga0501081_0002285
547 Ga0501081_0006726
548 Ga0501081_0007973
549 Ga0501035_0022177
550 Ga0501045_0001893
551 Ga0501045_0006631
552 Ga0501045_0030805
553 nmdc:mga0yw44_28297_c1
554 nmdc:mga05p37_145913_c1
555 nmdc:mga0qj67_96646_c1
556 nmdc:mga06r32_119863_c1
557 nmdc:mga06r32_76248_c1
558 nmdc:mga08y16_171722_c1
559 nmdc:mga08y16_21432_c1
560 nmdc:mga08y16_3940_c1
561 nmdc:mga08y16_41103_c1
562 nmdc:mga08y16_52501_c1
563 nmdc:mga0n895_175953_c1
564 nmdc:mga0a205_13405_c1
565 nmdc:mga0a205_38861_c1
566 Ga0495619_0036083
567 Ga0495619_0101663
568 Ga0495619_0109806
569 Ga0501084_0007157
570 Ga0501084_0019465
571 Ga0501084_0070709
572 Ga0501082_0014225
573 Ga0501082_0022463
574 Ga0530510_0120768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00664

ABC_membrane

ABC transporter transmembrane region

19

290

0.96

PF00005

ABC_tran

ABC transporter

352

501

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ghi-assembly1.cif.gz_A crystal structure of plasmodium yoelii multidrug resistance protein 2 0.943 289 499
2fgk-assembly2.cif.gz_B crystal structure of the abc-cassette e631q mutant of hlyb with bound atp 0.9312 294 499
4k8o-assembly1.cif.gz_A-2 crystal structure of the atpase domain of tap1 with atp (d645n, d651a mutant) 0.92 282 499
2ixe-assembly1.cif.gz_A crystal structure of the atpase domain of tap1 with atp (d645n mutant) 0.9188 282 499
2ixf-assembly2.cif.gz_C crystal structure of the atpase domain of tap1 with atp (d645q, q678h mutant) 0.9145 282 499
ID Description Score Start End Superfamily
af_A4I2J3_1020_1267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9582 292 499 3.40.50.300
af_Q61102_466_725_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 288 499 3.40.50.300
af_Q8T9W1_1574_1812_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9482 293 499 3.40.50.300
af_O53645_932_1184_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9463 284 499 3.40.50.300
af_Q19015_1020_1270_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9436 312 499 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W3T926-F1-model_v4 ATP-binding cassette domain-containing protein 0.9566 316 498 GO:0005524
GO:0015421
GO:0016887
AF-A0A5C7QJQ5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9503 345 498 GO:0005524
GO:0016887
GO:0042626
AF-A0A7X6ENN9-F1-model_v4 deleted 0.9441 368 456
AF-A0A317IEB6-F1-model_v4 ABC transporter domain-containing protein 0.9354 328 498 GO:0005524
GO:0015421
GO:0016887
AF-A0A652JU67-F1-model_v4 ABC transporter ATP-binding protein 0.9335 287 497 GO:0005524
GO:0015421
GO:0016887
GO:0090374

Map