F387241

General Info

Members Datasets Scaffolds Average Seq Length
286 144 572 326

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100110809|Ga0070675_1001108091
Length 372
Sequence MGACTAHVRLSPEADFGCPPSRTVVSVGTIPCSSLRGRPGADMKRREFITLLSGAVVAWPLTARAQQPKKIPRLCFLTFDPGTLQSRSPRFDAFFEGLRDLGYVNGQTITIDYLSANGQSERFASLAAECVRLKADIIAVSTTPAAQAAKNTTHTIPIVMIALGDPVGTGLVKNLARPGENITGMSMMVPELAAKRLGLLKQVVPQISRILVLSYLADPIAPLQVKALNEAARSLGVTLLVQDIRSGDDLAAAFEAGSREHVEGLLTTAESIFVVHAARVAELAARYKLPAIYPQSIQVTEGGGLMAYDVDIRELHKSAALYVDRIVKGAKPSDLPVQQPTKVQFIINLKAAKALDLAIPPDLLDIADKVIE

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.09
Rhizosphere 90.56
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100110809 3300005354 Unclassified 2322
2 MBSR1b_contig_13237396 2162886012 Bacteria 1719
3 MBSR1b_contig_5921557 2162886012 Bacteria 1864
4 Ga0065712_10078287 3300005290 Bacteria 3369
5 Ga0065715_10091165 3300005293 Bacteria 6040
6 Ga0065715_10140391 3300005293 Bacteria 1863
7 Ga0070690_100166751 3300005330 Bacteria 1513
8 Ga0070670_100023854 3300005331 Bacteria 5264
9 Ga0070670_100331260 3300005331 Bacteria 1335
10 Ga0070677_10027394 3300005333 Bacteria 2145
11 Ga0068869_100152792 3300005334 Bacteria 1791
12 Ga0070689_100332610 3300005340 Bacteria 1271
13 Ga0070668_100003536 3300005347 Bacteria 11525
14 Ga0070668_100160794 3300005347 Bacteria 1822
15 Ga0070675_100010329 3300005354 Bacteria 7290
16 Ga0070709_10017494 3300005434 Bacteria 4113
17 Ga0070709_10073039 3300005434 Unclassified 2220
18 Ga0070709_10200715 3300005434 Bacteria 1412
19 Ga0070714_100064753 3300005435 Bacteria 3147
20 Ga0070714_100178329 3300005435 Bacteria 1932
21 Ga0070714_100280051 3300005435 Bacteria 1549
22 Ga0070714_100284057 3300005435 Unclassified 1538
23 Ga0070714_100318658 3300005435 Bacteria 1453
24 Ga0070713_100059423 3300005436 Bacteria 3193
25 Ga0070713_100066604 3300005436 Bacteria 3029
26 Ga0070713_100197200 3300005436 Bacteria 1817
27 Ga0070713_100310319 3300005436 Unclassified 1454
28 Ga0070710_10025170 3300005437 Bacteria 3149
29 Ga0070710_10062770 3300005437 Bacteria 2120
30 Ga0070710_10118292 3300005437 Bacteria 1600
31 Ga0070701_10096311 3300005438 Bacteria 1631
32 Ga0070711_100034582 3300005439 Bacteria 3372
33 Ga0070711_100042625 3300005439 Bacteria 3069
34 Ga0070711_100129538 3300005439 Bacteria 1877
35 Ga0070711_100280852 3300005439 Bacteria 1317
36 Ga0070694_100117324 3300005444 Bacteria 1905
37 Ga0070708_100006592 3300005445 Bacteria 9241
38 Ga0070708_100011102 3300005445 Bacteria 7320
39 Ga0070708_100017106 3300005445 Bacteria 6038
40 Ga0070708_100047109 3300005445 Bacteria 3807
41 Ga0070708_100049040 3300005445 Bacteria 3734
42 Ga0070708_100071766 3300005445 Bacteria 3118
43 Ga0070708_100089514 3300005445 Bacteria 2800
44 Ga0070708_100127170 3300005445 Bacteria 2356
45 Ga0070708_100175553 3300005445 Unclassified 2002
46 Ga0070708_100334347 3300005445 Unclassified 1427
47 Ga0070708_100419937 3300005445 Unclassified 1261
48 Ga0070663_100063544 3300005455 Bacteria 2666
49 Ga0070678_100015752 3300005456 Bacteria 4814
50 Ga0070678_100153076 3300005456 Bacteria 1860
51 Ga0070681_10326680 3300005458 Bacteria 1444
52 Ga0070706_100019303 3300005467 Bacteria 6287
53 Ga0070706_100038195 3300005467 Bacteria 4433
54 Ga0070706_100085236 3300005467 Bacteria 2927
55 Ga0070706_100163428 3300005467 Bacteria 2079
56 Ga0070706_100185591 3300005467 Unclassified 1943
57 Ga0070706_100188691 3300005467 Bacteria 1926
58 Ga0070706_100192934 3300005467 Bacteria 1903
59 Ga0070706_100478462 3300005467 Bacteria 1159
60 Ga0070707_100006939 3300005468 Bacteria 10500
61 Ga0070707_100051593 3300005468 Bacteria 3943
62 Ga0070707_100058211 3300005468 Bacteria 3706
63 Ga0070707_100076649 3300005468 Bacteria 3225
64 Ga0070707_100148711 3300005468 Bacteria 2280
65 Ga0070707_100301683 3300005468 Unclassified 1556
66 Ga0070707_100368556 3300005468 Unclassified 1395
67 Ga0070698_100023540 3300005471 Bacteria 6438
68 Ga0070698_100083855 3300005471 Bacteria 3176
69 Ga0070698_100090783 3300005471 Bacteria 3037
70 Ga0070698_100168243 3300005471 Bacteria 2133
71 Ga0070698_100265892 3300005471 Unclassified 1647
72 Ga0070699_100029075 3300005518 Bacteria 4765
73 Ga0070699_100034252 3300005518 Bacteria 4389
74 Ga0070699_100069801 3300005518 Bacteria 3053
75 Ga0070699_100154217 3300005518 Bacteria 2032
76 Ga0070697_100024642 3300005536 Bacteria 4792
77 Ga0070697_100070078 3300005536 Bacteria 2873
78 Ga0068853_100440705 3300005539 Unclassified 1224
79 Ga0070672_100195890 3300005543 Unclassified 1688
80 Ga0070686_100310659 3300005544 Unclassified 1172
81 Ga0070695_100002763 3300005545 Bacteria 10181
82 Ga0070696_100057853 3300005546 Bacteria 2706
83 Ga0070696_100289428 3300005546 Bacteria 1251
84 Ga0068856_100554533 3300005614 Bacteria 1170
85 Ga0068859_100141383 3300005617 Bacteria 2480
86 Ga0068861_100065552 3300005719 Bacteria 2798
87 Ga0068863_100205350 3300005841 Bacteria 1896
88 Ga0068860_100074338 3300005843 Bacteria 3232
89 Ga0068860_100102245 3300005843 Bacteria 2734
90 Ga0068860_100592606 3300005843 Bacteria 1113
91 Ga0068862_100060182 3300005844 Bacteria 3261
92 Ga0081455_10031477 3300005937 Bacteria 4799
93 Ga0081455_10078558 3300005937 Bacteria 2712
94 Ga0070717_10024818 3300006028 Bacteria 4763
95 Ga0070717_10156065 3300006028 Unclassified 1977
96 Ga0070717_10260768 3300006028 Bacteria 1533
97 Ga0070717_10274647 3300006028 Bacteria 1493
98 Ga0070717_10348363 3300006028 Bacteria 1324
99 Ga0070715_10004823 3300006163 Bacteria 4466
100 Ga0070715_10040985 3300006163 Bacteria 1938
101 Ga0070716_100135354 3300006173 Bacteria 1564
102 Ga0070712_100160739 3300006175 Bacteria 1734
103 Ga0070712_100304279 3300006175 Bacteria 1291
104 Ga0068871_100096550 3300006358 Bacteria 2469
105 Ga0075428_100037628 3300006844 Bacteria 5325
106 Ga0075428_100053314 3300006844 Bacteria 4431
107 Ga0075430_100220984 3300006846 Bacteria 1572
108 Ga0075431_100024955 3300006847 Bacteria 6128
109 Ga0075431_100049139 3300006847 Bacteria 4350
110 Ga0075433_10001447 3300006852 Bacteria 17531
111 Ga0075433_10016552 3300006852 Bacteria 6082
112 Ga0075434_100043025 3300006871 Unclassified 4478
113 Ga0075434_100049797 3300006871 Unclassified 4160
114 Ga0075434_100083172 3300006871 Bacteria 3198
115 Ga0075434_100099417 3300006871 Bacteria 2915
116 Ga0075434_100449647 3300006871 Bacteria 1309
117 Ga0075436_100032361 3300006914 Bacteria 3604
118 Ga0075436_100262501 3300006914 Bacteria 1232
119 Ga0097620_100141384 3300006931 Bacteria 2480
120 Ga0075435_100018614 3300007076 Bacteria 5288
121 Ga0075435_100021088 3300007076 Bacteria 5005
122 Ga0075435_100030530 3300007076 Bacteria 4239
123 Ga0075435_100081250 3300007076 Archaea 2662
124 Ga0075435_100364754 3300007076 Bacteria 1239
125 Ga0099794_10131772 3300007265 Bacteria 1263
126 Ga0111539_10171358 3300009094 Plasmid 2536
127 Ga0105245_10139359 3300009098 Bacteria 2283
128 Ga0105247_10147924 3300009101 Bacteria 1545
129 Ga0114129_10034471 3300009147 Bacteria 7149
130 Ga0114129_10061659 3300009147 Bacteria 5241
131 Ga0114129_10221011 3300009147 Plasmid 2555
132 Ga0114129_10607872 3300009147 Bacteria 1416
133 Ga0105242_10157094 3300009176 Bacteria 1987
134 Ga0105248_10030996 3300009177 Bacteria 5975
135 Ga0105248_10080761 3300009177 Unclassified 3655
136 Ga0105249_10050440 3300009553 Bacteria 3794
137 Ga0105239_10089780 3300010375 Bacteria 3389
138 Ga0105239_10318412 3300010375 Bacteria 1754
139 Ga0105246_10077908 3300011119 Bacteria 2353
140 Ga0157378_10047921 3300013297 Bacteria 3799
141 Ga0157378_10093401 3300013297 Unclassified 2738
142 Ga0163162_10014972 3300013306 Bacteria 7575
143 Ga0163162_10408409 3300013306 Unclassified 1491
144 Ga0163162_10519901 3300013306 Bacteria 1320
145 Ga0163162_10536711 3300013306 Unclassified 1299
146 Ga0163162_10542374 3300013306 Bacteria 1292
147 Ga0157375_10031011 3300013308 Bacteria 5047
148 Ga0163163_10081296 3300014325 Bacteria 3242
149 Ga0157379_10017743 3300014968 Bacteria 6271
150 Ga0157376_10030222 3300014969 Bacteria 4324
151 Ga0157376_10191967 3300014969 Bacteria 1873
152 Ga0207697_10079938 3300025315 Bacteria 1377
153 Ga0207692_10009799 3300025898 Bacteria 4015
154 Ga0207685_10021824 3300025905 Bacteria 2153
155 Ga0207699_10005190 3300025906 Bacteria 6230
156 Ga0207699_10009964 3300025906 Bacteria 4752
157 Ga0207699_10078236 3300025906 Unclassified 2042
158 Ga0207684_10007635 3300025910 Bacteria 9703
159 Ga0207684_10021069 3300025910 Bacteria 5566
160 Ga0207684_10031303 3300025910 Bacteria 4526
161 Ga0207684_10091392 3300025910 Bacteria 2594
162 Ga0207684_10094420 3300025910 Bacteria 2551
163 Ga0207684_10192788 3300025910 Bacteria 1758
164 Ga0207684_10295323 3300025910 Bacteria 1397
165 Ga0207707_10224530 3300025912 Bacteria 1635
166 Ga0207693_10139490 3300025915 Bacteria 1906
167 Ga0207693_10224429 3300025915 Bacteria 1476
168 Ga0207693_10315177 3300025915 Bacteria 1224
169 Ga0207663_10003298 3300025916 Bacteria 7868
170 Ga0207663_10159596 3300025916 Bacteria 1590
171 Ga0207646_10012313 3300025922 Bacteria 8225
172 Ga0207646_10029912 3300025922 Bacteria 4944
173 Ga0207646_10288212 3300025922 Unclassified 1484
174 Ga0207646_10328740 3300025922 Bacteria 1381
175 Ga0207646_10430622 3300025922 Bacteria 1190
176 Ga0207659_10056103 3300025926 Unclassified 2820
177 Ga0207687_10163374 3300025927 Bacteria 1711
178 Ga0207700_10010272 3300025928 Bacteria 5895
179 Ga0207700_10073278 3300025928 Bacteria 2644
180 Ga0207700_10167870 3300025928 Bacteria 1828
181 Ga0207700_10359041 3300025928 Unclassified 1270
182 Ga0207664_10050615 3300025929 Bacteria 3276
183 Ga0207665_10075989 3300025939 Bacteria 2302
184 Ga0207665_10095982 3300025939 Bacteria 2061
185 Ga0207665_10128216 3300025939 Bacteria 1798
186 Ga0207665_10189270 3300025939 Bacteria 1494
187 Ga0207665_10205213 3300025939 Bacteria 1437
188 Ga0207665_10297309 3300025939 Bacteria 1206
189 Ga0207691_10016342 3300025940 Bacteria 7045
190 Ga0207712_10060872 3300025961 Bacteria 2678
191 Ga0207712_10149492 3300025961 Unclassified 1803
192 Ga0207668_10006904 3300025972 Bacteria 6735
193 Ga0207668_10014446 3300025972 Bacteria 4887
194 Ga0207678_10060868 3300026067 Unclassified 3247
195 Ga0207678_10063508 3300026067 Bacteria 3173
196 Ga0207641_10178327 3300026088 Bacteria 1944
197 Ga0207675_100137870 3300026118 Bacteria 2316
198 Ga0207683_10005315 3300026121 Bacteria 11043
199 Ga0207683_10283236 3300026121 Bacteria 1515
200 Ga0209966_1005812 3300027695 Bacteria 2125
201 Ga0207428_10031227 3300027907 Bacteria 4399
202 Ga0268264_10042366 3300028381 Bacteria 3769
203 Ga0268264_10366522 3300028381 Bacteria 1376
204 Ga0307416_100306862 3300032002 Bacteria 1581
205 Ga0373947_0025347 3300035725 Bacteria 3458
206 Ga0373947_0071922 3300035725 Bacteria 2122
207 Ga0373937_0039196 3300036401 Bacteria 4318
208 Ga0395901_0615378 3300038443 Bacteria 1094
209 Ga0451577_0325601 3300042876 Bacteria 1394
210 Ga0453683_0111587 3300044673 Bacteria 1719
211 Ga0451576_0412309 3300045051 Bacteria 1417
212 Ga0466967_0053972 3300045976 Bacteria 3535
213 Ga0495592_0335737 3300046454 Unclassified 973
214 Ga0495603_0163648 3300046455 Bacteria 1290
215 Ga0495629_0243244 3300046459 Bacteria 1239
216 Ga0495641_0073948 3300046461 Unclassified 1529
217 Ga0495664_0006651 3300046477 Bacteria 6392
218 Ga0495645_0249625 3300046543 Bacteria 1180
219 Ga0495656_0017874 3300046615 Bacteria 2713
220 Ga0495674_0012690 3300047319 Bacteria 7940
221 Ga0495602_0296241 3300048088 Bacteria 1186
222 Ga0496100_0014513 3300048903 Bacteria 4575
223 Ga0496100_0131057 3300048903 Bacteria 1766
224 Ga0496101_0029918 3300048904 Bacteria 3812
225 Ga0496102_0057027 3300048905 Bacteria 3564
226 Ga0496102_0113827 3300048905 Unclassified 2524
227 Ga0496103_0009761 3300048906 Bacteria 5683
228 Ga0496104_0002469 3300048907 Bacteria 15932
229 Ga0496104_0163289 3300048907 Bacteria 2136
230 Ga0496105_0158601 3300048908 Bacteria 1858
231 Ga0496106_0007285 3300048909 Bacteria 8174
232 Ga0496106_0076929 3300048909 Unclassified 2558
233 Ga0496107_0012117 3300048910 Bacteria 6014
234 Ga0496108_0198328 3300048911 Bacteria 1741
235 Ga0496109_0169245 3300048912 Bacteria 2049
236 Ga0496110_0025889 3300048913 Bacteria 5016
237 Ga0496110_0134144 3300048913 Bacteria 2237
238 Ga0496110_0523362 3300048913 Bacteria 1079
239 Ga0496111_0154858 3300048914 Unclassified 1701
240 Ga0496112_0006670 3300048915 Bacteria 10161
241 Ga0496112_0080947 3300048915 Bacteria 3211
242 Ga0496112_0199411 3300048915 Bacteria 1961
243 Ga0496113_0007721 3300048916 Bacteria 6942
244 Ga0496113_0102615 3300048916 Bacteria 2218
245 Ga0496114_0058829 3300048917 Bacteria 3209
246 Ga0496115_0000970 3300048918 Bacteria 20835
247 Ga0496115_0008825 3300048918 Bacteria 7469
248 Ga0501036_0173891 3300049572 Bacteria 1814
249 Ga0501046_0240882 3300049580 Bacteria 1334
250 Ga0501075_0229574 3300049591 Bacteria 1415
251 Ga0501076_0007669 3300049592 Bacteria 7858
252 Ga0501079_0384932 3300049741 Unclassified 1100
253 Ga0501081_0005253 3300049743 Bacteria 8346
254 nmdc:mga05p37_192361_c1 3300050507 Bacteria 2476
255 nmdc:mga05p37_280095_c1 3300050507 Bacteria 1989
256 nmdc:mga05p37_578644_c1 3300050507 Bacteria 1272
257 nmdc:mga05p37_7419_c1 3300050507 Bacteria 12936
258 nmdc:mga05p37_74598_c1 3300050507 Bacteria 4175
259 nmdc:mga09592_214125_c1 3300050508 Bacteria 1669
260 nmdc:mga09592_233840_c1 3300050508 Bacteria 1592
261 nmdc:mga0qj67_198346_c1 3300050509 Bacteria 1631
262 nmdc:mga06r32_18962_c1 3300050510 Bacteria 6307
263 nmdc:mga06r32_20908_c1 3300050510 Bacteria 6033
264 nmdc:mga06r32_275829_c1 3300050510 Bacteria 1669
265 nmdc:mga06r32_384428_c1 3300050510 Bacteria 1386
266 nmdc:mga08y16_117028_c1 3300050511 Plasmid 2775
267 nmdc:mga0n895_11796_c1 3300050512 Bacteria 7815
268 nmdc:mga0n895_246875_c1 3300050512 Bacteria 1812
269 nmdc:mga0n895_3849_c1 3300050512 Bacteria 12183
270 nmdc:mga0n895_469963_c1 3300050512 Bacteria 1269
271 nmdc:mga0n895_50094_c1 3300050512 Bacteria 4094
272 nmdc:mga0rr50_13033_c1 3300050513 Bacteria 5396
273 nmdc:mga0rr50_14560_c1 3300050513 Bacteria 5165
274 nmdc:mga0rr50_178696_c1 3300050513 Bacteria 1238
275 nmdc:mga0rr50_221052_c1 3300050513 Bacteria 1564
276 nmdc:mga0rr50_2769_c1 3300050513 Bacteria 9970
277 nmdc:mga08x19_6551_c1 3300050514 Bacteria 6898
278 nmdc:mga08x19_7685_c1 3300050514 Bacteria 6402
279 nmdc:mga0a205_9545_c1 3300050515 Bacteria 8878
280 nmdc:mga0a205_9997_c1 3300050515 Bacteria 8705
281 Ga0495601_0003614 3300053077 Bacteria 8889
282 Ga0495612_0002066 3300053078 Bacteria 8267
283 Ga0495612_0063834 3300053078 Bacteria 1528
284 Ga0495595_0106271 3300053084 Bacteria 1358
285 Ga0530510_0014583 3300061734 Bacteria 5544
286 2847939007 2847930680 Bacteria 9342022
287 Ga0070675_100110809
288 MBSR1b_contig_13237396
289 MBSR1b_contig_5921557
290 Ga0065712_10078287
291 Ga0065715_10091165
292 Ga0065715_10140391
293 Ga0070690_100166751
294 Ga0070670_100023854
295 Ga0070670_100331260
296 Ga0070677_10027394
297 Ga0068869_100152792
298 Ga0070689_100332610
299 Ga0070668_100003536
300 Ga0070668_100160794
301 Ga0070675_100010329
302 Ga0070709_10017494
303 Ga0070709_10073039
304 Ga0070709_10200715
305 Ga0070714_100064753
306 Ga0070714_100178329
307 Ga0070714_100280051
308 Ga0070714_100284057
309 Ga0070714_100318658
310 Ga0070713_100059423
311 Ga0070713_100066604
312 Ga0070713_100197200
313 Ga0070713_100310319
314 Ga0070710_10025170
315 Ga0070710_10062770
316 Ga0070710_10118292
317 Ga0070701_10096311
318 Ga0070711_100034582
319 Ga0070711_100042625
320 Ga0070711_100129538
321 Ga0070711_100280852
322 Ga0070694_100117324
323 Ga0070708_100006592
324 Ga0070708_100011102
325 Ga0070708_100017106
326 Ga0070708_100047109
327 Ga0070708_100049040
328 Ga0070708_100071766
329 Ga0070708_100089514
330 Ga0070708_100127170
331 Ga0070708_100175553
332 Ga0070708_100334347
333 Ga0070708_100419937
334 Ga0070663_100063544
335 Ga0070678_100015752
336 Ga0070678_100153076
337 Ga0070681_10326680
338 Ga0070706_100019303
339 Ga0070706_100038195
340 Ga0070706_100085236
341 Ga0070706_100163428
342 Ga0070706_100185591
343 Ga0070706_100188691
344 Ga0070706_100192934
345 Ga0070706_100478462
346 Ga0070707_100006939
347 Ga0070707_100051593
348 Ga0070707_100058211
349 Ga0070707_100076649
350 Ga0070707_100148711
351 Ga0070707_100301683
352 Ga0070707_100368556
353 Ga0070698_100023540
354 Ga0070698_100083855
355 Ga0070698_100090783
356 Ga0070698_100168243
357 Ga0070698_100265892
358 Ga0070699_100029075
359 Ga0070699_100034252
360 Ga0070699_100069801
361 Ga0070699_100154217
362 Ga0070697_100024642
363 Ga0070697_100070078
364 Ga0068853_100440705
365 Ga0070672_100195890
366 Ga0070686_100310659
367 Ga0070695_100002763
368 Ga0070696_100057853
369 Ga0070696_100289428
370 Ga0068856_100554533
371 Ga0068859_100141383
372 Ga0068861_100065552
373 Ga0068863_100205350
374 Ga0068860_100074338
375 Ga0068860_100102245
376 Ga0068860_100592606
377 Ga0068862_100060182
378 Ga0081455_10031477
379 Ga0081455_10078558
380 Ga0070717_10024818
381 Ga0070717_10156065
382 Ga0070717_10260768
383 Ga0070717_10274647
384 Ga0070717_10348363
385 Ga0070715_10004823
386 Ga0070715_10040985
387 Ga0070716_100135354
388 Ga0070712_100160739
389 Ga0070712_100304279
390 Ga0068871_100096550
391 Ga0075428_100037628
392 Ga0075428_100053314
393 Ga0075430_100220984
394 Ga0075431_100024955
395 Ga0075431_100049139
396 Ga0075433_10001447
397 Ga0075433_10016552
398 Ga0075434_100043025
399 Ga0075434_100049797
400 Ga0075434_100083172
401 Ga0075434_100099417
402 Ga0075434_100449647
403 Ga0075436_100032361
404 Ga0075436_100262501
405 Ga0097620_100141384
406 Ga0075435_100018614
407 Ga0075435_100021088
408 Ga0075435_100030530
409 Ga0075435_100081250
410 Ga0075435_100364754
411 Ga0099794_10131772
412 Ga0111539_10171358
413 Ga0105245_10139359
414 Ga0105247_10147924
415 Ga0114129_10034471
416 Ga0114129_10061659
417 Ga0114129_10221011
418 Ga0114129_10607872
419 Ga0105242_10157094
420 Ga0105248_10030996
421 Ga0105248_10080761
422 Ga0105249_10050440
423 Ga0105239_10089780
424 Ga0105239_10318412
425 Ga0105246_10077908
426 Ga0157378_10047921
427 Ga0157378_10093401
428 Ga0163162_10014972
429 Ga0163162_10408409
430 Ga0163162_10519901
431 Ga0163162_10536711
432 Ga0163162_10542374
433 Ga0157375_10031011
434 Ga0163163_10081296
435 Ga0157379_10017743
436 Ga0157376_10030222
437 Ga0157376_10191967
438 Ga0207697_10079938
439 Ga0207692_10009799
440 Ga0207685_10021824
441 Ga0207699_10005190
442 Ga0207699_10009964
443 Ga0207699_10078236
444 Ga0207684_10007635
445 Ga0207684_10021069
446 Ga0207684_10031303
447 Ga0207684_10091392
448 Ga0207684_10094420
449 Ga0207684_10192788
450 Ga0207684_10295323
451 Ga0207707_10224530
452 Ga0207693_10139490
453 Ga0207693_10224429
454 Ga0207693_10315177
455 Ga0207663_10003298
456 Ga0207663_10159596
457 Ga0207646_10012313
458 Ga0207646_10029912
459 Ga0207646_10288212
460 Ga0207646_10328740
461 Ga0207646_10430622
462 Ga0207659_10056103
463 Ga0207687_10163374
464 Ga0207700_10010272
465 Ga0207700_10073278
466 Ga0207700_10167870
467 Ga0207700_10359041
468 Ga0207664_10050615
469 Ga0207665_10075989
470 Ga0207665_10095982
471 Ga0207665_10128216
472 Ga0207665_10189270
473 Ga0207665_10205213
474 Ga0207665_10297309
475 Ga0207691_10016342
476 Ga0207712_10060872
477 Ga0207712_10149492
478 Ga0207668_10006904
479 Ga0207668_10014446
480 Ga0207678_10060868
481 Ga0207678_10063508
482 Ga0207641_10178327
483 Ga0207675_100137870
484 Ga0207683_10005315
485 Ga0207683_10283236
486 Ga0209966_1005812
487 Ga0207428_10031227
488 Ga0268264_10042366
489 Ga0268264_10366522
490 Ga0307416_100306862
491 Ga0373947_0025347
492 Ga0373947_0071922
493 Ga0373937_0039196
494 Ga0395901_0615378
495 Ga0451577_0325601
496 Ga0453683_0111587
497 Ga0451576_0412309
498 Ga0466967_0053972
499 Ga0495592_0335737
500 Ga0495603_0163648
501 Ga0495629_0243244
502 Ga0495641_0073948
503 Ga0495664_0006651
504 Ga0495645_0249625
505 Ga0495656_0017874
506 Ga0495674_0012690
507 Ga0495602_0296241
508 Ga0496100_0014513
509 Ga0496100_0131057
510 Ga0496101_0029918
511 Ga0496102_0057027
512 Ga0496102_0113827
513 Ga0496103_0009761
514 Ga0496104_0002469
515 Ga0496104_0163289
516 Ga0496105_0158601
517 Ga0496106_0007285
518 Ga0496106_0076929
519 Ga0496107_0012117
520 Ga0496108_0198328
521 Ga0496109_0169245
522 Ga0496110_0025889
523 Ga0496110_0134144
524 Ga0496110_0523362
525 Ga0496111_0154858
526 Ga0496112_0006670
527 Ga0496112_0080947
528 Ga0496112_0199411
529 Ga0496113_0007721
530 Ga0496113_0102615
531 Ga0496114_0058829
532 Ga0496115_0000970
533 Ga0496115_0008825
534 Ga0501036_0173891
535 Ga0501046_0240882
536 Ga0501075_0229574
537 Ga0501076_0007669
538 Ga0501079_0384932
539 Ga0501081_0005253
540 nmdc:mga05p37_192361_c1
541 nmdc:mga05p37_280095_c1
542 nmdc:mga05p37_578644_c1
543 nmdc:mga05p37_7419_c1
544 nmdc:mga05p37_74598_c1
545 nmdc:mga09592_214125_c1
546 nmdc:mga09592_233840_c1
547 nmdc:mga0qj67_198346_c1
548 nmdc:mga06r32_18962_c1
549 nmdc:mga06r32_20908_c1
550 nmdc:mga06r32_275829_c1
551 nmdc:mga06r32_384428_c1
552 nmdc:mga08y16_117028_c1
553 nmdc:mga0n895_11796_c1
554 nmdc:mga0n895_246875_c1
555 nmdc:mga0n895_3849_c1
556 nmdc:mga0n895_469963_c1
557 nmdc:mga0n895_50094_c1
558 nmdc:mga0rr50_13033_c1
559 nmdc:mga0rr50_14560_c1
560 nmdc:mga0rr50_178696_c1
561 nmdc:mga0rr50_221052_c1
562 nmdc:mga0rr50_2769_c1
563 nmdc:mga08x19_6551_c1
564 nmdc:mga08x19_7685_c1
565 nmdc:mga0a205_9545_c1
566 nmdc:mga0a205_9997_c1
567 Ga0495601_0003614
568 Ga0495612_0002066
569 Ga0495612_0063834
570 Ga0495595_0106271
571 Ga0530510_0014583
572 2847939007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

84

371

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8649 27 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8622 27 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8616 31 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8562 31 325
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8544 28 325
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8738 148 325 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8692 148 325 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.857 148 325 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8526 148 325 3.40.50.2300
af_P02924_26_131_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8008 164 248 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537NRR0-F1-model_v4 ABC transporter substrate-binding protein 0.9553 153 326
AF-A0A536V9W1-F1-model_v4 ABC transporter substrate-binding protein 0.9545 93 326
AF-A0A537THP2-F1-model_v4 ABC transporter substrate-binding protein 0.954 156 326
AF-A0A2V6VYZ2-F1-model_v4 ABC transporter substrate-binding protein 0.9507 163 326
AF-A0A536XC92-F1-model_v4 ABC transporter substrate-binding protein 0.9503 124 326

Map