F387550

General Info

Members Datasets Scaffolds Average Seq Length
286 172 573 314

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1534469|Ga0451853_1534469_294_1307
Length 337
Sequence VAPSDPPTAAAGPSRHLGLDLGATNLKWVVAERDGDAWRVLDRGQIPTRAGGPDAVVPQLAETGAAALEHWKGGSPGDGGPEVSSAGIGVPGLYDPEAGVTRFLVNVPGEWDGCQVARPVGEALGLPAFLINDARAFGLAELRLGAGRGAQSMVGLTLGTGVGGVIAIDGKVHQGHDGTAGEVGHQTIDPDGPWCNCGNRGCVEAYARADQLALACGTTTAEEAVIRARAGDARAIDGLAQIGRYLGIGIANLVTIIAPDRIVIGGGIAQAGDLLFDPIRAELRRRVHTTALSPVEIVAAELGTWAGAIGAAVHGAERAEAIGSLAGAGTGASGAGR

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.99
Rhizosphere 91.96
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1534469 3300041512 Bacteria 1457
2 rootL2_10265164 3300003322 Bacteria 1221
3 rootH1_10018647 3300003316 Bacteria 6528
4 rootH1_10018647 3300003323 Bacteria 3477
5 Ga0070683_100018300 3300005329 Bacteria 6202
6 Ga0070683_100153020 3300005329 Bacteria 2187
7 Ga0070690_100021430 3300005330 Bacteria 3946
8 Ga0070680_100300663 3300005336 Bacteria 1361
9 Ga0070660_100057261 3300005339 Bacteria 3018
10 Ga0070689_100016846 3300005340 Bacteria 5356
11 Ga0070691_10131350 3300005341 Unclassified 1269
12 Ga0070687_100002794 3300005343 Bacteria 6644
13 Ga0070661_100025226 3300005344 Bacteria 4272
14 Ga0070669_100114179 3300005353 Bacteria 2053
15 Ga0070675_100061067 3300005354 Bacteria 3112
16 Ga0070675_100247665 3300005354 Unclassified 1559
17 Ga0070674_100021484 3300005356 Bacteria 4145
18 Ga0070673_100092170 3300005364 Unclassified 2478
19 Ga0070688_100004937 3300005365 Bacteria 6978
20 Ga0070688_100370525 3300005365 Bacteria 1053
21 Ga0070659_100022576 3300005366 Bacteria 4804
22 Ga0070659_100113176 3300005366 Bacteria 2192
23 Ga0070701_10001451 3300005438 Bacteria 8775
24 Ga0070705_100034155 3300005440 Bacteria 2841
25 Ga0070700_100004373 3300005441 Bacteria 7374
26 Ga0070700_100022181 3300005441 Bacteria 3700
27 Ga0070694_100001490 3300005444 Bacteria 13746
28 Ga0070694_100033521 3300005444 Bacteria 3380
29 Ga0070694_100197064 3300005444 Bacteria 1499
30 Ga0070694_100202516 3300005444 Bacteria 1480
31 Ga0070708_100004493 3300005445 Bacteria 10972
32 Ga0070708_100042206 3300005445 Bacteria 4003
33 Ga0070708_100061077 3300005445 Bacteria 3366
34 Ga0070708_100102532 3300005445 Bacteria 2622
35 Ga0070678_100154443 3300005456 Bacteria 1853
36 Ga0070662_100004313 3300005457 Bacteria 8984
37 Ga0070681_10055627 3300005458 Bacteria 3939
38 Ga0068867_100023452 3300005459 Bacteria 4417
39 Ga0070706_100000330 3300005467 Bacteria 57694
40 Ga0070706_100005986 3300005467 Bacteria 11500
41 Ga0070706_100306516 3300005467 Bacteria 1481
42 Ga0070707_100002583 3300005468 Bacteria 17205
43 Ga0070707_100008381 3300005468 Bacteria 9599
44 Ga0070698_100032778 3300005471 Bacteria 5380
45 Ga0070698_100131167 3300005471 Bacteria 2461
46 Ga0070698_100137230 3300005471 Bacteria 2399
47 Ga0070698_100167401 3300005471 Unclassified 2140
48 Ga0070699_100004382 3300005518 Bacteria 12471
49 Ga0070699_100146614 3300005518 Unclassified 2086
50 Ga0070697_100000003 3300005536 Bacteria 322584
51 Ga0070697_100021137 3300005536 Bacteria 5154
52 Ga0070672_100036688 3300005543 Bacteria 3736
53 Ga0070686_100013477 3300005544 Bacteria 4683
54 Ga0070695_100015468 3300005545 Bacteria 4608
55 Ga0070695_100018318 3300005545 Bacteria 4253
56 Ga0070695_100019540 3300005545 Bacteria 4125
57 Ga0070695_100051772 3300005545 Bacteria 2636
58 Ga0070696_100005656 3300005546 Bacteria 8353
59 Ga0070696_100008248 3300005546 Bacteria 6973
60 Ga0070704_100118206 3300005549 Bacteria 2030
61 Ga0068855_100063482 3300005563 Bacteria 4311
62 Ga0068857_100047915 3300005577 Bacteria 3795
63 Ga0068854_100131853 3300005578 Bacteria 1909
64 Ga0070702_100013752 3300005615 Bacteria 4093
65 Ga0068852_100073785 3300005616 Unclassified 3003
66 Ga0068859_100127467 3300005617 Bacteria 2615
67 Ga0068866_10017610 3300005718 Bacteria 3216
68 Ga0068861_100048033 3300005719 Bacteria 3224
69 Ga0068870_10014522 3300005840 Bacteria 3721
70 Ga0068863_100239556 3300005841 Unclassified 1751
71 Ga0068858_100074365 3300005842 Bacteria 3155
72 Ga0068858_100188038 3300005842 Bacteria 1951
73 Ga0068858_100355907 3300005842 Bacteria 1403
74 Ga0068860_100008291 3300005843 Bacteria 10343
75 Ga0068860_100011632 3300005843 Bacteria 8679
76 Ga0068862_100109801 3300005844 Unclassified 2420
77 Ga0068862_100109915 3300005844 Bacteria 2419
78 Ga0075428_100037238 3300006844 Bacteria 5357
79 Ga0075433_10090871 3300006852 Bacteria 2699
80 Ga0068865_100005720 3300006881 Bacteria 7556
81 Ga0097620_100127461 3300006931 Bacteria 2615
82 Ga0111539_10010146 3300009094 Bacteria 11868
83 Ga0111539_10217632 3300009094 Bacteria 2224
84 Ga0105245_10004218 3300009098 Bacteria 12757
85 Ga0105245_10249766 3300009098 Bacteria 1723
86 Ga0114129_10106353 3300009147 Bacteria 3876
87 Ga0114129_10226356 3300009147 Bacteria 2520
88 Ga0105243_10006925 3300009148 Bacteria 8738
89 Ga0105243_10034982 3300009148 Bacteria 3894
90 Ga0105243_10063049 3300009148 Bacteria 2970
91 Ga0105242_10048774 3300009176 Bacteria 3443
92 Ga0105242_10378748 3300009176 Bacteria 1315
93 Ga0105248_10020337 3300009177 Bacteria 7354
94 Ga0105248_10417532 3300009177 Bacteria 1511
95 Ga0105239_10323354 3300010375 Bacteria 1739
96 Ga0157378_10124774 3300013297 Bacteria 2377
97 Ga0163162_10176160 3300013306 Bacteria 2264
98 Ga0157375_10003096 3300013308 Bacteria 14442
99 Ga0163163_10029892 3300014325 Bacteria 5243
100 Ga0157380_10001268 3300014326 Bacteria 16400
101 Ga0157380_10101369 3300014326 Bacteria 2399
102 Ga0157377_10000597 3300014745 Bacteria 14977
103 Ga0157379_10188636 3300014968 Unclassified 1863
104 Ga0157379_10396205 3300014968 Bacteria 1268
105 Ga0207653_10004475 3300025885 Bacteria 4380
106 Ga0207643_10006321 3300025908 Bacteria 6343
107 Ga0207684_10000342 3300025910 Bacteria 64928
108 Ga0207684_10009126 3300025910 Bacteria 8784
109 Ga0207684_10074208 3300025910 Bacteria 2890
110 Ga0207707_10136875 3300025912 Bacteria 2141
111 Ga0207660_10352175 3300025917 Bacteria 1180
112 Ga0207662_10000485 3300025918 Bacteria 17855
113 Ga0207662_10092683 3300025918 Bacteria 1860
114 Ga0207652_10088455 3300025921 Bacteria 2718
115 Ga0207646_10004136 3300025922 Bacteria 15933
116 Ga0207646_10005936 3300025922 Bacteria 12738
117 Ga0207646_10011511 3300025922 Bacteria 8557
118 Ga0207681_10091522 3300025923 Bacteria 2173
119 Ga0207687_10131648 3300025927 Bacteria 1886
120 Ga0207690_10003136 3300025932 Bacteria 9936
121 Ga0207690_10195163 3300025932 Unclassified 1534
122 Ga0207686_10148989 3300025934 Bacteria 1627
123 Ga0207670_10249695 3300025936 Unclassified 1370
124 Ga0207669_10034516 3300025937 Bacteria 2867
125 Ga0207704_10018293 3300025938 Bacteria 3654
126 Ga0207665_10124493 3300025939 Bacteria 1824
127 Ga0207691_10057341 3300025940 Bacteria 3545
128 Ga0207689_10046648 3300025942 Bacteria 3580
129 Ga0207689_10122959 3300025942 Bacteria 2134
130 Ga0207661_10181255 3300025944 Bacteria 1840
131 Ga0207667_10056434 3300025949 Bacteria 4126
132 Ga0207651_10111452 3300025960 Bacteria 2055
133 Ga0207640_10131630 3300025981 Bacteria 1809
134 Ga0207703_10153716 3300026035 Bacteria 2009
135 Ga0207703_10386707 3300026035 Bacteria 1295
136 Ga0207678_10015672 3300026067 Bacteria 6662
137 Ga0207708_10001983 3300026075 Bacteria 15084
138 Ga0207708_10022257 3300026075 Bacteria 4785
139 Ga0207708_10127236 3300026075 Bacteria 1989
140 Ga0207676_10013207 3300026095 Bacteria 5931
141 Ga0207674_10033054 3300026116 Bacteria 5419
142 Ga0207675_100078581 3300026118 Bacteria 3092
143 Ga0207675_100136113 3300026118 Bacteria 2331
144 Ga0207683_10036040 3300026121 Bacteria 4305
145 Ga0207698_10052821 3300026142 Bacteria 3116
146 Ga0209971_1018382 3300027682 Bacteria 1658
147 Ga0209998_10000578 3300027717 Bacteria 9847
148 Ga0209998_10019110 3300027717 Unclassified 1459
149 Ga0209974_10002491 3300027876 Bacteria 6667
150 Ga0268265_10436249 3300028380 Unclassified 1220
151 Ga0268264_10014913 3300028381 Bacteria 6383
152 Ga0265318_10010544 3300028577 Bacteria 4019
153 Ga0265316_10048996 3300031344 Bacteria 3330
154 Ga0265316_10154301 3300031344 Bacteria 1719
155 Ga0307408_100048865 3300031548 Bacteria 3036
156 Ga0316575_10041739 3300031665 Bacteria 1815
157 Ga0316576_10005170 3300031727 Bacteria 7930
158 Ga0316576_10008077 3300031727 Bacteria 6677
159 Ga0316576_10026574 3300031727 Unclassified 4063
160 Ga0316576_10029491 3300031727 Bacteria 3879
161 Ga0307413_10031874 3300031824 Bacteria 2980
162 Ga0307406_10126417 3300031901 Bacteria 1787
163 Ga0307407_10092928 3300031903 Bacteria 1854
164 Ga0307409_100003659 3300031995 Bacteria 8412
165 Ga0307409_100006178 3300031995 Bacteria 7008
166 Ga0307416_100000744 3300032002 Bacteria 17001
167 Ga0307415_100023678 3300032126 Bacteria 3818
168 Ga0316574_0121300 3300035398 Bacteria 1679
169 Ga0316574_0177004 3300035398 Bacteria 1373
170 Ga0373931_0016138 3300035691 Bacteria 3672
171 Ga0373947_0081287 3300035725 Bacteria 2006
172 Ga0316582_0038202 3300036647 Bacteria 2982
173 Ga0316584_0002911 3300036712 Bacteria 10997
174 Ga0495592_0207070 3300046454 Bacteria 1320
175 Ga0495603_0063639 3300046455 Bacteria 2176
176 Ga0495629_0185724 3300046459 Bacteria 1440
177 Ga0495676_0139788 3300047321 Unclassified 1737
178 Ga0496101_0056294 3300048904 Bacteria 2843
179 Ga0496102_0144041 3300048905 Bacteria 2235
180 Ga0496102_0247682 3300048905 Bacteria 1680
181 Ga0496103_0002951 3300048906 Bacteria 10544
182 Ga0496103_0061493 3300048906 Bacteria 2336
183 Ga0496103_0076021 3300048906 Bacteria 2107
184 Ga0496105_0125421 3300048908 Bacteria 2116
185 Ga0496106_0065823 3300048909 Bacteria 2759
186 Ga0496107_0215000 3300048910 Bacteria 1430
187 Ga0496108_0007932 3300048911 Bacteria 8606
188 Ga0496108_0389970 3300048911 Unclassified 1216
189 Ga0496109_0012413 3300048912 Bacteria 7355
190 Ga0496109_0063253 3300048912 Bacteria 3385
191 Ga0496109_0170035 3300048912 Bacteria 2044
192 Ga0496110_0012979 3300048913 Bacteria 6872
193 Ga0496111_0010446 3300048914 Bacteria 6231
194 Ga0496112_0059192 3300048915 Bacteria 3774
195 Ga0496113_0058366 3300048916 Bacteria 2903
196 Ga0496114_0131183 3300048917 Unclassified 2164
197 Ga0496114_0389450 3300048917 Bacteria 1234
198 Ga0501031_0023865 3300049568 Bacteria 3988
199 Ga0501031_0057223 3300049568 Bacteria 2540
200 Ga0501031_0103724 3300049568 Unclassified 1856
201 Ga0501031_0107804 3300049568 Bacteria 1819
202 Ga0501031_0123247 3300049568 Bacteria 1693
203 Ga0501032_0084266 3300049569 Bacteria 2113
204 Ga0501033_0208514 3300049570 Bacteria 1394
205 Ga0501036_0134061 3300049572 Unclassified 2090
206 Ga0501036_0179595 3300049572 Unclassified 1782
207 Ga0501036_0199812 3300049572 Bacteria 1681
208 Ga0501037_0035482 3300049573 Bacteria 3677
209 Ga0501038_0026819 3300049574 Bacteria 5130
210 Ga0501039_0218644 3300049575 Bacteria 1498
211 Ga0501040_0003534 3300049576 Bacteria 10101
212 Ga0501040_0010489 3300049576 Bacteria 6060
213 Ga0501040_0186509 3300049576 Bacteria 1471
214 Ga0501041_0400471 3300049577 Bacteria 869
215 Ga0501042_0004664 3300049578 Bacteria 8746
216 Ga0501042_0020510 3300049578 Bacteria 4601
217 Ga0501042_0056761 3300049578 Bacteria 2794
218 Ga0501042_0093922 3300049578 Bacteria 2154
219 Ga0501042_0105012 3300049578 Bacteria 2033
220 Ga0501046_0065054 3300049580 Bacteria 2846
221 Ga0501046_0156723 3300049580 Bacteria 1715
222 Ga0501046_0177962 3300049580 Unclassified 1592
223 Ga0501048_0007091 3300049582 Bacteria 8512
224 Ga0501048_0023490 3300049582 Bacteria 4505
225 Ga0501067_0001475 3300049583 Bacteria 12780
226 Ga0501067_0153268 3300049583 Bacteria 1284
227 Ga0501068_0029794 3300049584 Bacteria 3235
228 Ga0501068_0146729 3300049584 Bacteria 1481
229 Ga0501068_0167457 3300049584 Bacteria 1386
230 Ga0501069_0024356 3300049585 Bacteria 3300
231 Ga0501069_0025046 3300049585 Bacteria 3259
232 Ga0501069_0029422 3300049585 Bacteria 3014
233 Ga0501069_0070942 3300049585 Unclassified 1952
234 Ga0501070_0221888 3300049586 Bacteria 1550
235 Ga0501070_0296880 3300049586 Bacteria 1317
236 Ga0501071_0085689 3300049587 Bacteria 2310
237 Ga0501071_0195528 3300049587 Bacteria 1518
238 Ga0501072_0007498 3300049588 Bacteria 8279
239 Ga0501072_0050148 3300049588 Bacteria 3287
240 Ga0501072_0063411 3300049588 Bacteria 2915
241 Ga0501072_0107960 3300049588 Bacteria 2214
242 Ga0501072_0108466 3300049588 Bacteria 2209
243 Ga0501073_0063237 3300049589 Bacteria 2582
244 Ga0501073_0166966 3300049589 Bacteria 1524
245 Ga0501074_0055239 3300049590 Bacteria 2863
246 Ga0501075_0014217 3300049591 Bacteria 5702
247 Ga0501075_0028579 3300049591 Bacteria 4116
248 Ga0501075_0081051 3300049591 Bacteria 2456
249 Ga0501076_0010004 3300049592 Bacteria 7017
250 Ga0501076_0023114 3300049592 Bacteria 4787
251 Ga0501076_0031802 3300049592 Bacteria 4117
252 Ga0501076_0057793 3300049592 Bacteria 3081
253 Ga0501076_0126967 3300049592 Bacteria 2067
254 Ga0501076_0155623 3300049592 Bacteria 1860
255 Ga0501077_0002493 3300049593 Bacteria 11023
256 Ga0501077_0028547 3300049593 Bacteria 3546
257 Ga0501077_0179817 3300049593 Bacteria 1344
258 Ga0501079_0032408 3300049741 Bacteria 4017
259 Ga0501079_0261467 3300049741 Bacteria 1353
260 Ga0501080_0018139 3300049742 Bacteria 6514
261 Ga0501080_0328067 3300049742 Bacteria 1384
262 Ga0501080_0697995 3300049742 Bacteria 895
263 Ga0501081_0005027 3300049743 Bacteria 8509
264 Ga0501083_0088445 3300049744 Bacteria 2048
265 Ga0501045_0002860 3300049824 Bacteria 11801
266 Ga0501045_0065949 3300049824 Bacteria 2658
267 Ga0501045_0136537 3300049824 Bacteria 1823
268 Ga0501045_0244370 3300049824 Bacteria 1336
269 nmdc:mga06r32_58758_c1 3300050510 Bacteria 3696
270 nmdc:mga08y16_112674_c1 3300050511 Unclassified 2832
271 nmdc:mga08y16_166382_c1 3300050511 Bacteria 2291
272 nmdc:mga0a205_36698_c1 3300050515 Bacteria 4711
273 Ga0495612_0000043 3300053078 Bacteria 62532
274 Ga0501084_0013072 3300054114 Bacteria 6869
275 Ga0501084_0044955 3300054114 Bacteria 3698
276 Ga0501084_0055830 3300054114 Bacteria 3304
277 Ga0501084_0088703 3300054114 Bacteria 2596
278 Ga0501084_0096726 3300054114 Bacteria 2479
279 Ga0501084_0116519 3300054114 Bacteria 2246
280 Ga0590071_020894 3300059421 Bacteria 1542
281 Ga0590075_012367 3300059424 Bacteria 2073
282 Ga0501082_0009590 3300060353 Bacteria 8333
283 Ga0501082_0199849 3300060353 Unclassified 1739
284 Ga0501082_0441596 3300060353 Bacteria 1137
285 Ga0530510_0084381 3300061734 Bacteria 2313
286 Ga0530510_0085919 3300061734 Bacteria 2292
287 Ga0530510_0131711 3300061734 Bacteria 1840
288 Ga0451853_1534469
289 rootL2_10265164
290 rootH1_10018647
291 Ga0070683_100018300
292 Ga0070683_100153020
293 Ga0070690_100021430
294 Ga0070680_100300663
295 Ga0070660_100057261
296 Ga0070689_100016846
297 Ga0070691_10131350
298 Ga0070687_100002794
299 Ga0070661_100025226
300 Ga0070669_100114179
301 Ga0070675_100061067
302 Ga0070675_100247665
303 Ga0070674_100021484
304 Ga0070673_100092170
305 Ga0070688_100004937
306 Ga0070688_100370525
307 Ga0070659_100022576
308 Ga0070659_100113176
309 Ga0070701_10001451
310 Ga0070705_100034155
311 Ga0070700_100004373
312 Ga0070700_100022181
313 Ga0070694_100001490
314 Ga0070694_100033521
315 Ga0070694_100197064
316 Ga0070694_100202516
317 Ga0070708_100004493
318 Ga0070708_100042206
319 Ga0070708_100061077
320 Ga0070708_100102532
321 Ga0070678_100154443
322 Ga0070662_100004313
323 Ga0070681_10055627
324 Ga0068867_100023452
325 Ga0070706_100000330
326 Ga0070706_100005986
327 Ga0070706_100306516
328 Ga0070707_100002583
329 Ga0070707_100008381
330 Ga0070698_100032778
331 Ga0070698_100131167
332 Ga0070698_100137230
333 Ga0070698_100167401
334 Ga0070699_100004382
335 Ga0070699_100146614
336 Ga0070697_100000003
337 Ga0070697_100021137
338 Ga0070672_100036688
339 Ga0070686_100013477
340 Ga0070695_100015468
341 Ga0070695_100018318
342 Ga0070695_100019540
343 Ga0070695_100051772
344 Ga0070696_100005656
345 Ga0070696_100008248
346 Ga0070704_100118206
347 Ga0068855_100063482
348 Ga0068857_100047915
349 Ga0068854_100131853
350 Ga0070702_100013752
351 Ga0068852_100073785
352 Ga0068859_100127467
353 Ga0068866_10017610
354 Ga0068861_100048033
355 Ga0068870_10014522
356 Ga0068863_100239556
357 Ga0068858_100074365
358 Ga0068858_100188038
359 Ga0068858_100355907
360 Ga0068860_100008291
361 Ga0068860_100011632
362 Ga0068862_100109801
363 Ga0068862_100109915
364 Ga0075428_100037238
365 Ga0075433_10090871
366 Ga0068865_100005720
367 Ga0097620_100127461
368 Ga0111539_10010146
369 Ga0111539_10217632
370 Ga0105245_10004218
371 Ga0105245_10249766
372 Ga0114129_10106353
373 Ga0114129_10226356
374 Ga0105243_10006925
375 Ga0105243_10034982
376 Ga0105243_10063049
377 Ga0105242_10048774
378 Ga0105242_10378748
379 Ga0105248_10020337
380 Ga0105248_10417532
381 Ga0105239_10323354
382 Ga0157378_10124774
383 Ga0163162_10176160
384 Ga0157375_10003096
385 Ga0163163_10029892
386 Ga0157380_10001268
387 Ga0157380_10101369
388 Ga0157377_10000597
389 Ga0157379_10188636
390 Ga0157379_10396205
391 Ga0207653_10004475
392 Ga0207643_10006321
393 Ga0207684_10000342
394 Ga0207684_10009126
395 Ga0207684_10074208
396 Ga0207707_10136875
397 Ga0207660_10352175
398 Ga0207662_10000485
399 Ga0207662_10092683
400 Ga0207652_10088455
401 Ga0207646_10004136
402 Ga0207646_10005936
403 Ga0207646_10011511
404 Ga0207681_10091522
405 Ga0207687_10131648
406 Ga0207690_10003136
407 Ga0207690_10195163
408 Ga0207686_10148989
409 Ga0207670_10249695
410 Ga0207669_10034516
411 Ga0207704_10018293
412 Ga0207665_10124493
413 Ga0207691_10057341
414 Ga0207689_10046648
415 Ga0207689_10122959
416 Ga0207661_10181255
417 Ga0207667_10056434
418 Ga0207651_10111452
419 Ga0207640_10131630
420 Ga0207703_10153716
421 Ga0207703_10386707
422 Ga0207678_10015672
423 Ga0207708_10001983
424 Ga0207708_10022257
425 Ga0207708_10127236
426 Ga0207676_10013207
427 Ga0207674_10033054
428 Ga0207675_100078581
429 Ga0207675_100136113
430 Ga0207683_10036040
431 Ga0207698_10052821
432 Ga0209971_1018382
433 Ga0209998_10000578
434 Ga0209998_10019110
435 Ga0209974_10002491
436 Ga0268265_10436249
437 Ga0268264_10014913
438 Ga0265318_10010544
439 Ga0265316_10048996
440 Ga0265316_10154301
441 Ga0307408_100048865
442 Ga0316575_10041739
443 Ga0316576_10005170
444 Ga0316576_10008077
445 Ga0316576_10026574
446 Ga0316576_10029491
447 Ga0307413_10031874
448 Ga0307406_10126417
449 Ga0307407_10092928
450 Ga0307409_100003659
451 Ga0307409_100006178
452 Ga0307416_100000744
453 Ga0307415_100023678
454 Ga0316574_0121300
455 Ga0316574_0177004
456 Ga0373931_0016138
457 Ga0373947_0081287
458 Ga0316582_0038202
459 Ga0316584_0002911
460 Ga0495592_0207070
461 Ga0495603_0063639
462 Ga0495629_0185724
463 Ga0495676_0139788
464 Ga0496101_0056294
465 Ga0496102_0144041
466 Ga0496102_0247682
467 Ga0496103_0002951
468 Ga0496103_0061493
469 Ga0496103_0076021
470 Ga0496105_0125421
471 Ga0496106_0065823
472 Ga0496107_0215000
473 Ga0496108_0007932
474 Ga0496108_0389970
475 Ga0496109_0012413
476 Ga0496109_0063253
477 Ga0496109_0170035
478 Ga0496110_0012979
479 Ga0496111_0010446
480 Ga0496112_0059192
481 Ga0496113_0058366
482 Ga0496114_0131183
483 Ga0496114_0389450
484 Ga0501031_0023865
485 Ga0501031_0057223
486 Ga0501031_0103724
487 Ga0501031_0107804
488 Ga0501031_0123247
489 Ga0501032_0084266
490 Ga0501033_0208514
491 Ga0501036_0134061
492 Ga0501036_0179595
493 Ga0501036_0199812
494 Ga0501037_0035482
495 Ga0501038_0026819
496 Ga0501039_0218644
497 Ga0501040_0003534
498 Ga0501040_0010489
499 Ga0501040_0186509
500 Ga0501041_0400471
501 Ga0501042_0004664
502 Ga0501042_0020510
503 Ga0501042_0056761
504 Ga0501042_0093922
505 Ga0501042_0105012
506 Ga0501046_0065054
507 Ga0501046_0156723
508 Ga0501046_0177962
509 Ga0501048_0007091
510 Ga0501048_0023490
511 Ga0501067_0001475
512 Ga0501067_0153268
513 Ga0501068_0029794
514 Ga0501068_0146729
515 Ga0501068_0167457
516 Ga0501069_0024356
517 Ga0501069_0025046
518 Ga0501069_0029422
519 Ga0501069_0070942
520 Ga0501070_0221888
521 Ga0501070_0296880
522 Ga0501071_0085689
523 Ga0501071_0195528
524 Ga0501072_0007498
525 Ga0501072_0050148
526 Ga0501072_0063411
527 Ga0501072_0107960
528 Ga0501072_0108466
529 Ga0501073_0063237
530 Ga0501073_0166966
531 Ga0501074_0055239
532 Ga0501075_0014217
533 Ga0501075_0028579
534 Ga0501075_0081051
535 Ga0501076_0010004
536 Ga0501076_0023114
537 Ga0501076_0031802
538 Ga0501076_0057793
539 Ga0501076_0126967
540 Ga0501076_0155623
541 Ga0501077_0002493
542 Ga0501077_0028547
543 Ga0501077_0179817
544 Ga0501079_0032408
545 Ga0501079_0261467
546 Ga0501080_0018139
547 Ga0501080_0328067
548 Ga0501080_0697995
549 Ga0501081_0005027
550 Ga0501083_0088445
551 Ga0501045_0002860
552 Ga0501045_0065949
553 Ga0501045_0136537
554 Ga0501045_0244370
555 nmdc:mga06r32_58758_c1
556 nmdc:mga08y16_112674_c1
557 nmdc:mga08y16_166382_c1
558 nmdc:mga0a205_36698_c1
559 Ga0495612_0000043
560 Ga0501084_0013072
561 Ga0501084_0044955
562 Ga0501084_0055830
563 Ga0501084_0088703
564 Ga0501084_0096726
565 Ga0501084_0116519
566 Ga0590071_020894
567 Ga0590075_012367
568 Ga0501082_0009590
569 Ga0501082_0199849
570 Ga0501082_0441596
571 Ga0530510_0084381
572 Ga0530510_0085919
573 Ga0530510_0131711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

16

316

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bp8-assembly2.cif.gz_A crystal structure of mlc/eiib complex 0.8483 8 299
5f7r-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.8482 7 300
3vgk-assembly2.cif.gz_B crystal structure of a rok family glucokinase from streptomyces griseus 0.8401 7 298
5f7q-assembly1.cif.gz_J rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8276 7 300
2yhy-assembly1.cif.gz_A structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp 0.823 5 300
ID Description Score Start End Superfamily
af_A0A2R8Q4C4_26_129_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8914 18 41 3.10.450.10
af_I6Y8D3_1_125_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8868 8 134 3.30.420.40
3vgkB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8843 7 134 3.30.420.40
af_I6Y8D3_1_106_1.10.3290.10 Mainly Alpha;Orthogonal Bundle;Fic-like fold;Fido-like domain 0.8829 8 115 1.10.3290.10
1xqsC01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8762 7 40 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A139DTA0-F1-model_v4 deleted 0.8881 7 296
AF-A0A7T1ALG8-F1-model_v4 N-acetylglucosamine repressor 0.8835 7 297
AF-A0A2W4MGB2-F1-model_v4 deleted 0.883 7 299
AF-A0A496QM56-F1-model_v4 Transcription regulator TrmB N-terminal domain-containing protein 0.8802 7 292 GO:0042732
AF-K6P272-F1-model_v4 Transcriptional regulator/sugar kinase 0.8772 5 297 GO:0016301

Map