F387106

General Info

Members Datasets Scaffolds Average Seq Length
285 155 570 318

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_31472_c1|nmdc:mga05p37_31472_c1_4087_5148
Length 353
Sequence VETDAQGTKEKRSGQPAMNRSKQTGMAIKPVVFLLVGLALASVRLVEAQQPTGKVKRIGFMATGSVSSDRNRIDTFRRGLRDLGYVEGKNVVIEYRYAEGKPDRLPGLAVELVHLKADVIVVSGGTSAKAAKNATQMVPIVMTNVSDPIEIGVVDSLARPGGNITGLTTQAPELGGKRLELLKEIVPKLSRVAAIGNPDTLSYSKQMKEIEMAAQAISLQVQSVPVKAPSDFENAFTAIKKERARALITLAAPTIIFLRDRIIELAVKTGLPAAYSDNEFVESGGLMSYAPNYNDLLRRAAVFVDKILKGAKPADLPVEQPTKFELVINLKAAKQIGLTIPQSVLYRADRVIK

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 25.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_31472_c1 3300050507 Bacteria 6480
2 Ga0065712_10000663 3300005290 Bacteria 9864
3 Ga0065712_10000831 3300005290 Bacteria 7837
4 Ga0065712_10149617 3300005290 Bacteria 1380
5 Ga0065715_10009328 3300005293 Unclassified 3280
6 Ga0070676_10110789 3300005328 Unclassified 1709
7 Ga0070676_10127286 3300005328 Unclassified 1606
8 Ga0070670_100005875 3300005331 Bacteria 10372
9 Ga0070670_100030071 3300005331 Unclassified 4678
10 Ga0070670_100228663 3300005331 Bacteria 1618
11 Ga0068869_100007272 3300005334 Bacteria 7055
12 Ga0070666_10024680 3300005335 Unclassified 3919
13 Ga0070666_10144677 3300005335 Bacteria 1657
14 Ga0070680_100229721 3300005336 Bacteria 1567
15 Ga0068868_100056268 3300005338 Bacteria 3106
16 Ga0068868_100097828 3300005338 Unclassified 2372
17 Ga0070660_100102608 3300005339 Unclassified 2267
18 Ga0070687_100092246 3300005343 Unclassified 1678
19 Ga0070669_100075940 3300005353 Unclassified 2493
20 Ga0070675_100190321 3300005354 Unclassified 1777
21 Ga0070671_100010683 3300005355 Bacteria 7371
22 Ga0070673_100097110 3300005364 Unclassified 2419
23 Ga0070673_100145408 3300005364 Unclassified 2004
24 Ga0070688_100213014 3300005365 Unclassified 1357
25 Ga0070659_100181338 3300005366 Bacteria 1728
26 Ga0070667_100006667 3300005367 Bacteria 9599
27 Ga0070667_100007733 3300005367 Bacteria 8911
28 Ga0070667_100018838 3300005367 Bacteria 5724
29 Ga0070710_10244756 3300005437 Unclassified 1150
30 Ga0070708_100003097 3300005445 Bacteria 12939
31 Ga0070708_100124495 3300005445 Bacteria 2381
32 Ga0070708_100162474 3300005445 Bacteria 2082
33 Ga0070708_100486056 3300005445 Bacteria 1165
34 Ga0070662_100037309 3300005457 Bacteria 3446
35 Ga0070662_100178376 3300005457 Unclassified 1673
36 Ga0070681_10021359 3300005458 Bacteria 6491
37 Ga0068867_100008024 3300005459 Bacteria 7461
38 Ga0068867_100147851 3300005459 Bacteria 1843
39 Ga0070706_100081959 3300005467 Bacteria 2988
40 Ga0070706_100135535 3300005467 Bacteria 2298
41 Ga0070706_100277097 3300005467 Unclassified 1565
42 Ga0070706_100356785 3300005467 Bacteria 1363
43 Ga0070707_100016975 3300005468 Bacteria 6839
44 Ga0070707_100051341 3300005468 Bacteria 3954
45 Ga0070707_100054657 3300005468 Bacteria 3828
46 Ga0070707_100059794 3300005468 Bacteria 3654
47 Ga0070698_100074365 3300005471 Bacteria 3403
48 Ga0070698_100084997 3300005471 Bacteria 3152
49 Ga0070698_100150330 3300005471 Bacteria 2276
50 Ga0070698_100492940 3300005471 Bacteria 1163
51 Ga0070699_100086597 3300005518 Bacteria 2734
52 Ga0070699_100144243 3300005518 Bacteria 2104
53 Ga0070697_100074485 3300005536 Bacteria 2789
54 Ga0070697_100121205 3300005536 Bacteria 2187
55 Ga0070686_100012258 3300005544 Bacteria 4876
56 Ga0070665_100493128 3300005548 Bacteria 1236
57 Ga0070704_100036330 3300005549 Bacteria 3357
58 Ga0068855_100128096 3300005563 Unclassified 2901
59 Ga0070664_100035711 3300005564 Bacteria 4173
60 Ga0068857_100077571 3300005577 Unclassified 2965
61 Ga0068854_100023898 3300005578 Bacteria 4178
62 Ga0068856_100249286 3300005614 Bacteria 1791
63 Ga0068852_100219956 3300005616 Bacteria 1806
64 Ga0068859_100021052 3300005617 Bacteria 6545
65 Ga0068859_100065820 3300005617 Bacteria 3658
66 Ga0068864_100030915 3300005618 Bacteria 4540
67 Ga0068861_100018621 3300005719 Bacteria 4948
68 Ga0068870_10079231 3300005840 Unclassified 1811
69 Ga0068863_100015267 3300005841 Bacteria 7380
70 Ga0068863_100021980 3300005841 Bacteria 6088
71 Ga0068858_100008866 3300005842 Bacteria 9644
72 Ga0068858_100077036 3300005842 Bacteria 3097
73 Ga0068858_100149612 3300005842 Bacteria 2194
74 Ga0068860_100005716 3300005843 Bacteria 12554
75 Ga0068860_100029795 3300005843 Bacteria 5250
76 Ga0068860_100362468 3300005843 Bacteria 1428
77 Ga0068862_100042017 3300005844 Bacteria 3892
78 Ga0068862_100307292 3300005844 Unclassified 1461
79 Ga0081455_10000512 3300005937 Bacteria 50237
80 Ga0081538_10027843 3300005981 Bacteria 3905
81 Ga0070717_10039434 3300006028 Bacteria 3843
82 Ga0097621_100030688 3300006237 Bacteria 4258
83 Ga0097621_100203249 3300006237 Unclassified 1721
84 Ga0075428_100002860 3300006844 Bacteria 18834
85 Ga0075428_100282578 3300006844 Bacteria 1786
86 Ga0075430_100088593 3300006846 Bacteria 2590
87 Ga0075430_100228137 3300006846 Bacteria 1544
88 Ga0075431_100001943 3300006847 Bacteria 19709
89 Ga0075431_100102651 3300006847 Bacteria 2951
90 Ga0075431_100201446 3300006847 Bacteria 2036
91 Ga0075433_10028408 3300006852 Unclassified 4754
92 Ga0075433_10059862 3300006852 Bacteria 3333
93 Ga0075433_10065711 3300006852 Bacteria 3182
94 Ga0075433_10154601 3300006852 Bacteria 2041
95 Ga0075433_10178848 3300006852 Bacteria 1887
96 Ga0075434_100003914 3300006871 Bacteria 13336
97 Ga0075434_100020106 3300006871 Bacteria 6470
98 Ga0075434_100048248 3300006871 Bacteria 4225
99 Ga0075434_100083958 3300006871 Unclassified 3183
100 Ga0075434_100503915 3300006871 Bacteria 1231
101 Ga0075429_100001896 3300006880 Bacteria 17332
102 Ga0068865_100010045 3300006881 Bacteria 5888
103 Ga0097620_100021051 3300006931 Bacteria 6545
104 Ga0097620_100065820 3300006931 Bacteria 3658
105 Ga0075435_100023996 3300007076 Bacteria 4726
106 Ga0075435_100132525 3300007076 Bacteria 2086
107 Ga0075435_100204770 3300007076 Bacteria 1672
108 Ga0099794_10137576 3300007265 Bacteria 1236
109 Ga0105251_10054665 3300009011 Unclassified 1895
110 Ga0111539_10000838 3300009094 Bacteria 40003
111 Ga0111539_10031185 3300009094 Bacteria 6479
112 Ga0105245_10091256 3300009098 Bacteria 2803
113 Ga0105245_10627059 3300009098 Bacteria 1104
114 Ga0114129_10118578 3300009147 Bacteria 3645
115 Ga0114129_10206824 3300009147 Bacteria 2655
116 Ga0114129_10244617 3300009147 Unclassified 2411
117 Ga0114129_10355945 3300009147 Unclassified 1938
118 Ga0114129_10492803 3300009147 Bacteria 1601
119 Ga0114129_10590491 3300009147 Bacteria 1440
120 Ga0114129_10593206 3300009147 Bacteria 1436
121 Ga0114129_10723653 3300009147 Unclassified 1277
122 Ga0114129_10727749 3300009147 Bacteria 1272
123 Ga0105248_10090623 3300009177 Bacteria 3443
124 Ga0105248_10097454 3300009177 Bacteria 3313
125 Ga0105249_10071739 3300009553 Bacteria 3201
126 Ga0105249_10101064 3300009553 Unclassified 2712
127 Ga0099796_10041992 3300010159 Bacteria 1551
128 Ga0105246_10047469 3300011119 Bacteria 2933
129 Ga0105246_10057319 3300011119 Unclassified 2695
130 Ga0157374_10107888 3300013296 Unclassified 2676
131 Ga0157378_10046214 3300013297 Bacteria 3871
132 Ga0157378_10386266 3300013297 Bacteria 1376
133 Ga0157378_10487754 3300013297 Bacteria 1229
134 Ga0157378_10630738 3300013297 Bacteria 1086
135 Ga0163162_10118366 3300013306 Bacteria 2751
136 Ga0163162_10199292 3300013306 Bacteria 2130
137 Ga0163162_10510397 3300013306 Bacteria 1332
138 Ga0163162_10566023 3300013306 Unclassified 1264
139 Ga0157375_10147893 3300013308 Unclassified 2482
140 Ga0157375_10404251 3300013308 Bacteria 1532
141 Ga0163163_10082912 3300014325 Bacteria 3211
142 Ga0157380_10044076 3300014326 Bacteria 3494
143 Ga0157377_10065243 3300014745 Unclassified 2091
144 Ga0157379_10032321 3300014968 Bacteria 4666
145 Ga0157379_10181510 3300014968 Unclassified 1901
146 Ga0157376_10034546 3300014969 Bacteria 4083
147 Ga0163161_10129667 3300017792 Unclassified 1901
148 Ga0207692_10197453 3300025898 Unclassified 1181
149 Ga0207680_10068935 3300025903 Unclassified 2184
150 Ga0207645_10114949 3300025907 Unclassified 1744
151 Ga0207645_10177819 3300025907 Unclassified 1396
152 Ga0207643_10049743 3300025908 Unclassified 2376
153 Ga0207684_10091394 3300025910 Bacteria 2594
154 Ga0207684_10261070 3300025910 Bacteria 1495
155 Ga0207652_10144927 3300025921 Bacteria 2125
156 Ga0207646_10011199 3300025922 Bacteria 8709
157 Ga0207646_10203078 3300025922 Bacteria 1790
158 Ga0207646_10204999 3300025922 Bacteria 1781
159 Ga0207650_10000929 3300025925 Bacteria 22065
160 Ga0207650_10036098 3300025925 Bacteria 3594
161 Ga0207650_10118735 3300025925 Unclassified 2056
162 Ga0207644_10022771 3300025931 Bacteria 4283
163 Ga0207706_10008228 3300025933 Bacteria 9623
164 Ga0207706_10078439 3300025933 Bacteria 2905
165 Ga0207706_10108079 3300025933 Bacteria 2448
166 Ga0207670_10023685 3300025936 Bacteria 3825
167 Ga0207670_10042828 3300025936 Bacteria 2986
168 Ga0207691_10020590 3300025940 Bacteria 6237
169 Ga0207691_10028882 3300025940 Bacteria 5190
170 Ga0207711_10292949 3300025941 Bacteria 1500
171 Ga0207689_10017352 3300025942 Bacteria 6092
172 Ga0207679_10196420 3300025945 Bacteria 1682
173 Ga0207679_10378473 3300025945 Unclassified 1240
174 Ga0207651_10019613 3300025960 Unclassified 4058
175 Ga0207651_10109060 3300025960 Bacteria 2073
176 Ga0207712_10123004 3300025961 Unclassified 1966
177 Ga0207658_10007212 3300025986 Bacteria 7579
178 Ga0207677_10055675 3300026023 Bacteria 2706
179 Ga0207677_10539070 3300026023 Unclassified 1015
180 Ga0207703_10001471 3300026035 Bacteria 21487
181 Ga0207639_10054759 3300026041 Bacteria 3050
182 Ga0207708_10153132 3300026075 Unclassified 1817
183 Ga0207641_10034696 3300026088 Bacteria 4198
184 Ga0207641_10044431 3300026088 Bacteria 3736
185 Ga0207641_10265608 3300026088 Unclassified 1608
186 Ga0207648_10012730 3300026089 Bacteria 7861
187 Ga0207648_10051716 3300026089 Bacteria 3591
188 Ga0207648_10197976 3300026089 Bacteria 1782
189 Ga0207676_10004294 3300026095 Bacteria 10076
190 Ga0207676_10031221 3300026095 Bacteria 4005
191 Ga0207674_10091833 3300026116 Unclassified 3026
192 Ga0207674_10249059 3300026116 Unclassified 1723
193 Ga0207675_100032275 3300026118 Bacteria 4878
194 Ga0207698_10206239 3300026142 Bacteria 1765
195 Ga0209971_1013034 3300027682 Bacteria 1970
196 Ga0209974_10011655 3300027876 Unclassified 2949
197 Ga0207428_10000670 3300027907 Bacteria 40011
198 Ga0207428_10236358 3300027907 Bacteria 1366
199 Ga0268265_10161359 3300028380 Unclassified 1904
200 Ga0268264_10008056 3300028381 Bacteria 8763
201 Ga0268264_10035931 3300028381 Unclassified 4079
202 Ga0307408_100088876 3300031548 Unclassified 2328
203 Ga0307408_100323337 3300031548 Bacteria 1300
204 Ga0307406_10201835 3300031901 Unclassified 1464
205 Ga0373946_0020674 3300035171 Bacteria 2546
206 Ga0373935_0101759 3300035692 Bacteria 1895
207 Ga0373935_0225000 3300035692 Unclassified 1305
208 Ga0373947_0045021 3300035725 Bacteria 2640
209 Ga0373947_0155611 3300035725 Bacteria 1475
210 Ga0373937_0143617 3300036401 Bacteria 2233
211 Ga0373925_0180745 3300037068 Bacteria 1669
212 Ga0373925_0305551 3300037068 Bacteria 1285
213 Ga0439435_0027429 3300042436 Unclassified 1524
214 Ga0451576_0368676 3300045051 Unclassified 1504
215 Ga0495580_0022073 3300046472 Bacteria 4690
216 Ga0495580_0023729 3300046472 Bacteria 4498
217 Ga0495580_0067866 3300046472 Bacteria 2495
218 Ga0495580_0276138 3300046472 Bacteria 1147
219 Ga0495582_0101264 3300046473 Bacteria 1613
220 Ga0495582_0223764 3300046473 Unclassified 1077
221 Ga0495639_0111705 3300046475 Unclassified 1297
222 Ga0495662_0130905 3300046476 Bacteria 1233
223 Ga0495664_0017394 3300046477 Bacteria 4109
224 Ga0495618_0069949 3300046514 Bacteria 2232
225 Ga0495618_0120120 3300046514 Bacteria 1683
226 Ga0495630_0023757 3300046517 Bacteria 4531
227 Ga0495663_0085505 3300046525 Bacteria 1022
228 Ga0495642_0093784 3300046528 Unclassified 1273
229 Ga0495654_0113353 3300046530 Unclassified 1235
230 Ga0495665_0007527 3300046531 Bacteria 5895
231 Ga0495640_0067905 3300046533 Bacteria 2401
232 Ga0495640_0083601 3300046533 Bacteria 2118
233 Ga0495621_0092521 3300046539 Bacteria 1141
234 Ga0495656_0137003 3300046615 Bacteria 1170
235 Ga0495634_0018013 3300046642 Bacteria 5033
236 Ga0495634_0043128 3300046642 Bacteria 3058
237 Ga0495635_0116558 3300046663 Bacteria 1823
238 Ga0495635_0119286 3300046663 Unclassified 1800
239 Ga0495647_0018659 3300046681 Bacteria 2473
240 Ga0495658_0025030 3300046683 Bacteria 3187
241 Ga0495658_0029980 3300046683 Bacteria 2950
242 Ga0495581_0045882 3300047315 Bacteria 2525
243 Ga0495581_0075699 3300047315 Bacteria 1947
244 Ga0495674_0086863 3300047319 Bacteria 2677
245 Ga0496102_0087766 3300048905 Bacteria 2874
246 Ga0496102_0569643 3300048905 Unclassified 1055
247 Ga0496103_0056732 3300048906 Unclassified 2432
248 Ga0496107_0233038 3300048910 Unclassified 1370
249 Ga0496109_0118062 3300048912 Unclassified 2469
250 Ga0496112_0718662 3300048915 Bacteria 926
251 nmdc:mga05p37_203483_c1 3300050507 Unclassified 2396
252 nmdc:mga05p37_419223_c1 3300050507 Bacteria 1558
253 nmdc:mga05p37_69436_c1 3300050507 Unclassified 4334
254 nmdc:mga05p37_87818_c1 3300050507 Bacteria 3833
255 nmdc:mga09592_4894_c1 3300050508 Bacteria 10851
256 nmdc:mga0qj67_273887_c1 3300050509 Unclassified 1368
257 nmdc:mga0qj67_7301_c1 3300050509 Bacteria 8168
258 nmdc:mga0qj67_79328_c1 3300050509 Bacteria 2629
259 nmdc:mga06r32_140219_c1 3300050510 Bacteria 2393
260 nmdc:mga06r32_162563_c1 3300050510 Unclassified 2215
261 nmdc:mga06r32_249259_c1 3300050510 Bacteria 1763
262 nmdc:mga06r32_357927_c1 3300050510 Bacteria 1444
263 nmdc:mga06r32_707_c1 3300050510 Bacteria 29165
264 nmdc:mga08y16_220138_c1 3300050511 Bacteria 1965
265 nmdc:mga08y16_237535_c1 3300050511 Bacteria 1884
266 nmdc:mga08y16_481607_c1 3300050511 Bacteria 1263
267 nmdc:mga0n895_17696_c1 3300050512 Bacteria 6576
268 nmdc:mga0n895_34906_c1 3300050512 Bacteria 4844
269 nmdc:mga0n895_47572_c2 3300050512 Unclassified 3083
270 nmdc:mga0n895_595185_c1 3300050512 Bacteria 1109
271 nmdc:mga0n895_608_c1 3300050512 Bacteria 24820
272 nmdc:mga0rr50_334429_c1 3300050513 Bacteria 1272
273 nmdc:mga0rr50_564322_c1 3300050513 Bacteria 969
274 nmdc:mga0rr50_71893_c1 3300050513 Unclassified 2641
275 nmdc:mga0a205_123678_c1 3300050515 Bacteria 2487
276 nmdc:mga0a205_140654_c1 3300050515 Bacteria 2314
277 nmdc:mga0a205_15478_c1 3300050515 Bacteria 7130
278 nmdc:mga0a205_183087_c1 3300050515 Bacteria 1988
279 nmdc:mga0a205_30106_c1 3300050515 Bacteria 5196
280 nmdc:mga0a205_5018_c1 3300050515 Bacteria 11920
281 nmdc:mga0a205_63475_c1 3300050515 Bacteria 3568
282 Ga0495601_0022262 3300053077 Bacteria 3889
283 Ga0495619_0062309 3300053085 Bacteria 2482
284 Ga0590071_025571 3300059421 Unclassified 1400
285 Ga0590075_017823 3300059424 Unclassified 1753
286 nmdc:mga05p37_31472_c1
287 Ga0065712_10000663
288 Ga0065712_10000831
289 Ga0065712_10149617
290 Ga0065715_10009328
291 Ga0070676_10110789
292 Ga0070676_10127286
293 Ga0070670_100005875
294 Ga0070670_100030071
295 Ga0070670_100228663
296 Ga0068869_100007272
297 Ga0070666_10024680
298 Ga0070666_10144677
299 Ga0070680_100229721
300 Ga0068868_100056268
301 Ga0068868_100097828
302 Ga0070660_100102608
303 Ga0070687_100092246
304 Ga0070669_100075940
305 Ga0070675_100190321
306 Ga0070671_100010683
307 Ga0070673_100097110
308 Ga0070673_100145408
309 Ga0070688_100213014
310 Ga0070659_100181338
311 Ga0070667_100006667
312 Ga0070667_100007733
313 Ga0070667_100018838
314 Ga0070710_10244756
315 Ga0070708_100003097
316 Ga0070708_100124495
317 Ga0070708_100162474
318 Ga0070708_100486056
319 Ga0070662_100037309
320 Ga0070662_100178376
321 Ga0070681_10021359
322 Ga0068867_100008024
323 Ga0068867_100147851
324 Ga0070706_100081959
325 Ga0070706_100135535
326 Ga0070706_100277097
327 Ga0070706_100356785
328 Ga0070707_100016975
329 Ga0070707_100051341
330 Ga0070707_100054657
331 Ga0070707_100059794
332 Ga0070698_100074365
333 Ga0070698_100084997
334 Ga0070698_100150330
335 Ga0070698_100492940
336 Ga0070699_100086597
337 Ga0070699_100144243
338 Ga0070697_100074485
339 Ga0070697_100121205
340 Ga0070686_100012258
341 Ga0070665_100493128
342 Ga0070704_100036330
343 Ga0068855_100128096
344 Ga0070664_100035711
345 Ga0068857_100077571
346 Ga0068854_100023898
347 Ga0068856_100249286
348 Ga0068852_100219956
349 Ga0068859_100021052
350 Ga0068859_100065820
351 Ga0068864_100030915
352 Ga0068861_100018621
353 Ga0068870_10079231
354 Ga0068863_100015267
355 Ga0068863_100021980
356 Ga0068858_100008866
357 Ga0068858_100077036
358 Ga0068858_100149612
359 Ga0068860_100005716
360 Ga0068860_100029795
361 Ga0068860_100362468
362 Ga0068862_100042017
363 Ga0068862_100307292
364 Ga0081455_10000512
365 Ga0081538_10027843
366 Ga0070717_10039434
367 Ga0097621_100030688
368 Ga0097621_100203249
369 Ga0075428_100002860
370 Ga0075428_100282578
371 Ga0075430_100088593
372 Ga0075430_100228137
373 Ga0075431_100001943
374 Ga0075431_100102651
375 Ga0075431_100201446
376 Ga0075433_10028408
377 Ga0075433_10059862
378 Ga0075433_10065711
379 Ga0075433_10154601
380 Ga0075433_10178848
381 Ga0075434_100003914
382 Ga0075434_100020106
383 Ga0075434_100048248
384 Ga0075434_100083958
385 Ga0075434_100503915
386 Ga0075429_100001896
387 Ga0068865_100010045
388 Ga0097620_100021051
389 Ga0097620_100065820
390 Ga0075435_100023996
391 Ga0075435_100132525
392 Ga0075435_100204770
393 Ga0099794_10137576
394 Ga0105251_10054665
395 Ga0111539_10000838
396 Ga0111539_10031185
397 Ga0105245_10091256
398 Ga0105245_10627059
399 Ga0114129_10118578
400 Ga0114129_10206824
401 Ga0114129_10244617
402 Ga0114129_10355945
403 Ga0114129_10492803
404 Ga0114129_10590491
405 Ga0114129_10593206
406 Ga0114129_10723653
407 Ga0114129_10727749
408 Ga0105248_10090623
409 Ga0105248_10097454
410 Ga0105249_10071739
411 Ga0105249_10101064
412 Ga0099796_10041992
413 Ga0105246_10047469
414 Ga0105246_10057319
415 Ga0157374_10107888
416 Ga0157378_10046214
417 Ga0157378_10386266
418 Ga0157378_10487754
419 Ga0157378_10630738
420 Ga0163162_10118366
421 Ga0163162_10199292
422 Ga0163162_10510397
423 Ga0163162_10566023
424 Ga0157375_10147893
425 Ga0157375_10404251
426 Ga0163163_10082912
427 Ga0157380_10044076
428 Ga0157377_10065243
429 Ga0157379_10032321
430 Ga0157379_10181510
431 Ga0157376_10034546
432 Ga0163161_10129667
433 Ga0207692_10197453
434 Ga0207680_10068935
435 Ga0207645_10114949
436 Ga0207645_10177819
437 Ga0207643_10049743
438 Ga0207684_10091394
439 Ga0207684_10261070
440 Ga0207652_10144927
441 Ga0207646_10011199
442 Ga0207646_10203078
443 Ga0207646_10204999
444 Ga0207650_10000929
445 Ga0207650_10036098
446 Ga0207650_10118735
447 Ga0207644_10022771
448 Ga0207706_10008228
449 Ga0207706_10078439
450 Ga0207706_10108079
451 Ga0207670_10023685
452 Ga0207670_10042828
453 Ga0207691_10020590
454 Ga0207691_10028882
455 Ga0207711_10292949
456 Ga0207689_10017352
457 Ga0207679_10196420
458 Ga0207679_10378473
459 Ga0207651_10019613
460 Ga0207651_10109060
461 Ga0207712_10123004
462 Ga0207658_10007212
463 Ga0207677_10055675
464 Ga0207677_10539070
465 Ga0207703_10001471
466 Ga0207639_10054759
467 Ga0207708_10153132
468 Ga0207641_10034696
469 Ga0207641_10044431
470 Ga0207641_10265608
471 Ga0207648_10012730
472 Ga0207648_10051716
473 Ga0207648_10197976
474 Ga0207676_10004294
475 Ga0207676_10031221
476 Ga0207674_10091833
477 Ga0207674_10249059
478 Ga0207675_100032275
479 Ga0207698_10206239
480 Ga0209971_1013034
481 Ga0209974_10011655
482 Ga0207428_10000670
483 Ga0207428_10236358
484 Ga0268265_10161359
485 Ga0268264_10008056
486 Ga0268264_10035931
487 Ga0307408_100088876
488 Ga0307408_100323337
489 Ga0307406_10201835
490 Ga0373946_0020674
491 Ga0373935_0101759
492 Ga0373935_0225000
493 Ga0373947_0045021
494 Ga0373947_0155611
495 Ga0373937_0143617
496 Ga0373925_0180745
497 Ga0373925_0305551
498 Ga0439435_0027429
499 Ga0451576_0368676
500 Ga0495580_0022073
501 Ga0495580_0023729
502 Ga0495580_0067866
503 Ga0495580_0276138
504 Ga0495582_0101264
505 Ga0495582_0223764
506 Ga0495639_0111705
507 Ga0495662_0130905
508 Ga0495664_0017394
509 Ga0495618_0069949
510 Ga0495618_0120120
511 Ga0495630_0023757
512 Ga0495663_0085505
513 Ga0495642_0093784
514 Ga0495654_0113353
515 Ga0495665_0007527
516 Ga0495640_0067905
517 Ga0495640_0083601
518 Ga0495621_0092521
519 Ga0495656_0137003
520 Ga0495634_0018013
521 Ga0495634_0043128
522 Ga0495635_0116558
523 Ga0495635_0119286
524 Ga0495647_0018659
525 Ga0495658_0025030
526 Ga0495658_0029980
527 Ga0495581_0045882
528 Ga0495581_0075699
529 Ga0495674_0086863
530 Ga0496102_0087766
531 Ga0496102_0569643
532 Ga0496103_0056732
533 Ga0496107_0233038
534 Ga0496109_0118062
535 Ga0496112_0718662
536 nmdc:mga05p37_203483_c1
537 nmdc:mga05p37_419223_c1
538 nmdc:mga05p37_69436_c1
539 nmdc:mga05p37_87818_c1
540 nmdc:mga09592_4894_c1
541 nmdc:mga0qj67_273887_c1
542 nmdc:mga0qj67_7301_c1
543 nmdc:mga0qj67_79328_c1
544 nmdc:mga06r32_140219_c1
545 nmdc:mga06r32_162563_c1
546 nmdc:mga06r32_249259_c1
547 nmdc:mga06r32_357927_c1
548 nmdc:mga06r32_707_c1
549 nmdc:mga08y16_220138_c1
550 nmdc:mga08y16_237535_c1
551 nmdc:mga08y16_481607_c1
552 nmdc:mga0n895_17696_c1
553 nmdc:mga0n895_34906_c1
554 nmdc:mga0n895_47572_c2
555 nmdc:mga0n895_595185_c1
556 nmdc:mga0n895_608_c1
557 nmdc:mga0rr50_334429_c1
558 nmdc:mga0rr50_564322_c1
559 nmdc:mga0rr50_71893_c1
560 nmdc:mga0a205_123678_c1
561 nmdc:mga0a205_140654_c1
562 nmdc:mga0a205_15478_c1
563 nmdc:mga0a205_183087_c1
564 nmdc:mga0a205_30106_c1
565 nmdc:mga0a205_5018_c1
566 nmdc:mga0a205_63475_c1
567 Ga0495601_0022262
568 Ga0495619_0062309
569 Ga0590071_025571
570 Ga0590075_017823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

60

352

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9019 32 329
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8961 32 329
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.887 34 330
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8785 34 330
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8713 36 330
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8884 153 329 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8652 153 329 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.842 153 330 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.826 153 330 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8188 36 301 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A536Z3T8-F1-model_v4 ABC transporter substrate-binding protein 0.9752 235 331
AF-A0A1G0K1G6-F1-model_v4 ABC transporter substrate-binding protein 0.9748 209 331
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9745 222 331
AF-A0A2V6ZIS3-F1-model_v4 ABC transporter substrate-binding protein 0.9685 229 331
AF-A0A7X6XTX3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9678 226 331

Map