F387599

General Info

Members Datasets Scaffolds Average Seq Length
286 181 572 333

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0084721|Ga0495608_0084721_345_1418
Length 357
Sequence MSWSDAVAVVLFFGVTAYAVFAGADFGAGFWDLIAGGARRGERPRAVIDHSIGPVWEANHVWLIFTLVVLWTAFSEAFASITLTLFVPLTLAALGIVLRGSSFAFRKAVFRTRDQRNFGAAFASSSVLVPYCMGAVAGAIASGRVPAGGEAGEPVSSWINPTSILGGVLAVTACAYLAAVYLVWDSRRLDDEVMTEYFRRRAIAAGVVVGVVAFVGIFVLHSDARYVFDGLASRALPFVILSALCGAGSLLLLFRNARGARALSIGAVATVVIGWGVAQWPYMLPTSLKVSQAAAPDGTLEAVLVVFAIAAVTILPALALLYVLDQKSALPEEGTEPGLRSPQPQTPRLDGPAAVHE

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
175 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
176 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
177 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
178 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
179 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
180 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
181 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 8.39
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0084721 3300046511 Bacteria 2055
2 JGI25407J50210_10000970 3300003373 Bacteria 6195
3 JGI25407J50210_10003574 3300003373 Bacteria 3733
4 JGI25407J50210_10013739 3300003373 Bacteria 2083
5 Ga0070658_10139105 3300005327 Bacteria 2027
6 Ga0070680_100011913 3300005336 Bacteria 6747
7 Ga0070680_100089309 3300005336 Bacteria 2550
8 Ga0070682_100026518 3300005337 Bacteria 3470
9 Ga0070682_100037212 3300005337 Bacteria 2978
10 Ga0070661_100011741 3300005344 Bacteria 6111
11 Ga0070668_100045337 3300005347 Bacteria 3374
12 Ga0070675_100333624 3300005354 Bacteria 1342
13 Ga0070674_100028390 3300005356 Bacteria 3675
14 Ga0070709_10074981 3300005434 Bacteria 2193
15 Ga0070714_100438925 3300005435 Bacteria 1239
16 Ga0070713_100003772 3300005436 Bacteria 10035
17 Ga0070700_100042621 3300005441 Bacteria 2788
18 Ga0070678_100273517 3300005456 Bacteria 1425
19 Ga0070662_100046889 3300005457 Bacteria 3106
20 Ga0070681_10000020 3300005458 Bacteria 123918
21 Ga0070681_10193278 3300005458 Bacteria 1954
22 Ga0068867_100034885 3300005459 Bacteria 3647
23 Ga0070679_100000044 3300005530 Bacteria 94029
24 Ga0070695_100156537 3300005545 Bacteria 1595
25 Ga0070693_100039417 3300005547 Bacteria 2646
26 Ga0068854_100082240 3300005578 Bacteria 2380
27 Ga0070702_100020186 3300005615 Bacteria 3486
28 Ga0070702_100022821 3300005615 Bacteria 3316
29 Ga0070702_100024096 3300005615 Bacteria 3242
30 Ga0068852_100040223 3300005616 Bacteria 3943
31 Ga0068859_100139802 3300005617 Bacteria 2495
32 Ga0068861_100068473 3300005719 Bacteria 2743
33 Ga0068861_100260059 3300005719 Bacteria 1485
34 Ga0068860_100008693 3300005843 Bacteria 10118
35 Ga0081455_10000024 3300005937 Bacteria 157764
36 Ga0081455_10038630 3300005937 Bacteria 4226
37 Ga0081455_10049887 3300005937 Unclassified 3605
38 Ga0081455_10071069 3300005937 Bacteria 2887
39 Ga0081538_10000210 3300005981 Bacteria 65100
40 Ga0081538_10000501 3300005981 Bacteria 43813
41 Ga0081538_10000657 3300005981 Bacteria 38241
42 Ga0081540_1005642 3300005983 Bacteria 9314
43 Ga0081539_10011688 3300005985 Bacteria 6900
44 Ga0075363_100018954 3300006048 Bacteria 3434
45 Ga0070715_10004784 3300006163 Bacteria 4479
46 Ga0070712_100079224 3300006175 Bacteria 2374
47 Ga0070712_100146557 3300006175 Bacteria 1807
48 Ga0068871_100085316 3300006358 Bacteria 2622
49 Ga0075428_100000457 3300006844 Bacteria 40962
50 Ga0075428_100011596 3300006844 Bacteria 9807
51 Ga0075428_100119732 3300006844 Bacteria 2866
52 Ga0075428_100126277 3300006844 Bacteria 2784
53 Ga0075430_100023301 3300006846 Bacteria 5268
54 Ga0075430_100032673 3300006846 Bacteria 4417
55 Ga0075430_100035386 3300006846 Bacteria 4237
56 Ga0075430_100173233 3300006846 Bacteria 1795
57 Ga0075430_100223167 3300006846 Bacteria 1563
58 Ga0075431_100001158 3300006847 Bacteria 23733
59 Ga0075431_100048344 3300006847 Bacteria 4387
60 Ga0075431_100255678 3300006847 Bacteria 1779
61 Ga0075434_100084039 3300006871 Bacteria 3182
62 Ga0075429_100001084 3300006880 Bacteria 21853
63 Ga0075429_100001705 3300006880 Bacteria 18170
64 Ga0068865_100042653 3300006881 Bacteria 3095
65 Ga0097620_100139805 3300006931 Bacteria 2495
66 Ga0075435_100230563 3300007076 Bacteria 1573
67 Ga0111539_10001032 3300009094 Bacteria 36496
68 Ga0111539_10193479 3300009094 Bacteria 2373
69 Ga0105245_10205880 3300009098 Bacteria 1891
70 Ga0105245_10342705 3300009098 Bacteria 1478
71 Ga0114129_10000014 3300009147 Bacteria 130267
72 Ga0114129_10050957 3300009147 Bacteria 5813
73 Ga0114129_10269471 3300009147 Bacteria 2279
74 Ga0114129_10389862 3300009147 Bacteria 1837
75 Ga0114129_10679645 3300009147 Bacteria 1325
76 Ga0105243_10001738 3300009148 Bacteria 18749
77 Ga0105243_10036404 3300009148 Bacteria 3820
78 Ga0105243_10062508 3300009148 Bacteria 2981
79 Ga0105243_10404363 3300009148 Bacteria 1269
80 Ga0105242_10061798 3300009176 Bacteria 3081
81 Ga0105249_10152445 3300009553 Bacteria 2226
82 Ga0105249_10179964 3300009553 Bacteria 2056
83 Ga0105249_10392935 3300009553 Bacteria 1415
84 Ga0105239_10304167 3300010375 Bacteria 1796
85 Ga0105239_10343967 3300010375 Bacteria 1683
86 Ga0157369_10011104 3300013105 Bacteria 10247
87 Ga0157375_10774766 3300013308 Bacteria 1109
88 Ga0163163_10074353 3300014325 Bacteria 3390
89 Ga0157380_10073546 3300014326 Bacteria 2772
90 Ga0163161_10221381 3300017792 Bacteria 1465
91 Ga0207692_10156487 3300025898 Bacteria 1310
92 Ga0207688_10060619 3300025901 Bacteria 2131
93 Ga0207699_10000040 3300025906 Bacteria 120655
94 Ga0207707_10000612 3300025912 Bacteria 35757
95 Ga0207693_10000637 3300025915 Bacteria 31341
96 Ga0207660_10000333 3300025917 Bacteria 30375
97 Ga0207660_10249169 3300025917 Bacteria 1402
98 Ga0207652_10000218 3300025921 Bacteria 60676
99 Ga0207659_10283996 3300025926 Bacteria 1354
100 Ga0207700_10003460 3300025928 Bacteria 9190
101 Ga0207690_10050779 3300025932 Bacteria 2770
102 Ga0207706_10015117 3300025933 Bacteria 6985
103 Ga0207709_10016395 3300025935 Bacteria 4118
104 Ga0207669_10030120 3300025937 Bacteria 3012
105 Ga0207669_10198351 3300025937 Bacteria 1455
106 Ga0207704_10074570 3300025938 Bacteria 2166
107 Ga0207661_10002884 3300025944 Bacteria 11893
108 Ga0207661_10153339 3300025944 Bacteria 1993
109 Ga0207677_10129329 3300026023 Bacteria 1914
110 Ga0207677_10129362 3300026023 Bacteria 1914
111 Ga0207677_10197441 3300026023 Bacteria 1596
112 Ga0207708_10007836 3300026075 Bacteria 7912
113 Ga0207708_10035960 3300026075 Bacteria 3769
114 Ga0207648_10035027 3300026089 Bacteria 4425
115 Ga0207676_10058548 3300026095 Bacteria 3039
116 Ga0207674_10015798 3300026116 Bacteria 8280
117 Ga0207675_100019409 3300026118 Bacteria 6342
118 Ga0207675_100064879 3300026118 Bacteria 3413
119 Ga0207675_100117832 3300026118 Bacteria 2511
120 Ga0207675_100259069 3300026118 Bacteria 1685
121 Ga0207698_10230763 3300026142 Bacteria 1680
122 Ga0207428_10014507 3300027907 Bacteria 6839
123 Ga0207428_10075058 3300027907 Bacteria 2650
124 Ga0268264_10004605 3300028381 Bacteria 11720
125 Ga0265327_10006071 3300031251 Bacteria 9799
126 Ga0265327_10023901 3300031251 Bacteria 3603
127 Ga0316575_10087140 3300031665 Bacteria 1262
128 Ga0307405_10030431 3300031731 Bacteria 3166
129 Ga0307405_10093121 3300031731 Bacteria 2001
130 Ga0307413_10003043 3300031824 Bacteria 6970
131 Ga0307413_10011464 3300031824 Bacteria 4361
132 Ga0307410_10010640 3300031852 Bacteria 5222
133 Ga0307406_10005319 3300031901 Bacteria 7042
134 Ga0307406_10159240 3300031901 Bacteria 1621
135 Ga0307407_10008826 3300031903 Bacteria 4654
136 Ga0307409_100025306 3300031995 Bacteria 4159
137 Ga0307409_100033949 3300031995 Bacteria 3720
138 Ga0307416_100022568 3300032002 Bacteria 4545
139 Ga0307416_100032200 3300032002 Bacteria 3958
140 Ga0307411_10025595 3300032005 Bacteria 3538
141 Ga0307415_100004956 3300032126 Bacteria 7006
142 Ga0307415_100015949 3300032126 Bacteria 4462
143 Ga0373926_0000016 3300035083 Bacteria 26994
144 Ga0373944_0000285 3300035089 Bacteria 11225
145 Ga0373936_0003999 3300035113 Bacteria 5555
146 Ga0373936_0115740 3300035113 Bacteria 1142
147 Ga0373945_0000031 3300035116 Bacteria 28586
148 Ga0373943_0007787 3300035170 Bacteria 4811
149 Ga0373946_0000151 3300035171 Bacteria 21089
150 Ga0373935_0000409 3300035692 Bacteria 22309
151 Ga0373935_0231886 3300035692 Bacteria 1286
152 Ga0373927_0000809 3300035695 Bacteria 23930
153 Ga0373947_0000293 3300035725 Bacteria 28170
154 Ga0373937_0012366 3300036401 Bacteria 7506
155 Ga0373937_0074944 3300036401 Bacteria 3124
156 Ga0373925_0000908 3300037068 Bacteria 27018
157 Ga0451853_3537872 3300041512 Bacteria 1545
158 Ga0439450_005991 3300042008 Bacteria 2168
159 Ga0439463_007266 3300042016 Bacteria 2736
160 Ga0466966_0013327 3300044684 Bacteria 5443
161 Ga0466961_0005900 3300044693 Bacteria 7763
162 Ga0466961_0107947 3300044693 Bacteria 1752
163 Ga0466968_0002059 3300044735 Bacteria 7320
164 Ga0466970_0008200 3300044765 Bacteria 5247
165 Ga0466970_0077514 3300044765 Bacteria 1792
166 Ga0466960_0037016 3300044901 Bacteria 2288
167 Ga0466958_0015776 3300045836 Bacteria 4339
168 Ga0466967_0066220 3300045976 Bacteria 3218
169 Ga0466967_0079676 3300045976 Bacteria 2953
170 Ga0466967_0240210 3300045976 Bacteria 1728
171 Ga0466967_0309784 3300045976 Bacteria 1521
172 Ga0495603_0072743 3300046455 Bacteria 2020
173 Ga0495629_0000404 3300046459 Bacteria 36222
174 Ga0495629_0053650 3300046459 Bacteria 2820
175 Ga0495641_0000671 3300046461 Bacteria 28836
176 Ga0495651_0012986 3300046462 Bacteria 6435
177 Ga0495651_0224514 3300046462 Bacteria 1298
178 Ga0495653_0016420 3300046463 Bacteria 6030
179 Ga0495653_0036656 3300046463 Bacteria 3861
180 Ga0495580_0027052 3300046472 Bacteria 4177
181 Ga0495582_0003109 3300046473 Bacteria 9305
182 Ga0495582_0133989 3300046473 Bacteria 1401
183 Ga0495639_0000832 3300046475 Bacteria 14057
184 Ga0495662_0000338 3300046476 Bacteria 20496
185 Ga0495662_0075189 3300046476 Bacteria 1639
186 Ga0495628_0023444 3300046516 Bacteria 5066
187 Ga0495630_0011611 3300046517 Bacteria 6381
188 Ga0495630_0050346 3300046517 Bacteria 3117
189 Ga0495630_0057045 3300046517 Bacteria 2927
190 Ga0495644_0013782 3300046523 Bacteria 3099
191 Ga0495666_0000094 3300046526 Bacteria 36379
192 Ga0495665_0000109 3300046531 Bacteria 38894
193 Ga0495640_0000565 3300046533 Bacteria 27203
194 Ga0495640_0067337 3300046533 Bacteria 2412
195 Ga0495586_0005149 3300046535 Bacteria 6998
196 Ga0495586_0029166 3300046535 Bacteria 2954
197 Ga0495667_0000792 3300046559 Bacteria 20332
198 Ga0495634_0000485 3300046642 Bacteria 39124
199 Ga0495634_0015378 3300046642 Bacteria 5501
200 Ga0495635_0005600 3300046663 Bacteria 8752
201 Ga0495588_0000522 3300046674 Bacteria 18568
202 Ga0495657_0010672 3300046675 Bacteria 6906
203 Ga0495623_0004551 3300046679 Bacteria 9108
204 Ga0495647_0000057 3300046681 Bacteria 28116
205 Ga0495658_0000643 3300046683 Bacteria 18898
206 Ga0495613_0000245 3300046689 Bacteria 51376
207 Ga0495613_0021282 3300046689 Bacteria 4836
208 Ga0495613_0163388 3300046689 Bacteria 1583
209 Ga0495624_0000268 3300046690 Bacteria 41265
210 Ga0495670_0047179 3300046691 Bacteria 2153
211 Ga0495581_0000288 3300047315 Bacteria 24478
212 Ga0495674_0001387 3300047319 Bacteria 23659
213 Ga0495674_0186449 3300047319 Bacteria 1726
214 Ga0495674_0256656 3300047319 Bacteria 1437
215 Ga0495674_0351400 3300047319 Bacteria 1197
216 Ga0495676_0046465 3300047321 Bacteria 3522
217 Ga0495680_0000581 3300047322 Bacteria 41016
218 Ga0495680_0001915 3300047322 Bacteria 21849
219 Ga0495675_0027105 3300047444 Bacteria 3651
220 Ga0495684_0013536 3300047471 Bacteria 6278
221 Ga0495593_0000186 3300047673 Bacteria 32409
222 Ga0495614_0000202 3300048089 Bacteria 22963
223 Ga0496100_0010523 3300048903 Bacteria 5239
224 Ga0496101_0004104 3300048904 Bacteria 9113
225 Ga0496101_0249492 3300048904 Bacteria 1383
226 Ga0496102_0077601 3300048905 Bacteria 3057
227 Ga0496102_0086673 3300048905 Bacteria 2892
228 Ga0496104_0028574 3300048907 Bacteria 5169
229 Ga0496104_0055759 3300048907 Bacteria 3737
230 Ga0496104_0350688 3300048907 Bacteria 1389
231 Ga0496105_0017533 3300048908 Bacteria 5744
232 Ga0496105_0030453 3300048908 Bacteria 4421
233 Ga0496107_0015682 3300048910 Bacteria 5312
234 Ga0496108_0191784 3300048911 Bacteria 1771
235 Ga0496108_0259468 3300048911 Bacteria 1512
236 Ga0496109_0012284 3300048912 Bacteria 7393
237 Ga0496109_0053025 3300048912 Bacteria 3698
238 Ga0496109_0058997 3300048912 Bacteria 3506
239 Ga0496109_0360060 3300048912 Bacteria 1374
240 Ga0496110_0198834 3300048913 Bacteria 1821
241 Ga0496111_0060943 3300048914 Bacteria 2735
242 Ga0496111_0064458 3300048914 Bacteria 2658
243 Ga0496112_0001238 3300048915 Bacteria 19274
244 Ga0496114_0028553 3300048917 Bacteria 4579
245 Ga0496114_0099922 3300048917 Bacteria 2475
246 Ga0496114_0176332 3300048917 Bacteria 1865
247 Ga0501034_0012491 3300049571 Bacteria 8771
248 Ga0501034_0084150 3300049571 Bacteria 3183
249 Ga0501039_0274308 3300049575 Bacteria 1326
250 Ga0501070_0063120 3300049586 Bacteria 3068
251 nmdc:mga0yw44_198315_c1 3300050492 Bacteria 1325
252 nmdc:mga05p37_164124_c1 3300050507 Bacteria 2712
253 nmdc:mga05p37_16628_c1 3300050507 Bacteria 8862
254 nmdc:mga05p37_363771_c1 3300050507 Bacteria 1700
255 nmdc:mga05p37_83924_c1 3300050507 Bacteria 3925
256 nmdc:mga09592_1240_c1 3300050508 Bacteria 20452
257 nmdc:mga09592_2756_c1 3300050508 Bacteria 14207
258 nmdc:mga0qj67_104347_c1 3300050509 Bacteria 2287
259 nmdc:mga0qj67_15450_c1 3300050509 Bacteria 5781
260 nmdc:mga0qj67_195008_c1 3300050509 Bacteria 1646
261 nmdc:mga0qj67_25184_c1 3300050509 Bacteria 4595
262 nmdc:mga0qj67_276362_c1 3300050509 Bacteria 1362
263 nmdc:mga0qj67_30923_c1 3300050509 Bacteria 4169
264 nmdc:mga06r32_111056_c1 3300050510 Bacteria 2698
265 nmdc:mga06r32_121647_c1 3300050510 Bacteria 2575
266 nmdc:mga06r32_86316_c1 3300050510 Bacteria 3061
267 nmdc:mga08y16_146754_c1 3300050511 Bacteria 2453
268 nmdc:mga08y16_15954_c1 3300050511 Bacteria 7897
269 nmdc:mga0rr50_321277_c1 3300050513 Bacteria 1298
270 Ga0495601_0024666 3300053077 Bacteria 3704
271 Ga0495595_0002069 3300053084 Bacteria 7802
272 Ga0495619_0000389 3300053085 Bacteria 29922
273 Ga0495619_0023825 3300053085 Bacteria 3924
274 Ga0495619_0029489 3300053085 Bacteria 3545
275 Ga0495619_0167151 3300053085 Bacteria 1520
276 Ga0500616_0003515 3300053153 Bacteria 11899
277 Ga0501084_0477236 3300054114 Bacteria 1054
278 Ga0466962_0090754 3300061719 Bacteria 1464
279 2585299471 2582581312 Bacteria 7308206
280 2744958282 2744054611 Bacteria 5611514
281 2884703451 2884693830 Bacteria 11273186
282 2891397390 2891395885 Bacteria 9251614
283 2891561251 2891554331 Bacteria 8812224
284 2895443524 2895442618 Bacteria 11027144
285 2912716444 2912715099 Bacteria 9460473
286 8055176747 8055172936 Bacteria 9305943
287 Ga0495608_0084721
288 JGI25407J50210_10000970
289 JGI25407J50210_10003574
290 JGI25407J50210_10013739
291 Ga0070658_10139105
292 Ga0070680_100011913
293 Ga0070680_100089309
294 Ga0070682_100026518
295 Ga0070682_100037212
296 Ga0070661_100011741
297 Ga0070668_100045337
298 Ga0070675_100333624
299 Ga0070674_100028390
300 Ga0070709_10074981
301 Ga0070714_100438925
302 Ga0070713_100003772
303 Ga0070700_100042621
304 Ga0070678_100273517
305 Ga0070662_100046889
306 Ga0070681_10000020
307 Ga0070681_10193278
308 Ga0068867_100034885
309 Ga0070679_100000044
310 Ga0070695_100156537
311 Ga0070693_100039417
312 Ga0068854_100082240
313 Ga0070702_100020186
314 Ga0070702_100022821
315 Ga0070702_100024096
316 Ga0068852_100040223
317 Ga0068859_100139802
318 Ga0068861_100068473
319 Ga0068861_100260059
320 Ga0068860_100008693
321 Ga0081455_10000024
322 Ga0081455_10038630
323 Ga0081455_10049887
324 Ga0081455_10071069
325 Ga0081538_10000210
326 Ga0081538_10000501
327 Ga0081538_10000657
328 Ga0081540_1005642
329 Ga0081539_10011688
330 Ga0075363_100018954
331 Ga0070715_10004784
332 Ga0070712_100079224
333 Ga0070712_100146557
334 Ga0068871_100085316
335 Ga0075428_100000457
336 Ga0075428_100011596
337 Ga0075428_100119732
338 Ga0075428_100126277
339 Ga0075430_100023301
340 Ga0075430_100032673
341 Ga0075430_100035386
342 Ga0075430_100173233
343 Ga0075430_100223167
344 Ga0075431_100001158
345 Ga0075431_100048344
346 Ga0075431_100255678
347 Ga0075434_100084039
348 Ga0075429_100001084
349 Ga0075429_100001705
350 Ga0068865_100042653
351 Ga0097620_100139805
352 Ga0075435_100230563
353 Ga0111539_10001032
354 Ga0111539_10193479
355 Ga0105245_10205880
356 Ga0105245_10342705
357 Ga0114129_10000014
358 Ga0114129_10050957
359 Ga0114129_10269471
360 Ga0114129_10389862
361 Ga0114129_10679645
362 Ga0105243_10001738
363 Ga0105243_10036404
364 Ga0105243_10062508
365 Ga0105243_10404363
366 Ga0105242_10061798
367 Ga0105249_10152445
368 Ga0105249_10179964
369 Ga0105249_10392935
370 Ga0105239_10304167
371 Ga0105239_10343967
372 Ga0157369_10011104
373 Ga0157375_10774766
374 Ga0163163_10074353
375 Ga0157380_10073546
376 Ga0163161_10221381
377 Ga0207692_10156487
378 Ga0207688_10060619
379 Ga0207699_10000040
380 Ga0207707_10000612
381 Ga0207693_10000637
382 Ga0207660_10000333
383 Ga0207660_10249169
384 Ga0207652_10000218
385 Ga0207659_10283996
386 Ga0207700_10003460
387 Ga0207690_10050779
388 Ga0207706_10015117
389 Ga0207709_10016395
390 Ga0207669_10030120
391 Ga0207669_10198351
392 Ga0207704_10074570
393 Ga0207661_10002884
394 Ga0207661_10153339
395 Ga0207677_10129329
396 Ga0207677_10129362
397 Ga0207677_10197441
398 Ga0207708_10007836
399 Ga0207708_10035960
400 Ga0207648_10035027
401 Ga0207676_10058548
402 Ga0207674_10015798
403 Ga0207675_100019409
404 Ga0207675_100064879
405 Ga0207675_100117832
406 Ga0207675_100259069
407 Ga0207698_10230763
408 Ga0207428_10014507
409 Ga0207428_10075058
410 Ga0268264_10004605
411 Ga0265327_10006071
412 Ga0265327_10023901
413 Ga0316575_10087140
414 Ga0307405_10030431
415 Ga0307405_10093121
416 Ga0307413_10003043
417 Ga0307413_10011464
418 Ga0307410_10010640
419 Ga0307406_10005319
420 Ga0307406_10159240
421 Ga0307407_10008826
422 Ga0307409_100025306
423 Ga0307409_100033949
424 Ga0307416_100022568
425 Ga0307416_100032200
426 Ga0307411_10025595
427 Ga0307415_100004956
428 Ga0307415_100015949
429 Ga0373926_0000016
430 Ga0373944_0000285
431 Ga0373936_0003999
432 Ga0373936_0115740
433 Ga0373945_0000031
434 Ga0373943_0007787
435 Ga0373946_0000151
436 Ga0373935_0000409
437 Ga0373935_0231886
438 Ga0373927_0000809
439 Ga0373947_0000293
440 Ga0373937_0012366
441 Ga0373937_0074944
442 Ga0373925_0000908
443 Ga0451853_3537872
444 Ga0439450_005991
445 Ga0439463_007266
446 Ga0466966_0013327
447 Ga0466961_0005900
448 Ga0466961_0107947
449 Ga0466968_0002059
450 Ga0466970_0008200
451 Ga0466970_0077514
452 Ga0466960_0037016
453 Ga0466958_0015776
454 Ga0466967_0066220
455 Ga0466967_0079676
456 Ga0466967_0240210
457 Ga0466967_0309784
458 Ga0495603_0072743
459 Ga0495629_0000404
460 Ga0495629_0053650
461 Ga0495641_0000671
462 Ga0495651_0012986
463 Ga0495651_0224514
464 Ga0495653_0016420
465 Ga0495653_0036656
466 Ga0495580_0027052
467 Ga0495582_0003109
468 Ga0495582_0133989
469 Ga0495639_0000832
470 Ga0495662_0000338
471 Ga0495662_0075189
472 Ga0495628_0023444
473 Ga0495630_0011611
474 Ga0495630_0050346
475 Ga0495630_0057045
476 Ga0495644_0013782
477 Ga0495666_0000094
478 Ga0495665_0000109
479 Ga0495640_0000565
480 Ga0495640_0067337
481 Ga0495586_0005149
482 Ga0495586_0029166
483 Ga0495667_0000792
484 Ga0495634_0000485
485 Ga0495634_0015378
486 Ga0495635_0005600
487 Ga0495588_0000522
488 Ga0495657_0010672
489 Ga0495623_0004551
490 Ga0495647_0000057
491 Ga0495658_0000643
492 Ga0495613_0000245
493 Ga0495613_0021282
494 Ga0495613_0163388
495 Ga0495624_0000268
496 Ga0495670_0047179
497 Ga0495581_0000288
498 Ga0495674_0001387
499 Ga0495674_0186449
500 Ga0495674_0256656
501 Ga0495674_0351400
502 Ga0495676_0046465
503 Ga0495680_0000581
504 Ga0495680_0001915
505 Ga0495675_0027105
506 Ga0495684_0013536
507 Ga0495593_0000186
508 Ga0495614_0000202
509 Ga0496100_0010523
510 Ga0496101_0004104
511 Ga0496101_0249492
512 Ga0496102_0077601
513 Ga0496102_0086673
514 Ga0496104_0028574
515 Ga0496104_0055759
516 Ga0496104_0350688
517 Ga0496105_0017533
518 Ga0496105_0030453
519 Ga0496107_0015682
520 Ga0496108_0191784
521 Ga0496108_0259468
522 Ga0496109_0012284
523 Ga0496109_0053025
524 Ga0496109_0058997
525 Ga0496109_0360060
526 Ga0496110_0198834
527 Ga0496111_0060943
528 Ga0496111_0064458
529 Ga0496112_0001238
530 Ga0496114_0028553
531 Ga0496114_0099922
532 Ga0496114_0176332
533 Ga0501034_0012491
534 Ga0501034_0084150
535 Ga0501039_0274308
536 Ga0501070_0063120
537 nmdc:mga0yw44_198315_c1
538 nmdc:mga05p37_164124_c1
539 nmdc:mga05p37_16628_c1
540 nmdc:mga05p37_363771_c1
541 nmdc:mga05p37_83924_c1
542 nmdc:mga09592_1240_c1
543 nmdc:mga09592_2756_c1
544 nmdc:mga0qj67_104347_c1
545 nmdc:mga0qj67_15450_c1
546 nmdc:mga0qj67_195008_c1
547 nmdc:mga0qj67_25184_c1
548 nmdc:mga0qj67_276362_c1
549 nmdc:mga0qj67_30923_c1
550 nmdc:mga06r32_111056_c1
551 nmdc:mga06r32_121647_c1
552 nmdc:mga06r32_86316_c1
553 nmdc:mga08y16_146754_c1
554 nmdc:mga08y16_15954_c1
555 nmdc:mga0rr50_321277_c1
556 Ga0495601_0024666
557 Ga0495595_0002069
558 Ga0495619_0000389
559 Ga0495619_0023825
560 Ga0495619_0029489
561 Ga0495619_0167151
562 Ga0500616_0003515
563 Ga0501084_0477236
564 Ga0466962_0090754
565 2585299471
566 2744958282
567 2884703451
568 2891397390
569 2891561251
570 2895443524
571 2912716444
572 8055176747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

3

325

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8536 1 326
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.849 3 322
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.826 3 330
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8104 1 326
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.7991 1 327
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5924 11 275 1.20.1630.10
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5798 169 284 1.10.10.1740
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5751 11 275 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5724 12 273 1.20.1630.10
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5275 169 284 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A132NF75-F1-model_v4 Cytochrome D ubiquinol oxidase subunit II 0.9951 1 163 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-D6KG90-F1-model_v4 Cytochrome D ubiquinol oxidase, subunit II 0.9912 12 253 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A7V9EER1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9907 5 258 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A850CDP5-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9887 1 285 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A7Y5RL68-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9885 4 186 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069

Map