F387242

General Info

Members Datasets Scaffolds Average Seq Length
286 213 572 206

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100102282|Ga0070671_1001022823
Length 245
Sequence LTEGAKALVRVGLVGVPTRRPRRRLEGVDQRVAESRVRLRAVGFYVDRVLPRITDVALSGKEFAKLRARVCGGLSGEVLEVGFGSGRNVPHYPPAVERVQAVDPATAGRRLAANRLAATSIPIEFIGLNGEDLPLADASVDHVLTTWTLCTIPDVDRALAEMRRVLRPGGALHFVEHGLSPDAQVARWQDRLNPIQKRVFGGCHLNRPIDRLLENAGLRVAPLEKFYAKGPKAFGYLFEGVATKA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
112 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
187 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 2517572101 Frankia sp. DC12 Isolate Nodule
191 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
192 2619619003 Frankia sp. CpI1-P Isolate Nodule
193 2626541554 Frankia sp. AvcI.1 Isolate Nodule
194 2643221692 Nocardia sp. Root136 Isolate Unclassified
195 2671180195 Frankia sp. CcI49 Isolate Nodule
196 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
197 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
198 2687453737 Frankia sp. BMG5.36 Isolate Nodule
199 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
200 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
201 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
202 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
203 2773857922 Frankia sp. CcI49 Isolate Nodule
204 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
205 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
206 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
207 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
208 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
209 8002775197 Frankia nepalensis CN7 Isolate Nodule
210 8002784119 Frankia sp. AgB1.9 Isolate Nodule
211 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
212 8054920844 Frankia tisae Agncl-8 Isolate Nodule
213 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.56
Metatranscriptomes 0.35
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 4.9
Rhizoplane 9.09
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100102282 3300005355 Bacteria 2404
2 JGI24739J22299_10135315 3300001989 Bacteria 732
3 rootH1_10056215 3300003323 Bacteria 1503
4 Ga0070658_10003279 3300005327 Bacteria 13357
5 Ga0070658_10026317 3300005327 Bacteria 4666
6 Ga0070658_10075980 3300005327 Bacteria 2756
7 Ga0070683_100002777 3300005329 Bacteria 14001
8 Ga0070666_10082802 3300005335 Bacteria 2194
9 Ga0070682_100574685 3300005337 Bacteria 886
10 Ga0068868_100472215 3300005338 Bacteria 1094
11 Ga0070660_100143851 3300005339 Bacteria 1915
12 Ga0070687_100032935 3300005343 Bacteria 2554
13 Ga0070661_100135318 3300005344 Bacteria 1854
14 Ga0070692_10190005 3300005345 Bacteria 1196
15 Ga0070675_100558298 3300005354 Bacteria 1036
16 Ga0070659_100020097 3300005366 Bacteria 5071
17 Ga0070659_100387751 3300005366 Bacteria 1178
18 Ga0070713_100527663 3300005436 Bacteria 1116
19 Ga0070710_10047589 3300005437 Bacteria 2393
20 Ga0070663_100129614 3300005455 Bacteria 1914
21 Ga0070678_100857944 3300005456 Bacteria 828
22 Ga0070706_100004076 3300005467 Bacteria 14209
23 Ga0070707_100857095 3300005468 Bacteria 873
24 Ga0070698_100029569 3300005471 Bacteria 5689
25 Ga0070698_100155662 3300005471 Bacteria 2231
26 Ga0070679_100493734 3300005530 Bacteria 1168
27 Ga0070684_100000511 3300005535 Bacteria 26664
28 Ga0070684_100205413 3300005535 Bacteria 1795
29 Ga0070684_100844000 3300005535 Bacteria 857
30 Ga0068853_100123578 3300005539 Bacteria 2311
31 Ga0070665_100582230 3300005548 Bacteria 1132
32 Ga0068855_101569640 3300005563 Bacteria 674
33 Ga0068857_100008311 3300005577 Bacteria 8969
34 Ga0068854_100905098 3300005578 Bacteria 776
35 Ga0068856_100251574 3300005614 Bacteria 1782
36 Ga0068856_100614479 3300005614 Bacteria 1108
37 Ga0070702_100015108 3300005615 Bacteria 3933
38 Ga0068863_100250446 3300005841 Bacteria 1711
39 Ga0068863_100910037 3300005841 Bacteria 880
40 Ga0068858_100000018 3300005842 Bacteria 186799
41 Ga0068858_100003035 3300005842 Bacteria 16821
42 Ga0068858_100011369 3300005842 Bacteria 8406
43 Ga0068858_100577363 3300005842 Unclassified 1089
44 Ga0068862_100193548 3300005844 Bacteria 1831
45 Ga0070717_10003784 3300006028 Bacteria 10875
46 Ga0070717_10206992 3300006028 Bacteria 1721
47 Ga0075365_10000082 3300006038 Bacteria 27803
48 Ga0075363_100085331 3300006048 Bacteria 1732
49 Ga0075364_10044335 3300006051 Unclassified 2893
50 Ga0075364_10668296 3300006051 Bacteria 709
51 Ga0070712_100027591 3300006175 Bacteria 3792
52 Ga0075370_10260828 3300006353 Bacteria 1028
53 Ga0068871_100723882 3300006358 Bacteria 913
54 Ga0075428_100401991 3300006844 Bacteria 1468
55 Ga0075431_100081797 3300006847 Bacteria 3334
56 Ga0075434_100025806 3300006871 Bacteria 5752
57 Ga0075434_100651096 3300006871 Bacteria 1072
58 Ga0068865_100110887 3300006881 Bacteria 2024
59 Ga0075435_100461156 3300007076 Bacteria 1096
60 Ga0075435_100520617 3300007076 Bacteria 1029
61 Ga0111539_10081175 3300009094 Bacteria 3814
62 Ga0111539_10082786 3300009094 Bacteria 3774
63 Ga0111539_10273177 3300009094 Bacteria 1967
64 Ga0105245_10006752 3300009098 Bacteria 10064
65 Ga0105245_10059504 3300009098 Bacteria 3440
66 Ga0105247_10026619 3300009101 Bacteria 3494
67 Ga0105247_10774058 3300009101 Bacteria 730
68 Ga0114129_10021560 3300009147 Bacteria 9145
69 Ga0105243_10003238 3300009148 Bacteria 13286
70 Ga0105242_10273179 3300009176 Unclassified 1532
71 Ga0105248_10794837 3300009177 Bacteria 1068
72 Ga0105237_10254298 3300009545 Bacteria 1759
73 Ga0105239_10026339 3300010375 Bacteria 6399
74 Ga0105239_10274406 3300010375 Bacteria 1897
75 Ga0105246_10536301 3300011119 Bacteria 1000
76 Ga0157371_10207297 3300013102 Bacteria 1406
77 Ga0157369_10264108 3300013105 Bacteria 1795
78 Ga0157378_10588891 3300013297 Bacteria 1122
79 Ga0163162_10037324 3300013306 Bacteria 4848
80 Ga0157372_10001454 3300013307 Bacteria 25656
81 Ga0157372_10163571 3300013307 Bacteria 2572
82 Ga0157375_10004752 3300013308 Bacteria 11802
83 Ga0163163_10473659 3300014325 Bacteria 1313
84 Ga0157380_10007190 3300014326 Bacteria 7888
85 Ga0157377_10274578 3300014745 Bacteria 1102
86 Ga0157379_10000033 3300014968 Bacteria 83512
87 Ga0206353_10977685 3300020082 Bacteria 1965
88 Ga0207710_10000270 3300025900 Bacteria 42677
89 Ga0207688_10016972 3300025901 Bacteria 3956
90 Ga0207647_10014969 3300025904 Bacteria 5331
91 Ga0207699_10010724 3300025906 Bacteria 4609
92 Ga0207684_10000377 3300025910 Bacteria 60516
93 Ga0207662_10046189 3300025918 Bacteria 2576
94 Ga0207657_10160784 3300025919 Bacteria 1824
95 Ga0207649_10131047 3300025920 Bacteria 1703
96 Ga0207646_10679278 3300025922 Bacteria 922
97 Ga0207694_10746920 3300025924 Bacteria 826
98 Ga0207687_10061512 3300025927 Bacteria 2652
99 Ga0207690_10147342 3300025932 Bacteria 1741
100 Ga0207690_10191403 3300025932 Bacteria 1547
101 Ga0207709_10021156 3300025935 Bacteria 3679
102 Ga0207709_10116567 3300025935 Bacteria 1796
103 Ga0207711_10206966 3300025941 Bacteria 1791
104 Ga0207661_10089019 3300025944 Bacteria 2567
105 Ga0207703_10000017 3300026035 Bacteria 282185
106 Ga0207703_10006488 3300026035 Bacteria 9338
107 Ga0207703_10014566 3300026035 Bacteria 6135
108 Ga0207703_10206243 3300026035 Bacteria 1749
109 Ga0207703_10485474 3300026035 Unclassified 1158
110 Ga0207639_10212939 3300026041 Bacteria 1664
111 Ga0207678_10250100 3300026067 Bacteria 1518
112 Ga0207678_10291555 3300026067 Bacteria 1401
113 Ga0207702_10429284 3300026078 Bacteria 1279
114 Ga0207641_10001394 3300026088 Bacteria 23812
115 Ga0207641_10889138 3300026088 Bacteria 884
116 Ga0207676_10058032 3300026095 Bacteria 3051
117 Ga0207674_10015802 3300026116 Bacteria 8277
118 Ga0207683_10058394 3300026121 Bacteria 3387
119 Ga0207428_10065980 3300027907 Bacteria 2853
120 Ga0207428_10389816 3300027907 Bacteria 1021
121 Ga0268266_10939708 3300028379 Bacteria 836
122 Ga0307508_10031995 3300031616 Unclassified 4753
123 Ga0316575_10001871 3300031665 Bacteria 6927
124 Ga0316576_10104865 3300031727 Bacteria 2116
125 Ga0316576_10161062 3300031727 Bacteria 1692
126 Ga0316576_10328871 3300031727 Bacteria 1139
127 Ga0316578_10034975 3300031728 Bacteria 2886
128 Ga0307413_10087449 3300031824 Unclassified 2019
129 Ga0307409_100436207 3300031995 Unclassified 1261
130 Ga0373953_0000486 3300035117 Bacteria 10990
131 Ga0373954_0000779 3300035118 Bacteria 12288
132 Ga0373956_0000922 3300035119 Bacteria 12202
133 Ga0373957_0000316 3300035120 Bacteria 12139
134 Ga0373955_0000417 3300035172 Bacteria 18055
135 Ga0316574_0009458 3300035398 Bacteria 5462
136 Ga0316574_0019651 3300035398 Bacteria 3989
137 Ga0316574_0039930 3300035398 Bacteria 2888
138 Ga0316574_0088058 3300035398 Bacteria 1977
139 Ga0316574_0192102 3300035398 Bacteria 1313
140 Ga0316574_0276335 3300035398 Bacteria 1070
141 Ga0373924_0000467 3300035410 Bacteria 12403
142 Ga0373924_0106423 3300035410 Bacteria 1209
143 Ga0373933_0000239 3300035724 Bacteria 36227
144 Ga0373933_0049597 3300035724 Bacteria 2503
145 Ga0373933_0091764 3300035724 Bacteria 1875
146 Ga0373937_0000010 3300036401 Bacteria 163001
147 Ga0373937_0016998 3300036401 Bacteria 6470
148 Ga0373937_0267563 3300036401 Bacteria 1613
149 Ga0316582_0001082 3300036647 Bacteria 11487
150 Ga0316582_0091034 3300036647 Bacteria 2008
151 Ga0316582_0443991 3300036647 Bacteria 894
152 Ga0316584_0020726 3300036712 Bacteria 4770
153 Ga0316584_0270520 3300036712 Unclassified 1237
154 Ga0373925_0062256 3300037068 Bacteria 2805
155 Ga0373925_0423022 3300037068 Bacteria 1088
156 Ga0436362_0652365 3300039453 Bacteria 3540
157 Ga0451802_1552369 3300041460 Bacteria 1256
158 Ga0451851_0379268 3300041507 Bacteria 1834
159 Ga0451853_4056251 3300041512 Bacteria 1082
160 Ga0451577_0205856 3300042876 Unclassified 1776
161 Ga0451577_0522344 3300042876 Bacteria 1078
162 Ga0466961_0017204 3300044693 Bacteria 4645
163 Ga0466963_0185464 3300044694 Bacteria 1453
164 Ga0466963_0417030 3300044694 Bacteria 947
165 Ga0466971_0086221 3300044719 Bacteria 1435
166 Ga0466970_0072560 3300044765 Bacteria 1852
167 Ga0466957_0002628 3300044842 Bacteria 9697
168 Ga0466960_0030900 3300044901 Bacteria 2468
169 Ga0466960_0042289 3300044901 Bacteria 2163
170 Ga0466958_0007386 3300045836 Bacteria 6041
171 Ga0466967_0716293 3300045976 Bacteria 992
172 Ga0495592_0000136 3300046454 Bacteria 65571
173 Ga0495603_0256813 3300046455 Bacteria 1006
174 Ga0495651_0000809 3300046462 Bacteria 24220
175 Ga0495664_0246421 3300046477 Bacteria 1081
176 Ga0495594_0008361 3300046499 Bacteria 5331
177 Ga0495608_0000089 3300046511 Bacteria 65189
178 Ga0495628_0000818 3300046516 Bacteria 28789
179 Ga0495648_0019522 3300046524 Bacteria 4763
180 Ga0495666_0039728 3300046526 Unclassified 2283
181 Ga0495652_0001525 3300046529 Bacteria 25391
182 Ga0495652_0031744 3300046529 Bacteria 4623
183 Ga0495586_0071025 3300046535 Bacteria 1902
184 Ga0495587_0000074 3300046536 Bacteria 78796
185 Ga0495622_0013778 3300046557 Bacteria 3749
186 Ga0495667_0000540 3300046559 Bacteria 24191
187 Ga0495667_0005208 3300046559 Bacteria 8789
188 Ga0495657_0000009 3300046675 Bacteria 217555
189 Ga0495599_0000084 3300046678 Bacteria 65440
190 Ga0495623_0000346 3300046679 Bacteria 30558
191 Ga0495623_0023587 3300046679 Bacteria 3970
192 Ga0495646_0009639 3300046680 Bacteria 6130
193 Ga0495613_0295083 3300046689 Bacteria 1123
194 Ga0495671_0046984 3300046692 Bacteria 2158
195 Ga0495600_0033991 3300046809 Bacteria 3311
196 Ga0495600_0170251 3300046809 Bacteria 1406
197 Ga0495604_0000945 3300047317 Bacteria 24221
198 Ga0495672_0006905 3300047320 Bacteria 8653
199 Ga0495680_0000195 3300047322 Bacteria 65440
200 Ga0495675_0027710 3300047444 Bacteria 3611
201 Ga0495673_0000243 3300047469 Bacteria 77026
202 Ga0495684_0045212 3300047471 Bacteria 3370
203 Ga0495684_0268658 3300047471 Bacteria 1235
204 Ga0495602_0000122 3300048088 Bacteria 73031
205 Ga0496100_0678481 3300048903 Bacteria 803
206 Ga0496101_0010976 3300048904 Bacteria 6000
207 Ga0496102_0010729 3300048905 Bacteria 7892
208 Ga0496102_0043394 3300048905 Bacteria 4077
209 Ga0496102_0615127 3300048905 Bacteria 1009
210 Ga0496103_0055881 3300048906 Bacteria 2449
211 Ga0496103_0429916 3300048906 Bacteria 847
212 Ga0496104_0074649 3300048907 Bacteria 3228
213 Ga0496105_0012510 3300048908 Bacteria 6718
214 Ga0496106_0034787 3300048909 Bacteria 3765
215 Ga0496107_0277134 3300048910 Bacteria 1248
216 Ga0496109_0334158 3300048912 Bacteria 1431
217 Ga0496109_0347752 3300048912 Bacteria 1400
218 Ga0496110_0035334 3300048913 Bacteria 4335
219 Ga0496110_0636891 3300048913 Bacteria 965
220 Ga0496111_0002546 3300048914 Bacteria 11013
221 Ga0496111_0060655 3300048914 Bacteria 2742
222 Ga0496111_0149252 3300048914 Bacteria 1734
223 Ga0496111_0252829 3300048914 Bacteria 1308
224 Ga0496112_0777221 3300048915 Bacteria 883
225 Ga0496114_0012735 3300048917 Bacteria 6735
226 Ga0496114_0040193 3300048917 Bacteria 3871
227 Ga0496114_0079060 3300048917 Bacteria 2775
228 Ga0496114_0393523 3300048917 Bacteria 1227
229 Ga0496115_0025205 3300048918 Bacteria 4629
230 Ga0496116_0000291 3300048919 Bacteria 85243
231 Ga0496117_0006464 3300048920 Bacteria 11846
232 Ga0496118_0005746 3300048921 Bacteria 13954
233 Ga0496119_0003226 3300048922 Bacteria 17069
234 Ga0496119_0009514 3300048922 Bacteria 8325
235 Ga0496121_0002219 3300048924 Bacteria 30349
236 Ga0501034_0210409 3300049571 Bacteria 1900
237 Ga0501047_0000083 3300049581 Bacteria 121172
238 Ga0501069_0000062 3300049585 Bacteria 60065
239 Ga0501070_0000016 3300049586 Bacteria 178549
240 Ga0501074_0183764 3300049590 Bacteria 1491
241 Ga0501080_0000894 3300049742 Bacteria 24428
242 Ga0501045_0369920 3300049824 Bacteria 1067
243 Ga0501045_0607299 3300049824 Bacteria 810
244 nmdc:mga03n38_233089_c1 3300050490 Bacteria 966
245 nmdc:mga00v17_42044_c1 3300050491 Bacteria 2747
246 nmdc:mga00v17_573900_c1 3300050491 Bacteria 728
247 nmdc:mga0yw44_328530_c1 3300050492 Bacteria 1028
248 nmdc:mga0yw44_58_c1 3300050492 Bacteria 40044
249 nmdc:mga05p37_121058_c1 3300050507 Bacteria 3215
250 nmdc:mga06r32_3589_c1 3300050510 Bacteria 13845
251 nmdc:mga08y16_111227_c1 3300050511 Bacteria 2852
252 nmdc:mga08y16_408823_c1 3300050511 Bacteria 1388
253 nmdc:mga08y16_78398_c1 3300050511 Bacteria 3444
254 nmdc:mga0n895_56773_c1 3300050512 Bacteria 3858
255 nmdc:mga0rr50_196347_c1 3300050513 Bacteria 1656
256 nmdc:mga0a205_400304_c1 3300050515 Bacteria 1237
257 Ga0500560_000283 3300053107 Bacteria 6407
258 Ga0500573_0002284 3300053140 Bacteria 9516
259 Ga0500616_0093816 3300053153 Bacteria 1480
260 Ga0501084_0483157 3300054114 Bacteria 1047
261 2517764044 2517572101 Bacteria 6884336
262 2579857203 2579778521 Bacteria 7624758
263 2620353120 2619619003 Bacteria 7619552
264 2626634688 2626541554 Bacteria 7741902
265 2644516142 2643221692 Bacteria 7282860
266 2671835201 2671180195 Bacteria 9757215
267 2676202878 2675902999 Bacteria 9438463
268 2686536365 2684623035 Bacteria 8032739
269 2689956498 2687453737 Bacteria 11203906
270 2689963571 2687453737 Bacteria 11203906
271 2738890193 2738541308 Bacteria 7020677
272 2739206173 2738543005 Bacteria 5278128
273 2739237609 2738543011 Bacteria 5731169
274 2774847454 2773857921 Bacteria 9435764
275 2774853357 2773857922 Bacteria 9757215
276 2889305032 2889300758 Bacteria 5690814
277 2895881855 2895880812 Bacteria 11255272
278 2895885714 2895880812 Bacteria 11255272
279 2928146628 2928142448 Bacteria 5288925
280 2939746370 2939743619 Bacteria 5762299
281 3001889812 3001889506 Bacteria 2975194
282 8002781075 8002775197 Bacteria 10728764
283 8002786933 8002784119 Bacteria 9788632
284 8054914324 8054913762 Bacteria 7713009
285 8054925679 8054920844 Bacteria 7068637
286 8055158030 8055157932 Bacteria 6429399
287 Ga0070671_100102282
288 JGI24739J22299_10135315
289 rootH1_10056215
290 Ga0070658_10003279
291 Ga0070658_10026317
292 Ga0070658_10075980
293 Ga0070683_100002777
294 Ga0070666_10082802
295 Ga0070682_100574685
296 Ga0068868_100472215
297 Ga0070660_100143851
298 Ga0070687_100032935
299 Ga0070661_100135318
300 Ga0070692_10190005
301 Ga0070675_100558298
302 Ga0070659_100020097
303 Ga0070659_100387751
304 Ga0070713_100527663
305 Ga0070710_10047589
306 Ga0070663_100129614
307 Ga0070678_100857944
308 Ga0070706_100004076
309 Ga0070707_100857095
310 Ga0070698_100029569
311 Ga0070698_100155662
312 Ga0070679_100493734
313 Ga0070684_100000511
314 Ga0070684_100205413
315 Ga0070684_100844000
316 Ga0068853_100123578
317 Ga0070665_100582230
318 Ga0068855_101569640
319 Ga0068857_100008311
320 Ga0068854_100905098
321 Ga0068856_100251574
322 Ga0068856_100614479
323 Ga0070702_100015108
324 Ga0068863_100250446
325 Ga0068863_100910037
326 Ga0068858_100000018
327 Ga0068858_100003035
328 Ga0068858_100011369
329 Ga0068858_100577363
330 Ga0068862_100193548
331 Ga0070717_10003784
332 Ga0070717_10206992
333 Ga0075365_10000082
334 Ga0075363_100085331
335 Ga0075364_10044335
336 Ga0075364_10668296
337 Ga0070712_100027591
338 Ga0075370_10260828
339 Ga0068871_100723882
340 Ga0075428_100401991
341 Ga0075431_100081797
342 Ga0075434_100025806
343 Ga0075434_100651096
344 Ga0068865_100110887
345 Ga0075435_100461156
346 Ga0075435_100520617
347 Ga0111539_10081175
348 Ga0111539_10082786
349 Ga0111539_10273177
350 Ga0105245_10006752
351 Ga0105245_10059504
352 Ga0105247_10026619
353 Ga0105247_10774058
354 Ga0114129_10021560
355 Ga0105243_10003238
356 Ga0105242_10273179
357 Ga0105248_10794837
358 Ga0105237_10254298
359 Ga0105239_10026339
360 Ga0105239_10274406
361 Ga0105246_10536301
362 Ga0157371_10207297
363 Ga0157369_10264108
364 Ga0157378_10588891
365 Ga0163162_10037324
366 Ga0157372_10001454
367 Ga0157372_10163571
368 Ga0157375_10004752
369 Ga0163163_10473659
370 Ga0157380_10007190
371 Ga0157377_10274578
372 Ga0157379_10000033
373 Ga0206353_10977685
374 Ga0207710_10000270
375 Ga0207688_10016972
376 Ga0207647_10014969
377 Ga0207699_10010724
378 Ga0207684_10000377
379 Ga0207662_10046189
380 Ga0207657_10160784
381 Ga0207649_10131047
382 Ga0207646_10679278
383 Ga0207694_10746920
384 Ga0207687_10061512
385 Ga0207690_10147342
386 Ga0207690_10191403
387 Ga0207709_10021156
388 Ga0207709_10116567
389 Ga0207711_10206966
390 Ga0207661_10089019
391 Ga0207703_10000017
392 Ga0207703_10006488
393 Ga0207703_10014566
394 Ga0207703_10206243
395 Ga0207703_10485474
396 Ga0207639_10212939
397 Ga0207678_10250100
398 Ga0207678_10291555
399 Ga0207702_10429284
400 Ga0207641_10001394
401 Ga0207641_10889138
402 Ga0207676_10058032
403 Ga0207674_10015802
404 Ga0207683_10058394
405 Ga0207428_10065980
406 Ga0207428_10389816
407 Ga0268266_10939708
408 Ga0307508_10031995
409 Ga0316575_10001871
410 Ga0316576_10104865
411 Ga0316576_10161062
412 Ga0316576_10328871
413 Ga0316578_10034975
414 Ga0307413_10087449
415 Ga0307409_100436207
416 Ga0373953_0000486
417 Ga0373954_0000779
418 Ga0373956_0000922
419 Ga0373957_0000316
420 Ga0373955_0000417
421 Ga0316574_0009458
422 Ga0316574_0019651
423 Ga0316574_0039930
424 Ga0316574_0088058
425 Ga0316574_0192102
426 Ga0316574_0276335
427 Ga0373924_0000467
428 Ga0373924_0106423
429 Ga0373933_0000239
430 Ga0373933_0049597
431 Ga0373933_0091764
432 Ga0373937_0000010
433 Ga0373937_0016998
434 Ga0373937_0267563
435 Ga0316582_0001082
436 Ga0316582_0091034
437 Ga0316582_0443991
438 Ga0316584_0020726
439 Ga0316584_0270520
440 Ga0373925_0062256
441 Ga0373925_0423022
442 Ga0436362_0652365
443 Ga0451802_1552369
444 Ga0451851_0379268
445 Ga0451853_4056251
446 Ga0451577_0205856
447 Ga0451577_0522344
448 Ga0466961_0017204
449 Ga0466963_0185464
450 Ga0466963_0417030
451 Ga0466971_0086221
452 Ga0466970_0072560
453 Ga0466957_0002628
454 Ga0466960_0030900
455 Ga0466960_0042289
456 Ga0466958_0007386
457 Ga0466967_0716293
458 Ga0495592_0000136
459 Ga0495603_0256813
460 Ga0495651_0000809
461 Ga0495664_0246421
462 Ga0495594_0008361
463 Ga0495608_0000089
464 Ga0495628_0000818
465 Ga0495648_0019522
466 Ga0495666_0039728
467 Ga0495652_0001525
468 Ga0495652_0031744
469 Ga0495586_0071025
470 Ga0495587_0000074
471 Ga0495622_0013778
472 Ga0495667_0000540
473 Ga0495667_0005208
474 Ga0495657_0000009
475 Ga0495599_0000084
476 Ga0495623_0000346
477 Ga0495623_0023587
478 Ga0495646_0009639
479 Ga0495613_0295083
480 Ga0495671_0046984
481 Ga0495600_0033991
482 Ga0495600_0170251
483 Ga0495604_0000945
484 Ga0495672_0006905
485 Ga0495680_0000195
486 Ga0495675_0027710
487 Ga0495673_0000243
488 Ga0495684_0045212
489 Ga0495684_0268658
490 Ga0495602_0000122
491 Ga0496100_0678481
492 Ga0496101_0010976
493 Ga0496102_0010729
494 Ga0496102_0043394
495 Ga0496102_0615127
496 Ga0496103_0055881
497 Ga0496103_0429916
498 Ga0496104_0074649
499 Ga0496105_0012510
500 Ga0496106_0034787
501 Ga0496107_0277134
502 Ga0496109_0334158
503 Ga0496109_0347752
504 Ga0496110_0035334
505 Ga0496110_0636891
506 Ga0496111_0002546
507 Ga0496111_0060655
508 Ga0496111_0149252
509 Ga0496111_0252829
510 Ga0496112_0777221
511 Ga0496114_0012735
512 Ga0496114_0040193
513 Ga0496114_0079060
514 Ga0496114_0393523
515 Ga0496115_0025205
516 Ga0496116_0000291
517 Ga0496117_0006464
518 Ga0496118_0005746
519 Ga0496119_0003226
520 Ga0496119_0009514
521 Ga0496121_0002219
522 Ga0501034_0210409
523 Ga0501047_0000083
524 Ga0501069_0000062
525 Ga0501070_0000016
526 Ga0501074_0183764
527 Ga0501080_0000894
528 Ga0501045_0369920
529 Ga0501045_0607299
530 nmdc:mga03n38_233089_c1
531 nmdc:mga00v17_42044_c1
532 nmdc:mga00v17_573900_c1
533 nmdc:mga0yw44_328530_c1
534 nmdc:mga0yw44_58_c1
535 nmdc:mga05p37_121058_c1
536 nmdc:mga06r32_3589_c1
537 nmdc:mga08y16_111227_c1
538 nmdc:mga08y16_408823_c1
539 nmdc:mga08y16_78398_c1
540 nmdc:mga0n895_56773_c1
541 nmdc:mga0rr50_196347_c1
542 nmdc:mga0a205_400304_c1
543 Ga0500560_000283
544 Ga0500573_0002284
545 Ga0500616_0093816
546 Ga0501084_0483157
547 2517764044
548 2579857203
549 2620353120
550 2626634688
551 2644516142
552 2671835201
553 2676202878
554 2686536365
555 2689956498
556 2689963571
557 2738890193
558 2739206173
559 2739237609
560 2774847454
561 2774853357
562 2889305032
563 2895881855
564 2895885714
565 2928146628
566 2939746370
567 3001889812
568 8002781075
569 8002786933
570 8054914324
571 8054925679
572 8055158030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

79

174

0.97

PF13649

Methyltransf_25

Methyltransferase domain

78

170

0.95

PF08242

Methyltransf_12

Methyltransferase domain

79

172

0.89

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

65

186

0.86

PF13489

Methyltransf_23

Methyltransferase domain

54

223

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.8022 22 187
4pne-assembly3.cif.gz_A crystal structure of the [4+2]-cyclase spnf 0.7858 24 207
1xxl-assembly2.cif.gz_B the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution 0.7789 19 207
3bus-assembly2.cif.gz_B crystal structure of rebm 0.7777 24 205
5e72-assembly1.cif.gz_A crystal structure of the archaeal trna m2g/m22g10 methyltransferase (atrm11) in complex with s-adenosyl-l-methionine (sam) from thermococcus kodakarensis 0.7735 30 202
ID Description Score Start End Superfamily
af_Q4DS78_179_367_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.918 24 205 3.40.50.150
af_A4HWZ1_308_486_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9176 83 205 3.40.50.150
af_Q4DRI7_264_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9101 83 205 3.40.50.150
af_O06547_23_200_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8874 14 191 3.40.50.150
af_Q562C4_44_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8864 16 183 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6G9YCJ0-F1-model_v4 Methyltransferase domain-containing protein 0.9931 1 204 GO:0008757
GO:0032259
AF-A0A4Q2SFD8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9931 26 202 GO:0008757
GO:0032259
AF-A0A1H6AJI7-F1-model_v4 Methyltransferase domain-containing protein 0.9891 1 207 GO:0008757
GO:0032259
AF-A0A7W0TFX2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9888 1 128 GO:0008757
GO:0032259
AF-A0A6L5F5S7-F1-model_v4 Methyltransferase domain-containing protein 0.9885 1 205 GO:0008757
GO:0032259

Map