F386708

General Info

Members Datasets Scaffolds Average Seq Length
285 171 570 258

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10002964|Ga0075364_100029645
Length 269
Sequence MTTEPMSFTYDVPDSIQVEVDGPIRIVRLNRPDDLNATNHELHKGIAGLFPQLSADPGARVAVITGNGRAFSAGGDFEYLDELTKDDALRQETIVDGRNIVTRMVACRIPVVAAVNGPAVGLGCSLVALSDIAYMAESAHLADPHVLIGLVAADGGPVSWPLMISLQLAKEYAFTGDRIPASRAAEIGLVNHVVPDDEVMDQALGCARRLAKLPQRALEDTKRILNMHLEKAVMTTLDFALGAEERSFTSPELRANLDRFLAPKQSREG

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
79 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
80 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
170 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
171 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.68
Nodule 0
Rhizoplane 4.91
Rhizosphere 79.65
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10002964 3300006051 Bacteria 9584
2 Ga0068869_100259833 3300005334 Bacteria 1390
3 Ga0070671_100019480 3300005355 Bacteria 5524
4 Ga0070674_100045915 3300005356 Bacteria 2986
5 Ga0070714_100042058 3300005435 Bacteria 3859
6 Ga0070700_100296781 3300005441 Bacteria 1178
7 Ga0070708_100053273 3300005445 Bacteria 3589
8 Ga0070663_100238937 3300005455 Bacteria 1433
9 Ga0070663_100466714 3300005455 Bacteria 1043
10 Ga0070681_10114013 3300005458 Bacteria 2642
11 Ga0070685_10237762 3300005466 Bacteria 1201
12 Ga0070706_100004945 3300005467 Bacteria 12758
13 Ga0070707_100079649 3300005468 Bacteria 3162
14 Ga0070698_100020155 3300005471 Bacteria 6991
15 Ga0070699_100017812 3300005518 Bacteria 6100
16 Ga0070697_100068149 3300005536 Bacteria 2912
17 Ga0070697_100090367 3300005536 Bacteria 2530
18 Ga0068853_100629475 3300005539 Bacteria 1020
19 Ga0068852_100184115 3300005616 Bacteria 1966
20 Ga0068861_100326930 3300005719 Bacteria 1337
21 Ga0068863_100218905 3300005841 Bacteria 1834
22 Ga0081455_10002429 3300005937 Bacteria 22223
23 Ga0081455_10019574 3300005937 Bacteria 6398
24 Ga0081455_10098512 3300005937 Bacteria 2353
25 Ga0081538_10000383 3300005981 Bacteria 50305
26 Ga0081538_10033195 3300005981 Bacteria 3441
27 Ga0081538_10041607 3300005981 Bacteria 2913
28 Ga0075365_10016520 3300006038 Bacteria 4492
29 Ga0075365_10017332 3300006038 Bacteria 4404
30 Ga0075365_10050002 3300006038 Bacteria 2756
31 Ga0075365_10271090 3300006038 Bacteria 1194
32 Ga0075365_10334506 3300006038 Bacteria 1067
33 Ga0075363_100000371 3300006048 Bacteria 13560
34 Ga0075363_100003374 3300006048 Bacteria 6783
35 Ga0075363_100017143 3300006048 Bacteria 3587
36 Ga0075363_100103863 3300006048 Bacteria 1574
37 Ga0075363_100135737 3300006048 Bacteria 1382
38 Ga0075364_10003076 3300006051 Bacteria 9425
39 Ga0075364_10017051 3300006051 Bacteria 4529
40 Ga0075364_10039489 3300006051 Bacteria 3060
41 Ga0075362_10115161 3300006177 Bacteria 1269
42 Ga0075367_10037318 3300006178 Bacteria 2823
43 Ga0075367_10074988 3300006178 Bacteria 2040
44 Ga0075369_10013506 3300006186 Bacteria 3243
45 Ga0075369_10091269 3300006186 Bacteria 1359
46 Ga0075370_10000639 3300006353 Bacteria 13581
47 Ga0068871_100541922 3300006358 Bacteria 1053
48 Ga0075428_100000955 3300006844 Bacteria 30623
49 Ga0075428_100007591 3300006844 Bacteria 12021
50 Ga0075428_100055237 3300006844 Bacteria 4351
51 Ga0075428_100269956 3300006844 Bacteria 1830
52 Ga0075428_100332625 3300006844 Bacteria 1632
53 Ga0075428_100452891 3300006844 Bacteria 1374
54 Ga0075430_100017176 3300006846 Bacteria 6161
55 Ga0075430_100020113 3300006846 Bacteria 5680
56 Ga0075430_100026233 3300006846 Bacteria 4958
57 Ga0075430_100125373 3300006846 Bacteria 2140
58 Ga0075430_100134322 3300006846 Bacteria 2062
59 Ga0075430_100397547 3300006846 Bacteria 1137
60 Ga0075431_100000463 3300006847 Bacteria 33500
61 Ga0075431_100017118 3300006847 Bacteria 7367
62 Ga0075431_100050871 3300006847 Bacteria 4272
63 Ga0075431_100289519 3300006847 Bacteria 1657
64 Ga0075429_100000747 3300006880 Bacteria 25547
65 Ga0075429_100008078 3300006880 Bacteria 9147
66 Ga0075429_100496310 3300006880 Bacteria 1070
67 Ga0111539_10026024 3300009094 Bacteria 7161
68 Ga0111539_10076993 3300009094 Bacteria 3927
69 Ga0105245_10506031 3300009098 Bacteria 1225
70 Ga0114129_10000160 3300009147 Bacteria 72462
71 Ga0114129_10578448 3300009147 Bacteria 1458
72 Ga0114129_10614806 3300009147 Bacteria 1406
73 Ga0105243_10489716 3300009148 Bacteria 1162
74 Ga0105242_10164340 3300009176 Bacteria 1946
75 Ga0105242_10669656 3300009176 Bacteria 1011
76 Ga0105248_10029520 3300009177 Bacteria 6117
77 Ga0105238_10105992 3300009551 Bacteria 2793
78 Ga0105249_10304352 3300009553 Bacteria 1600
79 Ga0105249_11008179 3300009553 Bacteria 901
80 Ga0105239_10068356 3300010375 Bacteria 3904
81 Ga0157372_10089549 3300013307 Bacteria 3497
82 Ga0157375_10533966 3300013308 Bacteria 1336
83 Ga0163163_10532136 3300014325 Bacteria 1238
84 Ga0157379_10248138 3300014968 Bacteria 1616
85 Ga0207684_10316525 3300025910 Bacteria 1345
86 Ga0207646_10090801 3300025922 Bacteria 2734
87 Ga0207694_10106019 3300025924 Bacteria 2232
88 Ga0207664_10038883 3300025929 Bacteria 3691
89 Ga0207669_10021827 3300025937 Bacteria 3388
90 Ga0207661_10262895 3300025944 Bacteria 1538
91 Ga0207678_10267192 3300026067 Bacteria 1466
92 Ga0207641_10086570 3300026088 Bacteria 2732
93 Ga0207675_100316049 3300026118 Bacteria 1524
94 Ga0207683_10228232 3300026121 Bacteria 1697
95 Ga0207698_10153801 3300026142 Bacteria 2001
96 Ga0209813_10036109 3300027866 Bacteria 1483
97 Ga0207428_10073478 3300027907 Bacteria 2683
98 Ga0207428_10195115 3300027907 Bacteria 1525
99 Ga0268264_10091716 3300028381 Bacteria 2621
100 Ga0316578_10273991 3300031728 Bacteria 1011
101 Ga0307413_10083490 3300031824 Bacteria 2056
102 Ga0307413_10127125 3300031824 Bacteria 1738
103 Ga0307410_10029985 3300031852 Bacteria 3471
104 Ga0307410_10043893 3300031852 Bacteria 2966
105 Ga0307407_10085940 3300031903 Bacteria 1915
106 Ga0307409_100026907 3300031995 Bacteria 4066
107 Ga0307416_100012456 3300032002 Bacteria 5731
108 Ga0307411_10669344 3300032005 Bacteria 901
109 Ga0307415_100077841 3300032126 Bacteria 2356
110 Ga0307415_100361923 3300032126 Bacteria 1225
111 Ga0373957_0022996 3300035120 Bacteria 2226
112 Ga0316574_0212530 3300035398 Bacteria 1241
113 Ga0373937_0031953 3300036401 Bacteria 4772
114 Ga0316584_0211320 3300036712 Bacteria 1428
115 Ga0436362_1207379 3300039453 Bacteria 1468
116 Ga0439447_054021 3300041407 Bacteria 954
117 Ga0439465_0059035 3300041413 Bacteria 1269
118 Ga0451837_0832413 3300041494 Bacteria 1724
119 Ga0451843_0129637 3300041509 Bacteria 1846
120 Ga0451853_1558488 3300041512 Bacteria 1188
121 Ga0439463_006038 3300042016 Bacteria 3008
122 Ga0439464_0033412 3300042439 Bacteria 1448
123 Ga0439440_0004112 3300042993 Bacteria 2845
124 Ga0466965_0086635 3300044683 Bacteria 1589
125 Ga0466966_0269610 3300044684 Bacteria 1024
126 Ga0466961_0032765 3300044693 Bacteria 3339
127 Ga0466961_0214288 3300044693 Bacteria 1188
128 Ga0466963_0203724 3300044694 Bacteria 1384
129 Ga0466963_0289340 3300044694 Bacteria 1152
130 Ga0466960_0004320 3300044901 Bacteria 5541
131 Ga0466959_0309992 3300045049 Bacteria 1080
132 Ga0466958_0012205 3300045836 Bacteria 4859
133 Ga0466967_0470877 3300045976 Bacteria 1230
134 Ga0466967_0591794 3300045976 Bacteria 1094
135 Ga0495629_0196830 3300046459 Bacteria 1394
136 Ga0495651_0076800 3300046462 Bacteria 2529
137 Ga0495653_0051077 3300046463 Bacteria 3176
138 Ga0495664_0112632 3300046477 Bacteria 1643
139 Ga0495618_0069201 3300046514 Bacteria 2244
140 Ga0495628_0008999 3300046516 Bacteria 8544
141 Ga0495630_0004571 3300046517 Bacteria 9696
142 Ga0495652_0097800 3300046529 Bacteria 2387
143 Ga0495640_0097061 3300046533 Bacteria 1938
144 Ga0495587_0014663 3300046536 Bacteria 4910
145 Ga0495667_0022533 3300046559 Bacteria 4243
146 Ga0495634_0003210 3300046642 Bacteria 13223
147 Ga0495657_0009212 3300046675 Bacteria 7492
148 Ga0495623_0029060 3300046679 Bacteria 3559
149 Ga0495613_0003004 3300046689 Bacteria 12632
150 Ga0495613_0117735 3300046689 Bacteria 1910
151 Ga0495600_0057481 3300046809 Bacteria 2541
152 Ga0495604_0080205 3300047317 Bacteria 2446
153 Ga0495672_0009878 3300047320 Bacteria 6861
154 Ga0495680_0005985 3300047322 Bacteria 11373
155 Ga0495680_0096865 3300047322 Unclassified 2203
156 Ga0496100_0000202 3300048903 Bacteria 32795
157 Ga0496101_0188375 3300048904 Bacteria 1591
158 Ga0496102_0575238 3300048905 Bacteria 1049
159 Ga0496104_0026373 3300048907 Bacteria 5365
160 Ga0496104_0062049 3300048907 Bacteria 3544
161 Ga0496106_0001563 3300048909 Bacteria 17234
162 Ga0496107_0013859 3300048910 Bacteria 5634
163 Ga0496109_0064454 3300048912 Bacteria 3353
164 Ga0496111_0014269 3300048914 Bacteria 5422
165 Ga0496112_0003775 3300048915 Bacteria 12645
166 Ga0496113_0029496 3300048916 Bacteria 3963
167 Ga0496114_0001795 3300048917 Bacteria 16292
168 Ga0496114_0258178 3300048917 Bacteria 1534
169 Ga0496115_0070145 3300048918 Bacteria 2840
170 Ga0501031_0022518 3300049568 Bacteria 4105
171 Ga0501031_0074730 3300049568 Bacteria 2207
172 Ga0501032_0023701 3300049569 Bacteria 4238
173 Ga0501032_0025560 3300049569 Bacteria 4070
174 Ga0501033_0000559 3300049570 Bacteria 34638
175 Ga0501034_0001109 3300049571 Bacteria 37776
176 Ga0501036_0011838 3300049572 Bacteria 7232
177 Ga0501036_0227349 3300049572 Bacteria 1566
178 Ga0501036_0294033 3300049572 Bacteria 1359
179 Ga0501037_0027908 3300049573 Bacteria 4171
180 Ga0501037_0155478 3300049573 Bacteria 1633
181 Ga0501037_0165243 3300049573 Bacteria 1576
182 Ga0501038_0060053 3300049574 Bacteria 3255
183 Ga0501039_0015125 3300049575 Bacteria 5903
184 Ga0501040_0019052 3300049576 Bacteria 4561
185 Ga0501040_0239582 3300049576 Bacteria 1293
186 Ga0501041_0023112 3300049577 Bacteria 3727
187 Ga0501042_0011109 3300049578 Bacteria 6066
188 Ga0501042_0071730 3300049578 Bacteria 2478
189 Ga0501046_0017750 3300049580 Bacteria 5936
190 Ga0501047_0103149 3300049581 Bacteria 2732
191 Ga0501048_0013864 3300049582 Bacteria 5978
192 Ga0501048_0108619 3300049582 Bacteria 1959
193 Ga0501048_0170618 3300049582 Bacteria 1541
194 Ga0501068_0005917 3300049584 Bacteria 6715
195 Ga0501068_0019485 3300049584 Bacteria 3942
196 Ga0501069_0153408 3300049585 Bacteria 1324
197 Ga0501070_0000298 3300049586 Bacteria 46144
198 Ga0501070_0002170 3300049586 Bacteria 17249
199 Ga0501070_0038346 3300049586 Bacteria 3997
200 Ga0501070_0060822 3300049586 Bacteria 3130
201 Ga0501070_0094105 3300049586 Bacteria 2479
202 Ga0501070_0317520 3300049586 Bacteria 1267
203 Ga0501071_0183688 3300049587 Bacteria 1567
204 Ga0501072_0004508 3300049588 Bacteria 10586
205 Ga0501072_0031327 3300049588 Bacteria 4162
206 Ga0501072_0035599 3300049588 Bacteria 3900
207 Ga0501073_0000574 3300049589 Bacteria 25952
208 Ga0501073_0023509 3300049589 Bacteria 4425
209 Ga0501074_0002539 3300049590 Bacteria 12725
210 Ga0501074_0005003 3300049590 Bacteria 9513
211 Ga0501074_0275492 3300049590 Bacteria 1196
212 Ga0501074_0411509 3300049590 Bacteria 959
213 Ga0501075_0006521 3300049591 Bacteria 8036
214 Ga0501075_0064556 3300049591 Bacteria 2762
215 Ga0501075_0119781 3300049591 Bacteria 2003
216 Ga0501076_0028998 3300049592 Bacteria 4301
217 Ga0501076_0066473 3300049592 Bacteria 2878
218 Ga0501076_0281876 3300049592 Bacteria 1361
219 Ga0501077_0012613 3300049593 Bacteria 5291
220 Ga0501077_0028922 3300049593 Bacteria 3523
221 Ga0501079_0000615 3300049741 Bacteria 23598
222 Ga0501079_0059992 3300049741 Bacteria 2934
223 Ga0501080_0000573 3300049742 Bacteria 29140
224 Ga0501080_0012199 3300049742 Bacteria 7874
225 Ga0501080_0018215 3300049742 Bacteria 6500
226 Ga0501080_0051957 3300049742 Bacteria 3814
227 Ga0501080_0065305 3300049742 Bacteria 3385
228 Ga0501080_0074184 3300049742 Bacteria 3165
229 Ga0501080_0331652 3300049742 Bacteria 1376
230 Ga0501081_0023390 3300049743 Bacteria 4141
231 Ga0501083_0021162 3300049744 Bacteria 4520
232 Ga0501083_0068647 3300049744 Bacteria 2359
233 Ga0501083_0299272 3300049744 Bacteria 1046
234 Ga0501044_0002308 3300049823 Bacteria 21735
235 Ga0501044_0019863 3300049823 Bacteria 7175
236 Ga0501044_0106559 3300049823 Bacteria 2815
237 Ga0501044_0596336 3300049823 Bacteria 998
238 Ga0501044_0677474 3300049823 Bacteria 918
239 Ga0501045_0014119 3300049824 Bacteria 5657
240 nmdc:mga03n38_105576_c1 3300050490 Bacteria 1365
241 nmdc:mga03n38_1468_c1 3300050490 Bacteria 6783
242 nmdc:mga03n38_28030_c1 3300050490 Bacteria 2343
243 nmdc:mga00v17_124366_c1 3300050491 Bacteria 1645
244 nmdc:mga00v17_3787_c1 3300050491 Bacteria 7807
245 nmdc:mga00v17_66006_c1 3300050491 Bacteria 2233
246 nmdc:mga00v17_7883_c1 3300050491 Bacteria 5713
247 nmdc:mga0yw44_16316_c1 3300050492 Bacteria 4008
248 nmdc:mga0yw44_194406_c1 3300050492 Bacteria 1339
249 nmdc:mga0yw44_21961_c1 3300050492 Bacteria 3570
250 nmdc:mga0yw44_299743_c1 3300050492 Bacteria 1077
251 nmdc:mga06z11_20260_c1 3300050494 Bacteria 3072
252 nmdc:mga06z11_53650_c1 3300050494 Bacteria 2074
253 nmdc:mga04h51_21838_c1 3300050495 Bacteria 1929
254 nmdc:mga05p37_3605_c1 3300050507 Bacteria 18090
255 nmdc:mga05p37_601065_c1 3300050507 Bacteria 1242
256 nmdc:mga05p37_763968_c1 3300050507 Bacteria 1063
257 nmdc:mga09592_1137_c1 3300050508 Bacteria 21197
258 nmdc:mga09592_144212_c1 3300050508 Bacteria 2053
259 nmdc:mga0qj67_373212_c1 3300050509 Bacteria 1152
260 nmdc:mga0qj67_41786_c1 3300050509 Bacteria 3608
261 nmdc:mga0qj67_54759_c1 3300050509 Bacteria 3159
262 nmdc:mga06r32_14801_c1 3300050510 Bacteria 7079
263 nmdc:mga06r32_350398_c1 3300050510 Bacteria 1461
264 nmdc:mga06r32_6827_c1 3300050510 Bacteria 10259
265 nmdc:mga06r32_69058_c1 3300050510 Bacteria 3415
266 nmdc:mga08y16_20852_c1 3300050511 Bacteria 6919
267 nmdc:mga0a205_478672_c1 3300050515 Bacteria 1103
268 Ga0495601_0056293 3300053077 Bacteria 2490
269 Ga0495601_0064635 3300053077 Bacteria 2327
270 Ga0495601_0131399 3300053077 Bacteria 1631
271 Ga0500635_0151828 3300053080 Bacteria 884
272 Ga0495619_0116513 3300053085 Bacteria 1829
273 Ga0500566_0000606 3300053094 Bacteria 20147
274 Ga0500566_0178516 3300053094 Bacteria 1091
275 Ga0500616_0001970 3300053153 Bacteria 18263
276 Ga0501084_0047030 3300054114 Bacteria 3613
277 Ga0501084_0124805 3300054114 Bacteria 2166
278 Ga0501084_0168259 3300054114 Bacteria 1850
279 Ga0501082_0011382 3300060353 Bacteria 7652
280 Ga0501082_0592152 3300060353 Bacteria 970
281 Ga0530510_0048985 3300061734 Bacteria 3053
282 Ga0530510_0132315 3300061734 Bacteria 1835
283 2809197529 2808606439 Bacteria 5952208
284 2929216843 2929212328 Bacteria 7708288
285 2939588874 2939582691 Bacteria 7088898
286 Ga0075364_10002964
287 Ga0068869_100259833
288 Ga0070671_100019480
289 Ga0070674_100045915
290 Ga0070714_100042058
291 Ga0070700_100296781
292 Ga0070708_100053273
293 Ga0070663_100238937
294 Ga0070663_100466714
295 Ga0070681_10114013
296 Ga0070685_10237762
297 Ga0070706_100004945
298 Ga0070707_100079649
299 Ga0070698_100020155
300 Ga0070699_100017812
301 Ga0070697_100068149
302 Ga0070697_100090367
303 Ga0068853_100629475
304 Ga0068852_100184115
305 Ga0068861_100326930
306 Ga0068863_100218905
307 Ga0081455_10002429
308 Ga0081455_10019574
309 Ga0081455_10098512
310 Ga0081538_10000383
311 Ga0081538_10033195
312 Ga0081538_10041607
313 Ga0075365_10016520
314 Ga0075365_10017332
315 Ga0075365_10050002
316 Ga0075365_10271090
317 Ga0075365_10334506
318 Ga0075363_100000371
319 Ga0075363_100003374
320 Ga0075363_100017143
321 Ga0075363_100103863
322 Ga0075363_100135737
323 Ga0075364_10003076
324 Ga0075364_10017051
325 Ga0075364_10039489
326 Ga0075362_10115161
327 Ga0075367_10037318
328 Ga0075367_10074988
329 Ga0075369_10013506
330 Ga0075369_10091269
331 Ga0075370_10000639
332 Ga0068871_100541922
333 Ga0075428_100000955
334 Ga0075428_100007591
335 Ga0075428_100055237
336 Ga0075428_100269956
337 Ga0075428_100332625
338 Ga0075428_100452891
339 Ga0075430_100017176
340 Ga0075430_100020113
341 Ga0075430_100026233
342 Ga0075430_100125373
343 Ga0075430_100134322
344 Ga0075430_100397547
345 Ga0075431_100000463
346 Ga0075431_100017118
347 Ga0075431_100050871
348 Ga0075431_100289519
349 Ga0075429_100000747
350 Ga0075429_100008078
351 Ga0075429_100496310
352 Ga0111539_10026024
353 Ga0111539_10076993
354 Ga0105245_10506031
355 Ga0114129_10000160
356 Ga0114129_10578448
357 Ga0114129_10614806
358 Ga0105243_10489716
359 Ga0105242_10164340
360 Ga0105242_10669656
361 Ga0105248_10029520
362 Ga0105238_10105992
363 Ga0105249_10304352
364 Ga0105249_11008179
365 Ga0105239_10068356
366 Ga0157372_10089549
367 Ga0157375_10533966
368 Ga0163163_10532136
369 Ga0157379_10248138
370 Ga0207684_10316525
371 Ga0207646_10090801
372 Ga0207694_10106019
373 Ga0207664_10038883
374 Ga0207669_10021827
375 Ga0207661_10262895
376 Ga0207678_10267192
377 Ga0207641_10086570
378 Ga0207675_100316049
379 Ga0207683_10228232
380 Ga0207698_10153801
381 Ga0209813_10036109
382 Ga0207428_10073478
383 Ga0207428_10195115
384 Ga0268264_10091716
385 Ga0316578_10273991
386 Ga0307413_10083490
387 Ga0307413_10127125
388 Ga0307410_10029985
389 Ga0307410_10043893
390 Ga0307407_10085940
391 Ga0307409_100026907
392 Ga0307416_100012456
393 Ga0307411_10669344
394 Ga0307415_100077841
395 Ga0307415_100361923
396 Ga0373957_0022996
397 Ga0316574_0212530
398 Ga0373937_0031953
399 Ga0316584_0211320
400 Ga0436362_1207379
401 Ga0439447_054021
402 Ga0439465_0059035
403 Ga0451837_0832413
404 Ga0451843_0129637
405 Ga0451853_1558488
406 Ga0439463_006038
407 Ga0439464_0033412
408 Ga0439440_0004112
409 Ga0466965_0086635
410 Ga0466966_0269610
411 Ga0466961_0032765
412 Ga0466961_0214288
413 Ga0466963_0203724
414 Ga0466963_0289340
415 Ga0466960_0004320
416 Ga0466959_0309992
417 Ga0466958_0012205
418 Ga0466967_0470877
419 Ga0466967_0591794
420 Ga0495629_0196830
421 Ga0495651_0076800
422 Ga0495653_0051077
423 Ga0495664_0112632
424 Ga0495618_0069201
425 Ga0495628_0008999
426 Ga0495630_0004571
427 Ga0495652_0097800
428 Ga0495640_0097061
429 Ga0495587_0014663
430 Ga0495667_0022533
431 Ga0495634_0003210
432 Ga0495657_0009212
433 Ga0495623_0029060
434 Ga0495613_0003004
435 Ga0495613_0117735
436 Ga0495600_0057481
437 Ga0495604_0080205
438 Ga0495672_0009878
439 Ga0495680_0005985
440 Ga0495680_0096865
441 Ga0496100_0000202
442 Ga0496101_0188375
443 Ga0496102_0575238
444 Ga0496104_0026373
445 Ga0496104_0062049
446 Ga0496106_0001563
447 Ga0496107_0013859
448 Ga0496109_0064454
449 Ga0496111_0014269
450 Ga0496112_0003775
451 Ga0496113_0029496
452 Ga0496114_0001795
453 Ga0496114_0258178
454 Ga0496115_0070145
455 Ga0501031_0022518
456 Ga0501031_0074730
457 Ga0501032_0023701
458 Ga0501032_0025560
459 Ga0501033_0000559
460 Ga0501034_0001109
461 Ga0501036_0011838
462 Ga0501036_0227349
463 Ga0501036_0294033
464 Ga0501037_0027908
465 Ga0501037_0155478
466 Ga0501037_0165243
467 Ga0501038_0060053
468 Ga0501039_0015125
469 Ga0501040_0019052
470 Ga0501040_0239582
471 Ga0501041_0023112
472 Ga0501042_0011109
473 Ga0501042_0071730
474 Ga0501046_0017750
475 Ga0501047_0103149
476 Ga0501048_0013864
477 Ga0501048_0108619
478 Ga0501048_0170618
479 Ga0501068_0005917
480 Ga0501068_0019485
481 Ga0501069_0153408
482 Ga0501070_0000298
483 Ga0501070_0002170
484 Ga0501070_0038346
485 Ga0501070_0060822
486 Ga0501070_0094105
487 Ga0501070_0317520
488 Ga0501071_0183688
489 Ga0501072_0004508
490 Ga0501072_0031327
491 Ga0501072_0035599
492 Ga0501073_0000574
493 Ga0501073_0023509
494 Ga0501074_0002539
495 Ga0501074_0005003
496 Ga0501074_0275492
497 Ga0501074_0411509
498 Ga0501075_0006521
499 Ga0501075_0064556
500 Ga0501075_0119781
501 Ga0501076_0028998
502 Ga0501076_0066473
503 Ga0501076_0281876
504 Ga0501077_0012613
505 Ga0501077_0028922
506 Ga0501079_0000615
507 Ga0501079_0059992
508 Ga0501080_0000573
509 Ga0501080_0012199
510 Ga0501080_0018215
511 Ga0501080_0051957
512 Ga0501080_0065305
513 Ga0501080_0074184
514 Ga0501080_0331652
515 Ga0501081_0023390
516 Ga0501083_0021162
517 Ga0501083_0068647
518 Ga0501083_0299272
519 Ga0501044_0002308
520 Ga0501044_0019863
521 Ga0501044_0106559
522 Ga0501044_0596336
523 Ga0501044_0677474
524 Ga0501045_0014119
525 nmdc:mga03n38_105576_c1
526 nmdc:mga03n38_1468_c1
527 nmdc:mga03n38_28030_c1
528 nmdc:mga00v17_124366_c1
529 nmdc:mga00v17_3787_c1
530 nmdc:mga00v17_66006_c1
531 nmdc:mga00v17_7883_c1
532 nmdc:mga0yw44_16316_c1
533 nmdc:mga0yw44_194406_c1
534 nmdc:mga0yw44_21961_c1
535 nmdc:mga0yw44_299743_c1
536 nmdc:mga06z11_20260_c1
537 nmdc:mga06z11_53650_c1
538 nmdc:mga04h51_21838_c1
539 nmdc:mga05p37_3605_c1
540 nmdc:mga05p37_601065_c1
541 nmdc:mga05p37_763968_c1
542 nmdc:mga09592_1137_c1
543 nmdc:mga09592_144212_c1
544 nmdc:mga0qj67_373212_c1
545 nmdc:mga0qj67_41786_c1
546 nmdc:mga0qj67_54759_c1
547 nmdc:mga06r32_14801_c1
548 nmdc:mga06r32_350398_c1
549 nmdc:mga06r32_6827_c1
550 nmdc:mga06r32_69058_c1
551 nmdc:mga08y16_20852_c1
552 nmdc:mga0a205_478672_c1
553 Ga0495601_0056293
554 Ga0495601_0064635
555 Ga0495601_0131399
556 Ga0500635_0151828
557 Ga0495619_0116513
558 Ga0500566_0000606
559 Ga0500566_0178516
560 Ga0500616_0001970
561 Ga0501084_0047030
562 Ga0501084_0124805
563 Ga0501084_0168259
564 Ga0501082_0011382
565 Ga0501082_0592152
566 Ga0530510_0048985
567 Ga0530510_0132315
568 2809197529
569 2929216843
570 2939588874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

19

267

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

24

264

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rrv-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis 0.9712 4 253
3rrv-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis 0.9636 4 253
3q1t-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium avium 0.9436 9 252
7m3w-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa15 protein from mycolicibacterium paratuberculosis 0.9389 9 257
3qk8-assembly1.cif.gz_D crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand 0.936 9 257
ID Description Score Start End Superfamily
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9712 4 253 3.90.226.10
3rrvD00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9636 4 253 3.90.226.10
4di1B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9304 6 207 3.90.226.10
4di1B01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.926 6 207 3.90.226.10
1wz8A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9259 8 204 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6I4MLI0-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9751 4 254 GO:0006631
GO:0016853
AF-A0A1S1NLN8-F1-model_v4 Enoyl-CoA hydratase 0.9714 4 256 GO:0004165
GO:0005777
AF-A0A1S1QQ65-F1-model_v4 Enoyl-CoA hydratase 0.9703 4 258
AF-J5ECG8-F1-model_v4 Enoyl-CoA hydratase 0.969 37 258
AF-A0A2A3LA98-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9679 4 256 GO:0006631
GO:0016853

Map