F387338

General Info

Members Datasets Scaffolds Average Seq Length
286 154 572 192

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10279769|Ga0070717_102797693
Length 220
Sequence VSPGTGDDFITLARVVKTQGRRGEVAAEVHSDFPGRFTEGMRLFALPPGTEETRRELQLEESWPHKGLLVLKFQGVESISDAESLVRCELQVPRSERAKLESGWNYVSDLVGCSLFDRGIVVGPIEDVQFGAGEAPLLIVADNSGKKLDVPFAEAYLESVDVKGKQVRMNLPEGMLEINAPVTNEEKLEQTASGEKNIKHRGHGGSQSKKNSRRAPRPLR

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
48 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
49 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
50 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
78 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
79 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 4.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.2
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 17.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10279769 3300006028 Unclassified 1480
2 Ga0058863_11905679 3300004799 Bacteria 1178
3 Ga0058862_10116988 3300004803 Unclassified 1569
4 Ga0058862_10251550 3300004803 Unclassified 1191
5 Ga0070683_100808888 3300005329 Bacteria 898
6 Ga0068868_100623660 3300005338 Bacteria 957
7 Ga0070709_10154169 3300005434 Bacteria 1591
8 Ga0070709_10438410 3300005434 Unclassified 982
9 Ga0070709_10675870 3300005434 Unclassified 801
10 Ga0070714_100000643 3300005435 Bacteria 24795
11 Ga0070714_100081431 3300005435 Unclassified 2818
12 Ga0070714_100096194 3300005435 Bacteria 2601
13 Ga0070714_100098866 3300005435 Bacteria 2567
14 Ga0070714_100232277 3300005435 Bacteria 1700
15 Ga0070714_100421858 3300005435 Unclassified 1264
16 Ga0070713_100001893 3300005436 Bacteria 13486
17 Ga0070713_100039916 3300005436 Bacteria 3813
18 Ga0070713_100160294 3300005436 Bacteria 2007
19 Ga0070713_100206736 3300005436 Bacteria 1775
20 Ga0070713_100220768 3300005436 Bacteria 1719
21 Ga0070713_100340527 3300005436 Bacteria 1389
22 Ga0070713_100444753 3300005436 Bacteria 1216
23 Ga0070710_10004191 3300005437 Bacteria 6838
24 Ga0070710_10138999 3300005437 Bacteria 1488
25 Ga0070710_10149463 3300005437 Bacteria 1439
26 Ga0070710_10558352 3300005437 Unclassified 792
27 Ga0070711_100083940 3300005439 Bacteria 2278
28 Ga0070711_100103025 3300005439 Bacteria 2079
29 Ga0070711_100151436 3300005439 Bacteria 1749
30 Ga0070711_100884620 3300005439 Bacteria 761
31 Ga0070708_100001614 3300005445 Bacteria 17288
32 Ga0070708_100021049 3300005445 Bacteria 5507
33 Ga0070708_100038301 3300005445 Bacteria 4189
34 Ga0070681_10024501 3300005458 Bacteria 6073
35 Ga0070681_10573209 3300005458 Bacteria 1042
36 Ga0070706_100122481 3300005467 Bacteria 2424
37 Ga0070706_100288770 3300005467 Bacteria 1531
38 Ga0070706_100336240 3300005467 Bacteria 1408
39 Ga0070706_100643278 3300005467 Unclassified 985
40 Ga0070707_100318123 3300005468 Bacteria 1512
41 Ga0070699_100007251 3300005518 Bacteria 9648
42 Ga0070699_100410221 3300005518 Bacteria 1225
43 Ga0070684_100052849 3300005535 Bacteria 3534
44 Ga0070697_100004824 3300005536 Bacteria 10337
45 Ga0068853_100071204 3300005539 Unclassified 3027
46 Ga0068853_100113098 3300005539 Unclassified 2413
47 Ga0070695_100037919 3300005545 Bacteria 3039
48 Ga0070696_100248155 3300005546 Bacteria 1345
49 Ga0070693_100245473 3300005547 Bacteria 1184
50 Ga0070664_100791456 3300005564 Bacteria 886
51 Ga0068856_100013835 3300005614 Bacteria 7801
52 Ga0068852_100654322 3300005616 Bacteria 1058
53 Ga0068851_10056273 3300005834 Bacteria 2005
54 Ga0070717_10031700 3300006028 Bacteria 4255
55 Ga0070717_10041754 3300006028 Bacteria 3740
56 Ga0070717_10119647 3300006028 Bacteria 2255
57 Ga0070717_10146051 3300006028 Bacteria 2043
58 Ga0070717_10161417 3300006028 Bacteria 1944
59 Ga0070717_10173683 3300006028 Bacteria 1875
60 Ga0070717_10341233 3300006028 Bacteria 1338
61 Ga0070717_10355366 3300006028 Bacteria 1310
62 Ga0070715_10026301 3300006163 Unclassified 2314
63 Ga0070715_10129645 3300006163 Unclassified 1212
64 Ga0070715_10291192 3300006163 Bacteria 870
65 Ga0070716_100001825 3300006173 Bacteria 9638
66 Ga0070716_100012899 3300006173 Bacteria 4247
67 Ga0070716_100097631 3300006173 Bacteria 1793
68 Ga0070716_100233735 3300006173 Bacteria 1242
69 Ga0070712_100004189 3300006175 Bacteria 8873
70 Ga0070712_100011293 3300006175 Bacteria 5658
71 Ga0070712_100057403 3300006175 Bacteria 2734
72 Ga0070712_100079322 3300006175 Bacteria 2372
73 Ga0070712_100666333 3300006175 Bacteria 885
74 Ga0075428_100838799 3300006844 Bacteria 976
75 Ga0075431_100595611 3300006847 Unclassified 1090
76 Ga0075433_10014644 3300006852 Bacteria 6414
77 Ga0075434_100006218 3300006871 Bacteria 10942
78 Ga0075434_100168817 3300006871 Unclassified 2208
79 Ga0075435_100016065 3300007076 Bacteria 5638
80 Ga0075435_100190014 3300007076 Bacteria 1738
81 Ga0075435_100447969 3300007076 Bacteria 1113
82 Ga0099795_10023968 3300007788 Bacteria 2030
83 Ga0105240_10006807 3300009093 Bacteria 16713
84 Ga0105240_10183772 3300009093 Bacteria 2465
85 Ga0105245_10004589 3300009098 Bacteria 12199
86 Ga0105245_10730803 3300009098 Unclassified 1025
87 Ga0114129_10105468 3300009147 Bacteria 3895
88 Ga0105241_10515429 3300009174 Bacteria 1069
89 Ga0105237_10336106 3300009545 Bacteria 1515
90 Ga0105238_10138680 3300009551 Bacteria 2409
91 Ga0105239_11296976 3300010375 Unclassified 840
92 Ga0157369_10155850 3300013105 Bacteria 2412
93 Ga0157369_10306141 3300013105 Bacteria 1653
94 Ga0157369_10798582 3300013105 Bacteria 970
95 Ga0157369_11120708 3300013105 Unclassified 804
96 Ga0157372_10288806 3300013307 Bacteria 1907
97 Ga0157379_10355179 3300014968 Bacteria 1342
98 Ga0157376_10245086 3300014969 Bacteria 1671
99 Ga0182007_10010181 3300015262 Bacteria 3732
100 Ga0224569_100042 3300022732 Bacteria 7926
101 Ga0224571_102560 3300022734 Unclassified 1158
102 Ga0224572_1000153 3300024225 Bacteria 6007
103 Ga0228598_1000505 3300024227 Bacteria 8069
104 Ga0228598_1002118 3300024227 Unclassified 4343
105 Ga0228598_1009549 3300024227 Bacteria 1942
106 Ga0228598_1011075 3300024227 Unclassified 1796
107 Ga0207656_10349013 3300025321 Unclassified 738
108 Ga0207692_10015461 3300025898 Bacteria 3359
109 Ga0207692_10020657 3300025898 Bacteria 3000
110 Ga0207685_10001876 3300025905 Bacteria 4620
111 Ga0207699_10000554 3300025906 Bacteria 18424
112 Ga0207699_10048156 3300025906 Bacteria 2503
113 Ga0207699_10512847 3300025906 Unclassified 866
114 Ga0207684_10102760 3300025910 Bacteria 2444
115 Ga0207684_10192011 3300025910 Bacteria 1762
116 Ga0207654_10248463 3300025911 Bacteria 1191
117 Ga0207707_10167635 3300025912 Bacteria 1919
118 Ga0207695_10025901 3300025913 Bacteria 6555
119 Ga0207671_10226614 3300025914 Bacteria 1465
120 Ga0207693_10003756 3300025915 Bacteria 12943
121 Ga0207693_10015238 3300025915 Bacteria 6169
122 Ga0207693_10039412 3300025915 Bacteria 3721
123 Ga0207693_10189361 3300025915 Bacteria 1619
124 Ga0207693_10243834 3300025915 Bacteria 1411
125 Ga0207693_10318246 3300025915 Bacteria 1218
126 Ga0207663_10055139 3300025916 Bacteria 2493
127 Ga0207663_10208819 3300025916 Bacteria 1414
128 Ga0207663_10226264 3300025916 Bacteria 1364
129 Ga0207649_10243917 3300025920 Bacteria 1291
130 Ga0207652_10295616 3300025921 Unclassified 1461
131 Ga0207652_10988313 3300025921 Unclassified 740
132 Ga0207646_10086030 3300025922 Bacteria 2812
133 Ga0207646_10429876 3300025922 Bacteria 1192
134 Ga0207646_10501004 3300025922 Bacteria 1094
135 Ga0207694_10573204 3300025924 Bacteria 948
136 Ga0207687_10002414 3300025927 Bacteria 12674
137 Ga0207700_10002235 3300025928 Bacteria 11116
138 Ga0207700_10003478 3300025928 Bacteria 9172
139 Ga0207700_10019040 3300025928 Bacteria 4629
140 Ga0207700_10031314 3300025928 Bacteria 3777
141 Ga0207700_10519199 3300025928 Bacteria 1055
142 Ga0207664_10001060 3300025929 Bacteria 18339
143 Ga0207664_10197595 3300025929 Bacteria 1734
144 Ga0207664_10269132 3300025929 Bacteria 1492
145 Ga0207664_10979420 3300025929 Unclassified 758
146 Ga0207665_10000036 3300025939 Bacteria 87649
147 Ga0207665_10006340 3300025939 Bacteria 7842
148 Ga0207665_10006897 3300025939 Bacteria 7518
149 Ga0207665_10012750 3300025939 Bacteria 5527
150 Ga0207665_10072436 3300025939 Bacteria 2353
151 Ga0207661_10036157 3300025944 Bacteria 3853
152 Ga0207661_10163450 3300025944 Unclassified 1933
153 Ga0207679_10294027 3300025945 Bacteria 1397
154 Ga0207667_10041809 3300025949 Bacteria 4873
155 Ga0207677_10450907 3300026023 Bacteria 1102
156 Ga0207639_10086337 3300026041 Unclassified 2498
157 Ga0207639_10320280 3300026041 Unclassified 1376
158 Ga0207702_10051915 3300026078 Bacteria 3467
159 Ga0207702_10237595 3300026078 Bacteria 1706
160 Ga0207702_10457842 3300026078 Bacteria 1239
161 Ga0207674_10275985 3300026116 Unclassified 1629
162 Ga0207674_10474024 3300026116 Bacteria 1210
163 Ga0265354_1002880 3300028016 Bacteria 2028
164 Ga0265356_1010778 3300028017 Unclassified 1017
165 Ga0265355_1000677 3300028036 Unclassified 1914
166 Ga0265338_10000833 3300028800 Bacteria 52026
167 Ga0265338_10211905 3300028800 Bacteria 1453
168 Ga0265762_1003425 3300030760 Bacteria 2841
169 Ga0265762_1006889 3300030760 Bacteria 2031
170 Ga0265770_1006185 3300030878 Bacteria 1662
171 Ga0265770_1028236 3300030878 Bacteria 926
172 Ga0265760_10007705 3300031090 Bacteria 3077
173 Ga0265760_10009810 3300031090 Unclassified 2733
174 Ga0265760_10015724 3300031090 Bacteria 2170
175 Ga0265760_10017406 3300031090 Bacteria 2064
176 Ga0265332_10120560 3300031238 Unclassified 1102
177 Ga0265339_10083872 3300031249 Bacteria 1680
178 Ga0265331_10047936 3300031250 Unclassified 2056
179 Ga0265316_10013294 3300031344 Bacteria 7319
180 Ga0265314_10008448 3300031711 Bacteria 8819
181 Ga0316053_100516 3300032120 Bacteria 1806
182 Ga0316214_1002619 3300033545 Bacteria 2219
183 Ga0373926_0006854 3300035083 Bacteria 3787
184 Ga0373934_0032860 3300035086 Bacteria 2036
185 Ga0373934_0187493 3300035086 Bacteria 851
186 Ga0373923_0022206 3300035111 Bacteria 2485
187 Ga0373936_0010803 3300035113 Bacteria 3447
188 Ga0373936_0020702 3300035113 Bacteria 2556
189 Ga0373945_0171293 3300035116 Bacteria 889
190 Ga0373953_0046374 3300035117 Bacteria 1744
191 Ga0373954_0027455 3300035118 Bacteria 2613
192 Ga0373956_0044862 3300035119 Bacteria 1971
193 Ga0373956_0070279 3300035119 Bacteria 1597
194 Ga0373957_0006230 3300035120 Bacteria 3749
195 Ga0373957_0019191 3300035120 Bacteria 2403
196 Ga0373943_0000097 3300035170 Bacteria 32274
197 Ga0373946_0003178 3300035171 Bacteria 5818
198 Ga0373955_0159616 3300035172 Bacteria 1330
199 Ga0373924_0004245 3300035410 Bacteria 4991
200 Ga0373924_0027969 3300035410 Bacteria 2244
201 Ga0373931_0040508 3300035691 Bacteria 2445
202 Ga0373935_0017438 3300035692 Bacteria 4356
203 Ga0373935_0131364 3300035692 Unclassified 1683
204 Ga0373935_0135008 3300035692 Bacteria 1661
205 Ga0373935_0151377 3300035692 Bacteria 1574
206 Ga0373927_0000812 3300035695 Bacteria 23883
207 Ga0373927_0002417 3300035695 Bacteria 13608
208 Ga0373927_0145467 3300035695 Bacteria 1551
209 Ga0373933_0034265 3300035724 Bacteria 2958
210 Ga0373933_0310891 3300035724 Bacteria 1021
211 Ga0373947_0053843 3300035725 Bacteria 2427
212 Ga0373947_0059657 3300035725 Bacteria 2313
213 Ga0373947_0275548 3300035725 Bacteria 1117
214 Ga0373937_0000531 3300036401 Bacteria 34073
215 Ga0373937_0024840 3300036401 Bacteria 5408
216 Ga0373937_0043571 3300036401 Bacteria 4097
217 Ga0373937_0297125 3300036401 Bacteria 1526
218 Ga0373937_0362160 3300036401 Bacteria 1374
219 Ga0373937_0460316 3300036401 Bacteria 1208
220 Ga0373925_0012971 3300037068 Bacteria 6034
221 Ga0373925_0038465 3300037068 Bacteria 3537
222 Ga0395898_0073714 3300037466 Bacteria 3298
223 Ga0436363_0752291 3300039450 Bacteria 997
224 Ga0451577_0003281 3300042876 Bacteria 18209
225 Ga0451577_0185334 3300042876 Bacteria 1877
226 Ga0466963_0000072 3300044694 Bacteria 35309
227 Ga0466963_0347072 3300044694 Unclassified 1045
228 Ga0453684_0000951 3300044712 Bacteria 95417
229 Ga0466957_0007975 3300044842 Bacteria 6008
230 Ga0466957_0721527 3300044842 Unclassified 704
231 Ga0451576_0033653 3300045051 Bacteria 5447
232 Ga0451576_0080152 3300045051 Bacteria 3397
233 Ga0451576_1862351 3300045051 Bacteria 621
234 Ga0466958_0813404 3300045836 Unclassified 609
235 Ga0466967_0092318 3300045976 Bacteria 2753
236 Ga0495592_0142861 3300046454 Bacteria 1663
237 Ga0495590_0038179 3300046457 Bacteria 1674
238 Ga0495580_0002254 3300046472 Bacteria 16837
239 Ga0495580_0003939 3300046472 Bacteria 12527
240 Ga0495580_0025342 3300046472 Bacteria 4335
241 Ga0495580_0206367 3300046472 Unclassified 1353
242 Ga0495580_0244532 3300046472 Bacteria 1229
243 Ga0495580_0296171 3300046472 Bacteria 1102
244 Ga0495580_0308180 3300046472 Bacteria 1077
245 Ga0495594_0045135 3300046499 Unclassified 2419
246 Ga0495608_0233509 3300046511 Bacteria 1151
247 Ga0495628_0040251 3300046516 Bacteria 3735
248 Ga0495628_0264744 3300046516 Bacteria 1280
249 Ga0495630_0016915 3300046517 Bacteria 5337
250 Ga0495630_0160515 3300046517 Bacteria 1712
251 Ga0495642_0036335 3300046528 Bacteria 1991
252 Ga0495665_0269210 3300046531 Unclassified 875
253 Ga0495586_0432504 3300046535 Unclassified 758
254 Ga0495667_0136526 3300046559 Bacteria 1581
255 Ga0495635_0058229 3300046663 Bacteria 2658
256 Ga0495588_0275197 3300046674 Bacteria 887
257 Ga0495657_0072697 3300046675 Bacteria 2242
258 Ga0495623_0042948 3300046679 Bacteria 2878
259 Ga0495669_0017381 3300046684 Bacteria 3087
260 Ga0495669_0031214 3300046684 Unclassified 2340
261 Ga0495624_0065462 3300046690 Bacteria 2271
262 Ga0495581_0091007 3300047315 Bacteria 1770
263 Ga0495674_0055004 3300047319 Unclassified 3492
264 Ga0495680_0089868 3300047322 Unclassified 2305
265 Ga0495602_0164630 3300048088 Bacteria 1728
266 Ga0495614_0037871 3300048089 Bacteria 2070
267 Ga0496104_0078497 3300048907 Unclassified 3146
268 Ga0496104_0332156 3300048907 Bacteria 1433
269 Ga0496105_0014598 3300048908 Bacteria 6255
270 Ga0496111_0013277 3300048914 Bacteria 5600
271 Ga0496111_0183230 3300048914 Unclassified 1557
272 Ga0496111_0285844 3300048914 Bacteria 1223
273 Ga0496112_0152152 3300048915 Bacteria 2281
274 Ga0496112_0522123 3300048915 Bacteria 1122
275 Ga0496112_0615519 3300048915 Unclassified 1017
276 Ga0496112_0651996 3300048915 Bacteria 982
277 Ga0496113_0002064 3300048916 Bacteria 11546
278 Ga0496115_0071794 3300048918 Bacteria 2808
279 nmdc:mga05p37_986683_c1 3300050507 Bacteria 897
280 nmdc:mga0n895_24901_c1 3300050512 Bacteria 5647
281 nmdc:mga0rr50_10175_c1 3300050513 Bacteria 5954
282 nmdc:mga0rr50_433139_c1 3300050513 Bacteria 1113
283 nmdc:mga0a205_5743_c1 3300050515 Bacteria 11181
284 Ga0495601_0013044 3300053077 Bacteria 4994
285 Ga0495619_0114180 3300053085 Bacteria 1848
286 Ga0587086_030092 3300059507 Unclassified 794
287 Ga0070717_10279769
288 Ga0058863_11905679
289 Ga0058862_10116988
290 Ga0058862_10251550
291 Ga0070683_100808888
292 Ga0068868_100623660
293 Ga0070709_10154169
294 Ga0070709_10438410
295 Ga0070709_10675870
296 Ga0070714_100000643
297 Ga0070714_100081431
298 Ga0070714_100096194
299 Ga0070714_100098866
300 Ga0070714_100232277
301 Ga0070714_100421858
302 Ga0070713_100001893
303 Ga0070713_100039916
304 Ga0070713_100160294
305 Ga0070713_100206736
306 Ga0070713_100220768
307 Ga0070713_100340527
308 Ga0070713_100444753
309 Ga0070710_10004191
310 Ga0070710_10138999
311 Ga0070710_10149463
312 Ga0070710_10558352
313 Ga0070711_100083940
314 Ga0070711_100103025
315 Ga0070711_100151436
316 Ga0070711_100884620
317 Ga0070708_100001614
318 Ga0070708_100021049
319 Ga0070708_100038301
320 Ga0070681_10024501
321 Ga0070681_10573209
322 Ga0070706_100122481
323 Ga0070706_100288770
324 Ga0070706_100336240
325 Ga0070706_100643278
326 Ga0070707_100318123
327 Ga0070699_100007251
328 Ga0070699_100410221
329 Ga0070684_100052849
330 Ga0070697_100004824
331 Ga0068853_100071204
332 Ga0068853_100113098
333 Ga0070695_100037919
334 Ga0070696_100248155
335 Ga0070693_100245473
336 Ga0070664_100791456
337 Ga0068856_100013835
338 Ga0068852_100654322
339 Ga0068851_10056273
340 Ga0070717_10031700
341 Ga0070717_10041754
342 Ga0070717_10119647
343 Ga0070717_10146051
344 Ga0070717_10161417
345 Ga0070717_10173683
346 Ga0070717_10341233
347 Ga0070717_10355366
348 Ga0070715_10026301
349 Ga0070715_10129645
350 Ga0070715_10291192
351 Ga0070716_100001825
352 Ga0070716_100012899
353 Ga0070716_100097631
354 Ga0070716_100233735
355 Ga0070712_100004189
356 Ga0070712_100011293
357 Ga0070712_100057403
358 Ga0070712_100079322
359 Ga0070712_100666333
360 Ga0075428_100838799
361 Ga0075431_100595611
362 Ga0075433_10014644
363 Ga0075434_100006218
364 Ga0075434_100168817
365 Ga0075435_100016065
366 Ga0075435_100190014
367 Ga0075435_100447969
368 Ga0099795_10023968
369 Ga0105240_10006807
370 Ga0105240_10183772
371 Ga0105245_10004589
372 Ga0105245_10730803
373 Ga0114129_10105468
374 Ga0105241_10515429
375 Ga0105237_10336106
376 Ga0105238_10138680
377 Ga0105239_11296976
378 Ga0157369_10155850
379 Ga0157369_10306141
380 Ga0157369_10798582
381 Ga0157369_11120708
382 Ga0157372_10288806
383 Ga0157379_10355179
384 Ga0157376_10245086
385 Ga0182007_10010181
386 Ga0224569_100042
387 Ga0224571_102560
388 Ga0224572_1000153
389 Ga0228598_1000505
390 Ga0228598_1002118
391 Ga0228598_1009549
392 Ga0228598_1011075
393 Ga0207656_10349013
394 Ga0207692_10015461
395 Ga0207692_10020657
396 Ga0207685_10001876
397 Ga0207699_10000554
398 Ga0207699_10048156
399 Ga0207699_10512847
400 Ga0207684_10102760
401 Ga0207684_10192011
402 Ga0207654_10248463
403 Ga0207707_10167635
404 Ga0207695_10025901
405 Ga0207671_10226614
406 Ga0207693_10003756
407 Ga0207693_10015238
408 Ga0207693_10039412
409 Ga0207693_10189361
410 Ga0207693_10243834
411 Ga0207693_10318246
412 Ga0207663_10055139
413 Ga0207663_10208819
414 Ga0207663_10226264
415 Ga0207649_10243917
416 Ga0207652_10295616
417 Ga0207652_10988313
418 Ga0207646_10086030
419 Ga0207646_10429876
420 Ga0207646_10501004
421 Ga0207694_10573204
422 Ga0207687_10002414
423 Ga0207700_10002235
424 Ga0207700_10003478
425 Ga0207700_10019040
426 Ga0207700_10031314
427 Ga0207700_10519199
428 Ga0207664_10001060
429 Ga0207664_10197595
430 Ga0207664_10269132
431 Ga0207664_10979420
432 Ga0207665_10000036
433 Ga0207665_10006340
434 Ga0207665_10006897
435 Ga0207665_10012750
436 Ga0207665_10072436
437 Ga0207661_10036157
438 Ga0207661_10163450
439 Ga0207679_10294027
440 Ga0207667_10041809
441 Ga0207677_10450907
442 Ga0207639_10086337
443 Ga0207639_10320280
444 Ga0207702_10051915
445 Ga0207702_10237595
446 Ga0207702_10457842
447 Ga0207674_10275985
448 Ga0207674_10474024
449 Ga0265354_1002880
450 Ga0265356_1010778
451 Ga0265355_1000677
452 Ga0265338_10000833
453 Ga0265338_10211905
454 Ga0265762_1003425
455 Ga0265762_1006889
456 Ga0265770_1006185
457 Ga0265770_1028236
458 Ga0265760_10007705
459 Ga0265760_10009810
460 Ga0265760_10015724
461 Ga0265760_10017406
462 Ga0265332_10120560
463 Ga0265339_10083872
464 Ga0265331_10047936
465 Ga0265316_10013294
466 Ga0265314_10008448
467 Ga0316053_100516
468 Ga0316214_1002619
469 Ga0373926_0006854
470 Ga0373934_0032860
471 Ga0373934_0187493
472 Ga0373923_0022206
473 Ga0373936_0010803
474 Ga0373936_0020702
475 Ga0373945_0171293
476 Ga0373953_0046374
477 Ga0373954_0027455
478 Ga0373956_0044862
479 Ga0373956_0070279
480 Ga0373957_0006230
481 Ga0373957_0019191
482 Ga0373943_0000097
483 Ga0373946_0003178
484 Ga0373955_0159616
485 Ga0373924_0004245
486 Ga0373924_0027969
487 Ga0373931_0040508
488 Ga0373935_0017438
489 Ga0373935_0131364
490 Ga0373935_0135008
491 Ga0373935_0151377
492 Ga0373927_0000812
493 Ga0373927_0002417
494 Ga0373927_0145467
495 Ga0373933_0034265
496 Ga0373933_0310891
497 Ga0373947_0053843
498 Ga0373947_0059657
499 Ga0373947_0275548
500 Ga0373937_0000531
501 Ga0373937_0024840
502 Ga0373937_0043571
503 Ga0373937_0297125
504 Ga0373937_0362160
505 Ga0373937_0460316
506 Ga0373925_0012971
507 Ga0373925_0038465
508 Ga0395898_0073714
509 Ga0436363_0752291
510 Ga0451577_0003281
511 Ga0451577_0185334
512 Ga0466963_0000072
513 Ga0466963_0347072
514 Ga0453684_0000951
515 Ga0466957_0007975
516 Ga0466957_0721527
517 Ga0451576_0033653
518 Ga0451576_0080152
519 Ga0451576_1862351
520 Ga0466958_0813404
521 Ga0466967_0092318
522 Ga0495592_0142861
523 Ga0495590_0038179
524 Ga0495580_0002254
525 Ga0495580_0003939
526 Ga0495580_0025342
527 Ga0495580_0206367
528 Ga0495580_0244532
529 Ga0495580_0296171
530 Ga0495580_0308180
531 Ga0495594_0045135
532 Ga0495608_0233509
533 Ga0495628_0040251
534 Ga0495628_0264744
535 Ga0495630_0016915
536 Ga0495630_0160515
537 Ga0495642_0036335
538 Ga0495665_0269210
539 Ga0495586_0432504
540 Ga0495667_0136526
541 Ga0495635_0058229
542 Ga0495588_0275197
543 Ga0495657_0072697
544 Ga0495623_0042948
545 Ga0495669_0017381
546 Ga0495669_0031214
547 Ga0495624_0065462
548 Ga0495581_0091007
549 Ga0495674_0055004
550 Ga0495680_0089868
551 Ga0495602_0164630
552 Ga0495614_0037871
553 Ga0496104_0078497
554 Ga0496104_0332156
555 Ga0496105_0014598
556 Ga0496111_0013277
557 Ga0496111_0183230
558 Ga0496111_0285844
559 Ga0496112_0152152
560 Ga0496112_0522123
561 Ga0496112_0615519
562 Ga0496112_0651996
563 Ga0496113_0002064
564 Ga0496115_0071794
565 nmdc:mga05p37_986683_c1
566 nmdc:mga0n895_24901_c1
567 nmdc:mga0rr50_10175_c1
568 nmdc:mga0rr50_433139_c1
569 nmdc:mga0a205_5743_c1
570 Ga0495601_0013044
571 Ga0495619_0114180
572 Ga0587086_030092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

11

96

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.8762 119 191
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8394 26 116
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.8149 119 191
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.813 26 116
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7558 26 191
ID Description Score Start End Superfamily
af_I1KSK3_79_172_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.9326 27 113 2.40.30.60
af_Q8IJ86_392_490_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.9267 25 113 2.40.30.60
af_P9WH19_2_95_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.9019 27 113 2.40.30.60
af_Q2FZ44_1_87_2.40.30.60 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8918 26 111 2.40.30.60
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8875 25 114 2.40.30.60
ID Description Score Start End GO Terms
AF-A0A849ZLR3-F1-model_v4 PRC-barrel domain-containing protein 0.9135 107 191 GO:0005840
GO:0006364
GO:0043022
AF-A0A3C1ZLS2-F1-model_v4 deleted 0.9102 25 185
AF-A0A1V5XJU3-F1-model_v4 Ribosome maturation factor RimM 0.9053 23 190 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A7V5ZED7-F1-model_v4 Ribosome maturation factor RimM 0.9047 20 111 GO:0006364
AF-A0A7X6SUR1-F1-model_v4 16S rRNA processing protein RimM 0.9043 27 100 GO:0005737
GO:0006364

Map