F386819

General Info

Members Datasets Scaffolds Average Seq Length
285 164 570 416

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000052|Ga0213875_1000005224
Length 453
Sequence LPHTSSLPQEARGAQHETPLLHLPTSTSGPSATPKAEVSSMRRLKGLKCRVCSETYELCPKHVCEFCFGPLEVDYDYDVIASVISREKIQRGPNSIWRYQDLLPVEGTPRVNLEAGFTPLVRADRLAKRLGIKELYIKNDTANPTWSFKDRVVSVALSRAVEFGFDTAACASTGNLANSVAAHAAHAGLKCFVFIPADLEVGKVMNSLIYAPHVVAVRGNYDEVNRLCSEIADRTKWAFVNVNVRPYYSEGSKTLAYEVAEQLGWRAPDHVVVPIASGSLLTKVHKGFGELKKLKLIEDTHVRISGAQAEGCSPVVQAYDQGLDFVTPVKPSTIAKSLAIGNPADGPFVLDIIRETKGAAALVTDDEIVEGMKLLAETEGIFTETAGGVTIGVLKKLAEAGKIKPDETTVAYITGIGLKTQEALAGRVGEPYQIDPNLNSFESALKDVLAAAS

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000052 3300021388 Bacteria 142140
2 Ga0070658_10000622 3300005327 Bacteria 30594
3 Ga0070676_10000158 3300005328 Bacteria 27074
4 Ga0070690_100014779 3300005330 Bacteria 4639
5 Ga0068869_100000174 3300005334 Bacteria 32589
6 Ga0070680_100000909 3300005336 Bacteria 20956
7 Ga0070682_100000546 3300005337 Bacteria 23369
8 Ga0070660_100000124 3300005339 Bacteria 48699
9 Ga0070689_100028144 3300005340 Bacteria 4246
10 Ga0070691_10003599 3300005341 Bacteria 6996
11 Ga0070692_10056778 3300005345 Bacteria 2051
12 Ga0070673_100021086 3300005364 Bacteria 4714
13 Ga0070673_100172813 3300005364 Bacteria 1845
14 Ga0070659_100002262 3300005366 Bacteria 13713
15 Ga0070705_100000151 3300005440 Bacteria 40840
16 Ga0070694_100000953 3300005444 Bacteria 16377
17 Ga0070708_100017978 3300005445 Bacteria 5911
18 Ga0070708_100024129 3300005445 Bacteria 5180
19 Ga0070708_100044228 3300005445 Bacteria 3915
20 Ga0070708_100071421 3300005445 Bacteria 3125
21 Ga0070708_100212357 3300005445 Bacteria 1813
22 Ga0070663_100002137 3300005455 Bacteria 11065
23 Ga0070662_100008799 3300005457 Bacteria 6583
24 Ga0070681_10002099 3300005458 Bacteria 18092
25 Ga0068867_100002279 3300005459 Bacteria 13495
26 Ga0070706_100046640 3300005467 Bacteria 4000
27 Ga0070706_100052345 3300005467 Bacteria 3768
28 Ga0070706_100106952 3300005467 Bacteria 2602
29 Ga0070706_100151385 3300005467 Bacteria 2166
30 Ga0070707_100010129 3300005468 Bacteria 8776
31 Ga0070707_100010452 3300005468 Bacteria 8645
32 Ga0070707_100014843 3300005468 Bacteria 7304
33 Ga0070707_100054780 3300005468 Bacteria 3824
34 Ga0070707_100101953 3300005468 Bacteria 2781
35 Ga0070707_100125474 3300005468 Bacteria 2493
36 Ga0070707_100181074 3300005468 Bacteria 2054
37 Ga0070698_100000812 3300005471 Bacteria 34080
38 Ga0070698_100049230 3300005471 Bacteria 4302
39 Ga0070698_100061883 3300005471 Bacteria 3777
40 Ga0070698_100096194 3300005471 Bacteria 2938
41 Ga0070698_100104821 3300005471 Bacteria 2797
42 Ga0070698_100203036 3300005471 Bacteria 1917
43 Ga0070698_100224131 3300005471 Bacteria 1813
44 Ga0070698_100304067 3300005471 Bacteria 1526
45 Ga0070699_100011014 3300005518 Bacteria 7820
46 Ga0070699_100019168 3300005518 Bacteria 5886
47 Ga0070699_100198773 3300005518 Bacteria 1782
48 Ga0070697_100001700 3300005536 Bacteria 16807
49 Ga0070697_100003213 3300005536 Bacteria 12543
50 Ga0070697_100036568 3300005536 Bacteria 3966
51 Ga0070697_100060919 3300005536 Bacteria 3077
52 Ga0070697_100191586 3300005536 Bacteria 1736
53 Ga0068853_100000619 3300005539 Bacteria 24364
54 Ga0070695_100000443 3300005545 Bacteria 21592
55 Ga0070695_100120834 3300005545 Bacteria 1792
56 Ga0070696_100003330 3300005546 Bacteria 10733
57 Ga0070696_100062564 3300005546 Bacteria 2605
58 Ga0070693_100000212 3300005547 Bacteria 27059
59 Ga0070665_100018060 3300005548 Bacteria 7079
60 Ga0070704_100000703 3300005549 Bacteria 16296
61 Ga0070704_100111014 3300005549 Bacteria 2086
62 Ga0070704_100212721 3300005549 Bacteria 1567
63 Ga0068855_100007907 3300005563 Bacteria 12846
64 Ga0068855_100073241 3300005563 Unclassified 3980
65 Ga0068855_100181160 3300005563 Bacteria 2382
66 Ga0068857_100017733 3300005577 Bacteria 6241
67 Ga0068857_100127961 3300005577 Bacteria 2289
68 Ga0068854_100004159 3300005578 Bacteria 9098
69 Ga0068856_100009034 3300005614 Bacteria 9696
70 Ga0070702_100024754 3300005615 Bacteria 3206
71 Ga0068859_100002742 3300005617 Bacteria 17867
72 Ga0068864_100001670 3300005618 Bacteria 18268
73 Ga0068870_10011648 3300005840 Bacteria 4086
74 Ga0068858_100064285 3300005842 Bacteria 3396
75 Ga0068860_100003749 3300005843 Bacteria 15630
76 Ga0068860_100038438 3300005843 Bacteria 4578
77 Ga0068862_100002088 3300005844 Bacteria 18009
78 Ga0081455_10000250 3300005937 Bacteria 70308
79 Ga0081540_1024967 3300005983 Bacteria 3454
80 Ga0081539_10054056 3300005985 Bacteria 2244
81 Ga0070716_100008426 3300006173 Bacteria 5115
82 Ga0075428_100025663 3300006844 Bacteria 6525
83 Ga0075430_100009233 3300006846 Bacteria 8335
84 Ga0075431_100003152 3300006847 Bacteria 15941
85 Ga0075431_100073431 3300006847 Bacteria 3529
86 Ga0075431_100238961 3300006847 Bacteria 1848
87 Ga0075433_10009518 3300006852 Bacteria 7766
88 Ga0075433_10011117 3300006852 Bacteria 7239
89 Ga0075433_10082753 3300006852 Bacteria 2831
90 Ga0075434_100006167 3300006871 Bacteria 10978
91 Ga0075434_100035124 3300006871 Bacteria 4955
92 Ga0075434_100135260 3300006871 Bacteria 2484
93 Ga0075436_100095065 3300006914 Bacteria 2073
94 Ga0097620_100002742 3300006931 Bacteria 17867
95 Ga0075435_100001892 3300007076 Bacteria 13621
96 Ga0075435_100014077 3300007076 Bacteria 5966
97 Ga0099794_10025879 3300007265 Bacteria 2707
98 Ga0105240_10000154 3300009093 Bacteria 140842
99 Ga0105240_10005201 3300009093 Bacteria 19462
100 Ga0105240_10036148 3300009093 Bacteria 6356
101 Ga0111539_10002900 3300009094 Bacteria 22767
102 Ga0111539_10160567 3300009094 Bacteria 2629
103 Ga0105245_10101852 3300009098 Bacteria 2659
104 Ga0114129_10000676 3300009147 Bacteria 42918
105 Ga0114129_10038217 3300009147 Bacteria 6773
106 Ga0105241_10000349 3300009174 Bacteria 35085
107 Ga0105237_10266012 3300009545 Bacteria 1718
108 Ga0105238_10019165 3300009551 Bacteria 6971
109 Ga0105249_10130088 3300009553 Bacteria 2402
110 Ga0105239_10010586 3300010375 Bacteria 10311
111 Ga0105239_10075294 3300010375 Bacteria 3711
112 Ga0105239_10300191 3300010375 Bacteria 1809
113 Ga0157373_10000834 3300013100 Bacteria 23934
114 Ga0157371_10075207 3300013102 Bacteria 2392
115 Ga0157369_10052468 3300013105 Bacteria 4412
116 Ga0157378_10146189 3300013297 Bacteria 2199
117 Ga0157372_10001718 3300013307 Bacteria 23773
118 Ga0182008_10093085 3300014497 Bacteria 1487
119 Ga0207653_10001950 3300025885 Bacteria 6602
120 Ga0207682_10019498 3300025893 Bacteria 2655
121 Ga0207645_10000037 3300025907 Bacteria 88771
122 Ga0207645_10064949 3300025907 Bacteria 2332
123 Ga0207643_10001245 3300025908 Bacteria 14960
124 Ga0207705_10000857 3300025909 Bacteria 24931
125 Ga0207684_10001229 3300025910 Bacteria 28446
126 Ga0207684_10006382 3300025910 Bacteria 10749
127 Ga0207654_10001868 3300025911 Bacteria 10905
128 Ga0207707_10000566 3300025912 Bacteria 37480
129 Ga0207695_10000093 3300025913 Bacteria 270427
130 Ga0207695_10013628 3300025913 Bacteria 9681
131 Ga0207695_10196188 3300025913 Bacteria 1935
132 Ga0207695_10288100 3300025913 Bacteria 1535
133 Ga0207671_10000062 3300025914 Bacteria 172081
134 Ga0207693_10030763 3300025915 Bacteria 4240
135 Ga0207662_10055550 3300025918 Bacteria 2363
136 Ga0207657_10008539 3300025919 Bacteria 10388
137 Ga0207652_10000957 3300025921 Bacteria 26960
138 Ga0207646_10001139 3300025922 Bacteria 33890
139 Ga0207646_10010469 3300025922 Bacteria 9058
140 Ga0207646_10049162 3300025922 Bacteria 3778
141 Ga0207646_10111715 3300025922 Bacteria 2453
142 Ga0207694_10015388 3300025924 Bacteria 5768
143 Ga0207650_10042510 3300025925 Bacteria 3334
144 Ga0207690_10002201 3300025932 Bacteria 11890
145 Ga0207706_10004145 3300025933 Bacteria 13666
146 Ga0207706_10058196 3300025933 Bacteria 3404
147 Ga0207665_10004215 3300025939 Bacteria 9571
148 Ga0207711_10271935 3300025941 Bacteria 1559
149 Ga0207689_10000056 3300025942 Bacteria 86419
150 Ga0207689_10063405 3300025942 Bacteria 3040
151 Ga0207679_10000923 3300025945 Bacteria 18749
152 Ga0207667_10001705 3300025949 Bacteria 27638
153 Ga0207667_10017731 3300025949 Bacteria 8007
154 Ga0207667_10051337 3300025949 Bacteria 4348
155 Ga0207667_10155704 3300025949 Bacteria 2351
156 Ga0207712_10142947 3300025961 Bacteria 1839
157 Ga0207712_10245192 3300025961 Bacteria 1445
158 Ga0207678_10034698 3300026067 Bacteria 4393
159 Ga0207708_10045818 3300026075 Bacteria 3333
160 Ga0207702_10003646 3300026078 Bacteria 13955
161 Ga0207648_10000678 3300026089 Bacteria 38201
162 Ga0207674_10000204 3300026116 Bacteria 73393
163 Ga0207674_10068699 3300026116 Bacteria 3565
164 Ga0209971_1000199 3300027682 Bacteria 17944
165 Ga0207428_10000132 3300027907 Bacteria 101581
166 Ga0268266_10161355 3300028379 Bacteria 2028
167 Ga0268265_10009522 3300028380 Bacteria 6561
168 Ga0268264_10001622 3300028381 Bacteria 20783
169 Ga0265337_1017986 3300028556 Bacteria 2254
170 Ga0265338_10003837 3300028800 Bacteria 20878
171 Ga0265329_10009488 3300031242 Bacteria 3631
172 Ga0373939_0028408 3300035114 Bacteria 1592
173 Ga0373941_0013091 3300035115 Bacteria 2186
174 Ga0373960_0004505 3300035121 Bacteria 3197
175 Ga0395900_0160386 3300037418 Bacteria 2294
176 Ga0395898_0210894 3300037466 Bacteria 1853
177 Ga0436364_0085187 3300037853 Bacteria 197036
178 Ga0395901_0393201 3300038443 Bacteria 1425
179 Ga0439448_0001776 3300042005 Bacteria 5698
180 Ga0439458_0003390 3300042157 Bacteria 3736
181 Ga0439459_0003129 3300042438 Bacteria 2602
182 Ga0451577_0000029 3300042876 Bacteria 395301
183 Ga0451577_0008360 3300042876 Bacteria 10073
184 Ga0451577_0012365 3300042876 Bacteria 8014
185 Ga0451577_0018679 3300042876 Bacteria 6380
186 Ga0451577_0139913 3300042876 Bacteria 2174
187 Ga0453683_0000565 3300044673 Bacteria 40909
188 Ga0453683_0000605 3300044673 Bacteria 39505
189 Ga0453683_0006605 3300044673 Bacteria 7944
190 Ga0453683_0017227 3300044673 Bacteria 4654
191 Ga0453683_0033898 3300044673 Bacteria 3220
192 Ga0453684_0000088 3300044712 Bacteria 395200
193 Ga0453684_0004155 3300044712 Bacteria 31335
194 Ga0453684_0033090 3300044712 Bacteria 7214
195 Ga0453684_0046655 3300044712 Bacteria 5759
196 Ga0453684_0237217 3300044712 Bacteria 2102
197 Ga0453684_0262850 3300044712 Bacteria 1976
198 Ga0453684_0344063 3300044712 Bacteria 1683
199 Ga0451576_0001707 3300045051 Bacteria 36278
200 Ga0451576_0004767 3300045051 Bacteria 17395
201 Ga0451576_0007142 3300045051 Bacteria 13476
202 Ga0451576_0029570 3300045051 Bacteria 5862
203 Ga0451576_0039634 3300045051 Bacteria 4986
204 Ga0451576_0055658 3300045051 Bacteria 4137
205 Ga0495584_0110474 3300046491 Bacteria 1391
206 Ga0496102_0060093 3300048905 Bacteria 3477
207 Ga0496106_0091084 3300048909 Bacteria 2354
208 Ga0496112_0053128 3300048915 Bacteria 3978
209 Ga0501032_0030462 3300049569 Bacteria 3703
210 Ga0501033_0010275 3300049570 Bacteria 7184
211 Ga0501033_0116455 3300049570 Bacteria 1942
212 Ga0501036_0001613 3300049572 Bacteria 17444
213 Ga0501036_0070853 3300049572 Bacteria 2948
214 Ga0501038_0000529 3300049574 Bacteria 33542
215 Ga0501039_0000975 3300049575 Bacteria 20797
216 Ga0501039_0112681 3300049575 Bacteria 2127
217 Ga0501040_0002129 3300049576 Bacteria 12766
218 Ga0501040_0033741 3300049576 Bacteria 3469
219 Ga0501040_0072587 3300049576 Bacteria 2377
220 Ga0501041_0000890 3300049577 Bacteria 16187
221 Ga0501042_0000170 3300049578 Bacteria 30045
222 Ga0501042_0131060 3300049578 Bacteria 1807
223 Ga0501043_0006046 3300049579 Bacteria 9727
224 Ga0501046_0007021 3300049580 Bacteria 9920
225 Ga0501047_0106693 3300049581 Bacteria 2682
226 Ga0501048_0000304 3300049582 Bacteria 33425
227 Ga0501048_0031034 3300049582 Bacteria 3867
228 Ga0501068_0087552 3300049584 Bacteria 1918
229 Ga0501068_0092031 3300049584 Bacteria 1872
230 Ga0501071_0001848 3300049587 Bacteria 12559
231 Ga0501071_0085910 3300049587 Bacteria 2307
232 Ga0501071_0152976 3300049587 Bacteria 1722
233 Ga0501072_0001525 3300049588 Bacteria 17333
234 Ga0501072_0072181 3300049588 Bacteria 2728
235 Ga0501072_0187836 3300049588 Bacteria 1648
236 Ga0501074_0008213 3300049590 Bacteria 7565
237 Ga0501075_0000023 3300049591 Bacteria 63418
238 Ga0501075_0019005 3300049591 Bacteria 4984
239 Ga0501075_0021963 3300049591 Bacteria 4658
240 Ga0501075_0075657 3300049591 Bacteria 2546
241 Ga0501076_0000079 3300049592 Bacteria 49962
242 Ga0501076_0050116 3300049592 Bacteria 3303
243 Ga0501076_0052659 3300049592 Bacteria 3225
244 Ga0501076_0078489 3300049592 Bacteria 2649
245 Ga0501077_0001924 3300049593 Bacteria 12578
246 Ga0501079_0001725 3300049741 Bacteria 15590
247 Ga0501079_0052071 3300049741 Bacteria 3161
248 Ga0501079_0184792 3300049741 Bacteria 1627
249 Ga0501080_0000399 3300049742 Bacteria 33503
250 Ga0501080_0225923 3300049742 Bacteria 1712
251 Ga0501081_0000549 3300049743 Bacteria 21301
252 Ga0501083_0025506 3300049744 Bacteria 4092
253 Ga0501035_0036110 3300049822 Bacteria 4481
254 Ga0501035_0147308 3300049822 Bacteria 2044
255 Ga0501045_0001597 3300049824 Bacteria 15137
256 Ga0501045_0063604 3300049824 Bacteria 2708
257 nmdc:mga05p37_200497_c1 3300050507 Bacteria 2417
258 nmdc:mga05p37_30686_c1 3300050507 Bacteria 6559
259 nmdc:mga05p37_4048_c1 3300050507 Bacteria 17133
260 nmdc:mga0qj67_6736_c1 3300050509 Bacteria 8441
261 nmdc:mga06r32_14448_c1 3300050510 Bacteria 7166
262 nmdc:mga06r32_3792_c1 3300050510 Bacteria 13527
263 nmdc:mga06r32_39136_c1 3300050510 Bacteria 4498
264 nmdc:mga08y16_140106_c1 3300050511 Bacteria 2514
265 nmdc:mga08y16_394032_c1 3300050511 Bacteria 1418
266 nmdc:mga0n895_77599_c1 3300050512 Bacteria 3305
267 nmdc:mga0rr50_11520_c1 3300050513 Bacteria 5667
268 nmdc:mga08x19_52965_c1 3300050514 Bacteria 2611
269 nmdc:mga08x19_52976_c1 3300050514 Bacteria 2610
270 nmdc:mga0a205_13962_c1 3300050515 Bacteria 7490
271 nmdc:mga0a205_52605_c1 3300050515 Bacteria 3930
272 nmdc:mga0a205_6169_c1 3300050515 Bacteria 10816
273 Ga0495601_0073219 3300053077 Bacteria 2190
274 Ga0495619_0005585 3300053085 Bacteria 7980
275 Ga0501084_0001272 3300054114 Bacteria 19874
276 Ga0501084_0024039 3300054114 Bacteria 5082
277 Ga0501082_0002913 3300060353 Bacteria 14926
278 Ga0530510_0004683 3300061734 Bacteria 9461
279 Ga0530510_0009307 3300061734 Bacteria 6892
280 Ga0530510_0015804 3300061734 Bacteria 5336
281 Ga0530510_0015876 3300061734 Bacteria 5324
282 Ga0530510_0047524 3300061734 Bacteria 3101
283 Ga0530510_0098656 3300061734 Bacteria 2136
284 Ga0530510_0113174 3300061734 Bacteria 1989
285 Ga0530510_0215122 3300061734 Bacteria 1428
286 Ga0213875_10000052
287 Ga0070658_10000622
288 Ga0070676_10000158
289 Ga0070690_100014779
290 Ga0068869_100000174
291 Ga0070680_100000909
292 Ga0070682_100000546
293 Ga0070660_100000124
294 Ga0070689_100028144
295 Ga0070691_10003599
296 Ga0070692_10056778
297 Ga0070673_100021086
298 Ga0070673_100172813
299 Ga0070659_100002262
300 Ga0070705_100000151
301 Ga0070694_100000953
302 Ga0070708_100017978
303 Ga0070708_100024129
304 Ga0070708_100044228
305 Ga0070708_100071421
306 Ga0070708_100212357
307 Ga0070663_100002137
308 Ga0070662_100008799
309 Ga0070681_10002099
310 Ga0068867_100002279
311 Ga0070706_100046640
312 Ga0070706_100052345
313 Ga0070706_100106952
314 Ga0070706_100151385
315 Ga0070707_100010129
316 Ga0070707_100010452
317 Ga0070707_100014843
318 Ga0070707_100054780
319 Ga0070707_100101953
320 Ga0070707_100125474
321 Ga0070707_100181074
322 Ga0070698_100000812
323 Ga0070698_100049230
324 Ga0070698_100061883
325 Ga0070698_100096194
326 Ga0070698_100104821
327 Ga0070698_100203036
328 Ga0070698_100224131
329 Ga0070698_100304067
330 Ga0070699_100011014
331 Ga0070699_100019168
332 Ga0070699_100198773
333 Ga0070697_100001700
334 Ga0070697_100003213
335 Ga0070697_100036568
336 Ga0070697_100060919
337 Ga0070697_100191586
338 Ga0068853_100000619
339 Ga0070695_100000443
340 Ga0070695_100120834
341 Ga0070696_100003330
342 Ga0070696_100062564
343 Ga0070693_100000212
344 Ga0070665_100018060
345 Ga0070704_100000703
346 Ga0070704_100111014
347 Ga0070704_100212721
348 Ga0068855_100007907
349 Ga0068855_100073241
350 Ga0068855_100181160
351 Ga0068857_100017733
352 Ga0068857_100127961
353 Ga0068854_100004159
354 Ga0068856_100009034
355 Ga0070702_100024754
356 Ga0068859_100002742
357 Ga0068864_100001670
358 Ga0068870_10011648
359 Ga0068858_100064285
360 Ga0068860_100003749
361 Ga0068860_100038438
362 Ga0068862_100002088
363 Ga0081455_10000250
364 Ga0081540_1024967
365 Ga0081539_10054056
366 Ga0070716_100008426
367 Ga0075428_100025663
368 Ga0075430_100009233
369 Ga0075431_100003152
370 Ga0075431_100073431
371 Ga0075431_100238961
372 Ga0075433_10009518
373 Ga0075433_10011117
374 Ga0075433_10082753
375 Ga0075434_100006167
376 Ga0075434_100035124
377 Ga0075434_100135260
378 Ga0075436_100095065
379 Ga0097620_100002742
380 Ga0075435_100001892
381 Ga0075435_100014077
382 Ga0099794_10025879
383 Ga0105240_10000154
384 Ga0105240_10005201
385 Ga0105240_10036148
386 Ga0111539_10002900
387 Ga0111539_10160567
388 Ga0105245_10101852
389 Ga0114129_10000676
390 Ga0114129_10038217
391 Ga0105241_10000349
392 Ga0105237_10266012
393 Ga0105238_10019165
394 Ga0105249_10130088
395 Ga0105239_10010586
396 Ga0105239_10075294
397 Ga0105239_10300191
398 Ga0157373_10000834
399 Ga0157371_10075207
400 Ga0157369_10052468
401 Ga0157378_10146189
402 Ga0157372_10001718
403 Ga0182008_10093085
404 Ga0207653_10001950
405 Ga0207682_10019498
406 Ga0207645_10000037
407 Ga0207645_10064949
408 Ga0207643_10001245
409 Ga0207705_10000857
410 Ga0207684_10001229
411 Ga0207684_10006382
412 Ga0207654_10001868
413 Ga0207707_10000566
414 Ga0207695_10000093
415 Ga0207695_10013628
416 Ga0207695_10196188
417 Ga0207695_10288100
418 Ga0207671_10000062
419 Ga0207693_10030763
420 Ga0207662_10055550
421 Ga0207657_10008539
422 Ga0207652_10000957
423 Ga0207646_10001139
424 Ga0207646_10010469
425 Ga0207646_10049162
426 Ga0207646_10111715
427 Ga0207694_10015388
428 Ga0207650_10042510
429 Ga0207690_10002201
430 Ga0207706_10004145
431 Ga0207706_10058196
432 Ga0207665_10004215
433 Ga0207711_10271935
434 Ga0207689_10000056
435 Ga0207689_10063405
436 Ga0207679_10000923
437 Ga0207667_10001705
438 Ga0207667_10017731
439 Ga0207667_10051337
440 Ga0207667_10155704
441 Ga0207712_10142947
442 Ga0207712_10245192
443 Ga0207678_10034698
444 Ga0207708_10045818
445 Ga0207702_10003646
446 Ga0207648_10000678
447 Ga0207674_10000204
448 Ga0207674_10068699
449 Ga0209971_1000199
450 Ga0207428_10000132
451 Ga0268266_10161355
452 Ga0268265_10009522
453 Ga0268264_10001622
454 Ga0265337_1017986
455 Ga0265338_10003837
456 Ga0265329_10009488
457 Ga0373939_0028408
458 Ga0373941_0013091
459 Ga0373960_0004505
460 Ga0395900_0160386
461 Ga0395898_0210894
462 Ga0436364_0085187
463 Ga0395901_0393201
464 Ga0439448_0001776
465 Ga0439458_0003390
466 Ga0439459_0003129
467 Ga0451577_0000029
468 Ga0451577_0008360
469 Ga0451577_0012365
470 Ga0451577_0018679
471 Ga0451577_0139913
472 Ga0453683_0000565
473 Ga0453683_0000605
474 Ga0453683_0006605
475 Ga0453683_0017227
476 Ga0453683_0033898
477 Ga0453684_0000088
478 Ga0453684_0004155
479 Ga0453684_0033090
480 Ga0453684_0046655
481 Ga0453684_0237217
482 Ga0453684_0262850
483 Ga0453684_0344063
484 Ga0451576_0001707
485 Ga0451576_0004767
486 Ga0451576_0007142
487 Ga0451576_0029570
488 Ga0451576_0039634
489 Ga0451576_0055658
490 Ga0495584_0110474
491 Ga0496102_0060093
492 Ga0496106_0091084
493 Ga0496112_0053128
494 Ga0501032_0030462
495 Ga0501033_0010275
496 Ga0501033_0116455
497 Ga0501036_0001613
498 Ga0501036_0070853
499 Ga0501038_0000529
500 Ga0501039_0000975
501 Ga0501039_0112681
502 Ga0501040_0002129
503 Ga0501040_0033741
504 Ga0501040_0072587
505 Ga0501041_0000890
506 Ga0501042_0000170
507 Ga0501042_0131060
508 Ga0501043_0006046
509 Ga0501046_0007021
510 Ga0501047_0106693
511 Ga0501048_0000304
512 Ga0501048_0031034
513 Ga0501068_0087552
514 Ga0501068_0092031
515 Ga0501071_0001848
516 Ga0501071_0085910
517 Ga0501071_0152976
518 Ga0501072_0001525
519 Ga0501072_0072181
520 Ga0501072_0187836
521 Ga0501074_0008213
522 Ga0501075_0000023
523 Ga0501075_0019005
524 Ga0501075_0021963
525 Ga0501075_0075657
526 Ga0501076_0000079
527 Ga0501076_0050116
528 Ga0501076_0052659
529 Ga0501076_0078489
530 Ga0501077_0001924
531 Ga0501079_0001725
532 Ga0501079_0052071
533 Ga0501079_0184792
534 Ga0501080_0000399
535 Ga0501080_0225923
536 Ga0501081_0000549
537 Ga0501083_0025506
538 Ga0501035_0036110
539 Ga0501035_0147308
540 Ga0501045_0001597
541 Ga0501045_0063604
542 nmdc:mga05p37_200497_c1
543 nmdc:mga05p37_30686_c1
544 nmdc:mga05p37_4048_c1
545 nmdc:mga0qj67_6736_c1
546 nmdc:mga06r32_14448_c1
547 nmdc:mga06r32_3792_c1
548 nmdc:mga06r32_39136_c1
549 nmdc:mga08y16_140106_c1
550 nmdc:mga08y16_394032_c1
551 nmdc:mga0n895_77599_c1
552 nmdc:mga0rr50_11520_c1
553 nmdc:mga08x19_52965_c1
554 nmdc:mga08x19_52976_c1
555 nmdc:mga0a205_13962_c1
556 nmdc:mga0a205_52605_c1
557 nmdc:mga0a205_6169_c1
558 Ga0495601_0073219
559 Ga0495619_0005585
560 Ga0501084_0001272
561 Ga0501084_0024039
562 Ga0501082_0002913
563 Ga0530510_0004683
564 Ga0530510_0009307
565 Ga0530510_0015804
566 Ga0530510_0015876
567 Ga0530510_0047524
568 Ga0530510_0098656
569 Ga0530510_0113174
570 Ga0530510_0215122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

111

415

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9196 55 408
2d1f-assembly1.cif.gz_B structure of mycobacterium tuberculosis threonine synthase 0.9145 52 407
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9144 55 408
2zsj-assembly2.cif.gz_C crystal structure of threonine synthase from aquifex aeolicus vf5 0.9134 55 408
2d1f-assembly1.cif.gz_B structure of mycobacterium tuberculosis threonine synthase 0.9095 52 407
ID Description Score Start End Superfamily
2jc3H02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9109 110 201 3.40.50.1100
2d1fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.899 52 407 3.40.50.1100
2d1fA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8989 110 201 3.40.50.1100
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8937 217 416 3.40.50.1100
2d1fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8922 52 407 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A2H6IDG8-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9897 1 407 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009088
GO:0009097
AF-A0A495YUA6-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9881 1 407 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009088
GO:0009097
AF-A0A3B1BZJ5-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9856 1 218 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
AF-A0A1G1IDX9-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9821 1 411 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009088
GO:0009097
AF-A0A2H6IDG8-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9801 1 407 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009088
GO:0009097

Map