F386643

General Info

Members Datasets Scaffolds Average Seq Length
285 149 285 382

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100002309|Ga0070711_1000023094
Length 399
Sequence MLYYLSQKLLEWTNGTPWADHLSALRLFRYITVRSAGAAVTALLLSWWLGPKIIHWLKQLKFGQDYADKAEEAGGLAARVLSKKGTPTMGGVLIVMVLVFSTMLWTEWNAQVELTALAVLVLAGLGFYDDYAKIIQQSGGGTPPRLKLIVQIAAALFVGIYLWQLPATSELRLSENKNVITSYLVSDLMLPFYKYPIHMGAIAGIPVAGLVVVLLAIVGSSNAVNLTDGLDGLAIGCALITAFVFLVFTYVAGNVKAAAYLQIPYVSGAGELTVFCAALIGAGLGFLWFNCHPAQVFMGDTGSLALGGAFGIMAVLIHQPFVLVIAGGVFVLEAVSVMLQTGWFKFTRMRTGTGRRIFLMAPLHHHFEKKGWYESQVVMRFYILCVLFAVVALATLKLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
84 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.65
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10035288 3300003320 Bacteria 5501
2 Ga0070683_100283051 3300005329 Unclassified 1577
3 Ga0070690_100010019 3300005330 Bacteria 5502
4 Ga0070690_100013712 3300005330 Bacteria 4799
5 Ga0070690_100051168 3300005330 Bacteria 2636
6 Ga0068868_100062267 3300005338 Bacteria 2957
7 Ga0070689_100050058 3300005340 Bacteria 3227
8 Ga0070689_100114883 3300005340 Bacteria 2145
9 Ga0070689_100221501 3300005340 Bacteria 1552
10 Ga0070691_10013697 3300005341 Bacteria 3718
11 Ga0070687_100051876 3300005343 Bacteria 2126
12 Ga0070675_100000804 3300005354 Bacteria 22072
13 Ga0070675_100101707 3300005354 Bacteria 2421
14 Ga0070675_100191505 3300005354 Bacteria 1772
15 Ga0070673_100068122 3300005364 Bacteria 2849
16 Ga0070688_100042696 3300005365 Bacteria 2790
17 Ga0070667_100061131 3300005367 Bacteria 3189
18 Ga0070701_10006647 3300005438 Bacteria 4880
19 Ga0070711_100002309 3300005439 Bacteria 10823
20 Ga0070711_100184271 3300005439 Bacteria 1600
21 Ga0070705_100026546 3300005440 Bacteria 3153
22 Ga0070694_100017293 3300005444 Bacteria 4554
23 Ga0070685_10014966 3300005466 Bacteria 4117
24 Ga0070672_100103891 3300005543 Bacteria 2308
25 Ga0070686_100013974 3300005544 Bacteria 4613
26 Ga0070686_100024588 3300005544 Bacteria 3612
27 Ga0070686_100155058 3300005544 Unclassified 1607
28 Ga0070686_100163504 3300005544 Bacteria 1569
29 Ga0070695_100183540 3300005545 Bacteria 1484
30 Ga0070665_100258107 3300005548 Bacteria 1744
31 Ga0070704_100026079 3300005549 Bacteria 3856
32 Ga0070704_100117070 3300005549 Bacteria 2039
33 Ga0068855_100021430 3300005563 Bacteria 7749
34 Ga0068855_100060216 3300005563 Bacteria 4441
35 Ga0068855_100142009 3300005563 Bacteria 2736
36 Ga0070664_100004318 3300005564 Bacteria 11426
37 Ga0068857_100002523 3300005577 Bacteria 14985
38 Ga0068857_100043616 3300005577 Bacteria 3978
39 Ga0068856_100000079 3300005614 Bacteria 92486
40 Ga0068859_100000581 3300005617 Bacteria 36448
41 Ga0068859_100020422 3300005617 Bacteria 6648
42 Ga0068859_100022598 3300005617 Bacteria 6306
43 Ga0068859_100022748 3300005617 Bacteria 6285
44 Ga0068859_100080687 3300005617 Bacteria 3294
45 Ga0068864_100155689 3300005618 Bacteria 2074
46 Ga0068864_100249343 3300005618 Bacteria 1648
47 Ga0068863_100002577 3300005841 Bacteria 17972
48 Ga0068863_100047618 3300005841 Bacteria 4066
49 Ga0068863_100189857 3300005841 Bacteria 1974
50 Ga0068858_100019960 3300005842 Bacteria 6267
51 Ga0068858_100249668 3300005842 Bacteria 1685
52 Ga0068858_100357201 3300005842 Bacteria 1400
53 Ga0068860_100001970 3300005843 Bacteria 21702
54 Ga0068862_100218106 3300005844 Bacteria 1726
55 Ga0081455_10199528 3300005937 Bacteria 1499
56 Ga0097621_100011178 3300006237 Bacteria 6607
57 Ga0097621_100053230 3300006237 Bacteria 3299
58 Ga0068871_100004387 3300006358 Bacteria 9807
59 Ga0068871_100169937 3300006358 Bacteria 1868
60 Ga0075428_100020061 3300006844 Bacteria 7402
61 Ga0075428_100032920 3300006844 Bacteria 5724
62 Ga0075428_100548189 3300006844 Bacteria 1236
63 Ga0075430_100056764 3300006846 Bacteria 3293
64 Ga0075431_100008485 3300006847 Bacteria 10289
65 Ga0075431_100314557 3300006847 Bacteria 1580
66 Ga0075433_10014318 3300006852 Bacteria 6479
67 Ga0075434_100023706 3300006871 Bacteria 5986
68 Ga0097620_100000581 3300006931 Bacteria 36448
69 Ga0097620_100020422 3300006931 Bacteria 6648
70 Ga0097620_100022598 3300006931 Bacteria 6306
71 Ga0097620_100022748 3300006931 Bacteria 6285
72 Ga0097620_100080691 3300006931 Bacteria 3294
73 Ga0105240_10002780 3300009093 Bacteria 27659
74 Ga0105240_10062830 3300009093 Bacteria 4622
75 Ga0105240_10120624 3300009093 Bacteria 3158
76 Ga0105240_10177679 3300009093 Bacteria 2515
77 Ga0111539_10011188 3300009094 Bacteria 11277
78 Ga0111539_10023482 3300009094 Bacteria 7576
79 Ga0105245_10157920 3300009098 Bacteria 2149
80 Ga0114129_10000254 3300009147 Bacteria 60253
81 Ga0105242_10040908 3300009176 Bacteria 3736
82 Ga0105248_10000381 3300009177 Bacteria 51763
83 Ga0105238_10095745 3300009551 Bacteria 2955
84 Ga0157370_10110034 3300013104 Bacteria 2575
85 Ga0157374_10017540 3300013296 Bacteria 6306
86 Ga0157374_10057460 3300013296 Bacteria 3634
87 Ga0163162_10012410 3300013306 Bacteria 8321
88 Ga0157372_10215118 3300013307 Bacteria 2227
89 Ga0157375_10000017 3300013308 Bacteria 286152
90 Ga0157375_10000440 3300013308 Bacteria 37608
91 Ga0163163_10000194 3300014325 Bacteria 62568
92 Ga0163163_10015916 3300014325 Bacteria 6966
93 Ga0163163_10044401 3300014325 Bacteria 4360
94 Ga0157377_10085674 3300014745 Bacteria 1850
95 Ga0157379_10000263 3300014968 Bacteria 41237
96 Ga0157376_10044774 3300014969 Bacteria 3639
97 Ga0163161_10068482 3300017792 Bacteria 2593
98 Ga0207695_10022689 3300025913 Bacteria 7114
99 Ga0207695_10045676 3300025913 Bacteria 4648
100 Ga0207663_10001297 3300025916 Bacteria 11584
101 Ga0207663_10154914 3300025916 Bacteria 1611
102 Ga0207694_10100018 3300025924 Bacteria 2297
103 Ga0207659_10000432 3300025926 Bacteria 25126
104 Ga0207659_10004454 3300025926 Bacteria 8479
105 Ga0207659_10009724 3300025926 Bacteria 6014
106 Ga0207687_10136053 3300025927 Bacteria 1858
107 Ga0207670_10005501 3300025936 Bacteria 6963
108 Ga0207670_10068706 3300025936 Bacteria 2442
109 Ga0207691_10061338 3300025940 Bacteria 3416
110 Ga0207691_10263897 3300025940 Bacteria 1484
111 Ga0207711_10004330 3300025941 Bacteria 12121
112 Ga0207661_10200818 3300025944 Bacteria 1753
113 Ga0207679_10026979 3300025945 Bacteria 3967
114 Ga0207667_10075438 3300025949 Bacteria 3501
115 Ga0207667_10178588 3300025949 Bacteria 2181
116 Ga0207651_10019038 3300025960 Bacteria 4104
117 Ga0207658_10045574 3300025986 Bacteria 3197
118 Ga0207677_10139504 3300026023 Bacteria 1854
119 Ga0207702_10000669 3300026078 Bacteria 37291
120 Ga0207702_10002497 3300026078 Bacteria 17366
121 Ga0207641_10001650 3300026088 Bacteria 21778
122 Ga0207641_10019516 3300026088 Bacteria 5565
123 Ga0207676_10155816 3300026095 Bacteria 1973
124 Ga0207674_10015568 3300026116 Bacteria 8352
125 Ga0207675_100077546 3300026118 Bacteria 3113
126 Ga0268266_10309046 3300028379 Bacteria 1477
127 Ga0268265_10168952 3300028380 Bacteria 1867
128 Ga0268264_10069822 3300028381 Bacteria 2972
129 Ga0265337_1000077 3300028556 Bacteria 46215
130 Ga0265337_1025990 3300028556 Bacteria 1778
131 Ga0265326_10010588 3300028558 Bacteria 2734
132 Ga0265319_1000004 3300028563 Bacteria 305085
133 Ga0265319_1013723 3300028563 Bacteria 3206
134 Ga0265323_10000058 3300028653 Bacteria 61416
135 Ga0265323_10045041 3300028653 Bacteria 1587
136 Ga0265322_10022428 3300028654 Bacteria 1806
137 Ga0265336_10001988 3300028666 Bacteria 8733
138 Ga0265338_10000038 3300028800 Bacteria 237195
139 Ga0265338_10000214 3300028800 Bacteria 106870
140 Ga0265338_10000276 3300028800 Bacteria 93585
141 Ga0265338_10000439 3300028800 Bacteria 74770
142 Ga0265338_10000533 3300028800 Bacteria 66710
143 Ga0265338_10000630 3300028800 Bacteria 61283
144 Ga0265338_10000843 3300028800 Bacteria 51673
145 Ga0265338_10001209 3300028800 Bacteria 42710
146 Ga0265338_10003168 3300028800 Bacteria 23481
147 Ga0265338_10004206 3300028800 Bacteria 19630
148 Ga0265338_10004557 3300028800 Bacteria 18651
149 Ga0265338_10005205 3300028800 Bacteria 17062
150 Ga0265338_10005988 3300028800 Bacteria 15643
151 Ga0265338_10007101 3300028800 Bacteria 14031
152 Ga0265338_10010977 3300028800 Bacteria 10526
153 Ga0265338_10042086 3300028800 Bacteria 4261
154 Ga0265338_10049724 3300028800 Bacteria 3797
155 Ga0265338_10069685 3300028800 Bacteria 3019
156 Ga0265338_10157554 3300028800 Bacteria 1757
157 Ga0265338_10163531 3300028800 Bacteria 1716
158 Ga0265338_10263419 3300028800 Bacteria 1266
159 Ga0265324_10000237 3300029957 Bacteria 41672
160 Ga0265324_10000865 3300029957 Bacteria 19451
161 Ga0265324_10018035 3300029957 Bacteria 2560
162 Ga0265324_10019675 3300029957 Bacteria 2430
163 Ga0265324_10027960 3300029957 Bacteria 1990
164 Ga0265328_10011966 3300031239 Bacteria 3460
165 Ga0265320_10000242 3300031240 Bacteria 45162
166 Ga0265320_10000364 3300031240 Bacteria 36776
167 Ga0265320_10025300 3300031240 Bacteria 3123
168 Ga0265320_10058233 3300031240 Bacteria 1850
169 Ga0265325_10007970 3300031241 Bacteria 6287
170 Ga0265325_10013206 3300031241 Bacteria 4706
171 Ga0265325_10057682 3300031241 Bacteria 1980
172 Ga0265329_10000325 3300031242 Bacteria 25315
173 Ga0265340_10000246 3300031247 Bacteria 28156
174 Ga0265340_10044978 3300031247 Bacteria 2158
175 Ga0265339_10013546 3300031249 Bacteria 4938
176 Ga0265339_10019883 3300031249 Bacteria 3931
177 Ga0265339_10029683 3300031249 Bacteria 3101
178 Ga0265339_10067163 3300031249 Bacteria 1918
179 Ga0265327_10001439 3300031251 Bacteria 30023
180 Ga0265316_10001480 3300031344 Bacteria 25164
181 Ga0265316_10005378 3300031344 Bacteria 12458
182 Ga0265316_10007636 3300031344 Bacteria 10157
183 Ga0265316_10021474 3300031344 Bacteria 5466
184 Ga0265316_10047472 3300031344 Bacteria 3397
185 Ga0265316_10069028 3300031344 Bacteria 2728
186 Ga0265316_10127303 3300031344 Bacteria 1920
187 Ga0265313_10004915 3300031595 Bacteria 10017
188 Ga0265313_10013895 3300031595 Bacteria 4795
189 Ga0265314_10000214 3300031711 Bacteria 85787
190 Ga0265314_10061098 3300031711 Bacteria 2568
191 Ga0265314_10123626 3300031711 Bacteria 1625
192 Ga0316576_10174895 3300031727 Bacteria 1620
193 Ga0373950_0001488 3300034818 Bacteria 3063
194 Ga0373951_0008722 3300035091 Bacteria 2285
195 Ga0373932_0000001 3300035112 Bacteria 1459067
196 Ga0373945_0005248 3300035116 Bacteria 4143
197 Ga0373954_0001248 3300035118 Bacteria 10248
198 Ga0373956_0020622 3300035119 Bacteria 2807
199 Ga0373946_0023148 3300035171 Bacteria 2425
200 Ga0373946_0043383 3300035171 Bacteria 1853
201 Ga0373931_0000004 3300035691 Bacteria 535140
202 Ga0373927_0057753 3300035695 Bacteria 2509
203 Ga0373947_0061870 3300035725 Bacteria 2276
204 Ga0373937_0001257 3300036401 Bacteria 21283
205 Ga0373937_0239249 3300036401 Bacteria 1710
206 Ga0373925_0001025 3300037068 Bacteria 25280
207 Ga0373925_0009077 3300037068 Bacteria 7239
208 Ga0373925_0019312 3300037068 Bacteria 4956
209 Ga0395900_0441768 3300037418 Bacteria 1258
210 Ga0395905_0011375 3300037471 Bacteria 8603
211 Ga0451577_0001244 3300042876 Bacteria 35254
212 Ga0451577_0001420 3300042876 Bacteria 31947
213 Ga0451577_0004245 3300042876 Bacteria 15254
214 Ga0451577_0014324 3300042876 Bacteria 7393
215 Ga0451577_0045227 3300042876 Bacteria 3940
216 Ga0451577_0120612 3300042876 Bacteria 2349
217 Ga0453684_0005468 3300044712 Bacteria 25149
218 Ga0453684_0022726 3300044712 Bacteria 9289
219 Ga0453684_0079718 3300044712 Bacteria 4092
220 Ga0451576_0029710 3300045051 Bacteria 5847
221 Ga0451576_0030294 3300045051 Bacteria 5784
222 Ga0451576_0036675 3300045051 Bacteria 5196
223 Ga0451576_0058186 3300045051 Bacteria 4040
224 Ga0451576_0064758 3300045051 Bacteria 3807
225 Ga0451576_0068329 3300045051 Bacteria 3698
226 Ga0451576_0071283 3300045051 Bacteria 3616
227 Ga0451576_0082396 3300045051 Bacteria 3346
228 Ga0451576_0138683 3300045051 Bacteria 2537
229 Ga0451576_0161229 3300045051 Bacteria 2341
230 Ga0451576_0297475 3300045051 Bacteria 1688
231 Ga0495592_0000101 3300046454 Bacteria 75856
232 Ga0495592_0173215 3300046454 Bacteria 1476
233 Ga0495608_0052528 3300046511 Bacteria 2698
234 Ga0495618_0001806 3300046514 Bacteria 14162
235 Ga0495628_0001655 3300046516 Bacteria 20382
236 Ga0495630_0000073 3300046517 Bacteria 79321
237 Ga0495630_0036449 3300046517 Bacteria 3677
238 Ga0495630_0174762 3300046517 Bacteria 1637
239 Ga0495666_0001768 3300046526 Bacteria 10663
240 Ga0495640_0015495 3300046533 Bacteria 5734
241 Ga0495640_0029893 3300046533 Bacteria 3905
242 Ga0495586_0000040 3300046535 Bacteria 79335
243 Ga0495586_0000348 3300046535 Bacteria 29056
244 Ga0495586_0000548 3300046535 Bacteria 21893
245 Ga0495586_0004896 3300046535 Bacteria 7163
246 Ga0495586_0032801 3300046535 Bacteria 2785
247 Ga0495656_0076364 3300046615 Bacteria 1501
248 Ga0495634_0000889 3300046642 Bacteria 28667
249 Ga0495634_0008406 3300046642 Bacteria 7691
250 Ga0495634_0031994 3300046642 Bacteria 3620
251 Ga0495634_0166651 3300046642 Bacteria 1386
252 Ga0495599_0012567 3300046678 Bacteria 5222
253 Ga0495647_0031901 3300046681 Bacteria 1961
254 Ga0495658_0004210 3300046683 Bacteria 7083
255 Ga0495658_0028547 3300046683 Bacteria 3013
256 Ga0495613_0008133 3300046689 Bacteria 7802
257 Ga0495613_0076080 3300046689 Bacteria 2443
258 Ga0495581_0095952 3300047315 Bacteria 1722
259 Ga0495604_0106790 3300047317 Bacteria 2047
260 Ga0495674_0002615 3300047319 Bacteria 17520
261 Ga0495674_0006476 3300047319 Bacteria 11226
262 Ga0495674_0110435 3300047319 Bacteria 2332
263 Ga0495676_0006224 3300047321 Bacteria 10981
264 Ga0495676_0123381 3300047321 Bacteria 1881
265 Ga0495680_0042956 3300047322 Bacteria 3583
266 Ga0495684_0106204 3300047471 Bacteria 2121
267 Ga0501031_0000004 3300049568 Bacteria 202781
268 Ga0501031_0018937 3300049568 Bacteria 4482
269 Ga0501032_0005152 3300049569 Bacteria 9747
270 Ga0501032_0052606 3300049569 Bacteria 2744
271 Ga0501033_0011982 3300049570 Bacteria 6622
272 Ga0501034_0085672 3300049571 Bacteria 3152
273 Ga0501036_0117347 3300049572 Bacteria 2248
274 Ga0501257_010413 3300049686 Bacteria 2110
275 Ga0501080_0088193 3300049742 Bacteria 2882
276 Ga0501035_0040887 3300049822 Bacteria 4187
277 Ga0501035_0186142 3300049822 Bacteria 1787
278 Ga0501044_0001072 3300049823 Bacteria 32802
279 Ga0501044_0029088 3300049823 Bacteria 5827
280 nmdc:mga05p37_2475_c1 3300050507 Bacteria 21484
281 nmdc:mga06r32_312141_c1 3300050510 Bacteria 1558
282 nmdc:mga08y16_13579_c1 3300050511 Bacteria 8572
283 nmdc:mga08y16_98393_c1 3300050511 Bacteria 3046
284 nmdc:mga0n895_10968_c1 3300050512 Bacteria 8053
285 nmdc:mga0a205_41022_c1 3300050515 Bacteria 4457

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0123381 Ga0495676_0123381_838_1830 328
2 3300005549 Ga0070704_100117070 Ga0070704_1001170702 338
3 3300005617 Ga0068859_100000581 Ga0068859_10000058122 338
4 3300006931 Ga0097620_100000581 Ga0097620_10000058122 338
5 3300009094 Ga0111539_10023482 Ga0111539_100234824 338
6 3300025926 Ga0207659_10009724 Ga0207659_100097244 338
7 3300026118 Ga0207675_100077546 Ga0207675_1000775462 338
8 3300042876 Ga0451577_0045227 Ga0451577_0045227_1476_2627 342
9 3300044712 Ga0453684_0005468 Ga0453684_0005468_13619_14770 342
10 3300028653 Ga0265323_10045041 Ga0265323_100450412 351
11 3300013308 Ga0157375_10000017 Ga0157375_10000017166 353
12 3300014969 Ga0157376_10044774 Ga0157376_100447741 353
13 3300005548 Ga0070665_100258107 Ga0070665_1002581072 354
14 3300006844 Ga0075428_100020061 Ga0075428_1000200615 354
15 3300025926 Ga0207659_10004454 Ga0207659_100044542 354
16 3300028379 Ga0268266_10309046 Ga0268266_103090462 354
17 3300005329 Ga0070683_100283051 Ga0070683_1002830511 355
18 3300013296 Ga0157374_10017540 Ga0157374_100175404 355
19 3300036401 Ga0373937_0239249 Ga0373937_0239249_244_1392 355
20 3300045051 Ga0451576_0082396 Ga0451576_0082396_1542_2705 357
21 3300005365 Ga0070688_100042696 Ga0070688_1000426962 361
22 3300005617 Ga0068859_100020422 Ga0068859_1000204225 361
23 3300006931 Ga0097620_100020422 Ga0097620_1000204223 361
24 3300025936 Ga0207670_10005501 Ga0207670_100055012 361
25 3300026088 Ga0207641_10019516 Ga0207641_100195163 361
26 3300005330 Ga0070690_100051168 Ga0070690_1000511682 362
27 3300005340 Ga0070689_100050058 Ga0070689_1000500582 362
28 3300005354 Ga0070675_100000804 Ga0070675_10000080416 362
29 3300005354 Ga0070675_100101707 Ga0070675_1001017072 362
30 3300005364 Ga0070673_100068122 Ga0070673_1000681222 362
31 3300005367 Ga0070667_100061131 Ga0070667_1000611312 362
32 3300005543 Ga0070672_100103891 Ga0070672_1001038912 362
33 3300005564 Ga0070664_100004318 Ga0070664_1000043188 362
34 3300005617 Ga0068859_100022748 Ga0068859_1000227484 362
35 3300005618 Ga0068864_100155689 Ga0068864_1001556892 362
36 3300005841 Ga0068863_100002577 Ga0068863_1000025777 362
37 3300005842 Ga0068858_100019960 Ga0068858_1000199602 362
38 3300005843 Ga0068860_100001970 Ga0068860_10000197012 362
39 3300006237 Ga0097621_100011178 Ga0097621_1000111782 362
40 3300006358 Ga0068871_100004387 Ga0068871_1000043873 362
41 3300006844 Ga0075428_100032920 Ga0075428_1000329202 362
42 3300006852 Ga0075433_10014318 Ga0075433_100143186 362
43 3300006871 Ga0075434_100023706 Ga0075434_1000237062 362
44 3300006931 Ga0097620_100022748 Ga0097620_1000227484 362
45 3300009094 Ga0111539_10011188 Ga0111539_100111888 362
46 3300009147 Ga0114129_10000254 Ga0114129_1000025437 362
47 3300009177 Ga0105248_10000381 Ga0105248_1000038140 362
48 3300013296 Ga0157374_10057460 Ga0157374_100574601 362
49 3300013306 Ga0163162_10012410 Ga0163162_100124107 362
50 3300013308 Ga0157375_10000440 Ga0157375_100004408 362
51 3300014325 Ga0163163_10044401 Ga0163163_100444013 362
52 3300014745 Ga0157377_10085674 Ga0157377_100856742 362
53 3300014968 Ga0157379_10000263 Ga0157379_1000026310 362
54 3300017792 Ga0163161_10068482 Ga0163161_100684822 362
55 3300025926 Ga0207659_10000432 Ga0207659_1000043220 362
56 3300025940 Ga0207691_10061338 Ga0207691_100613383 362
57 3300025940 Ga0207691_10263897 Ga0207691_102638972 362
58 3300025941 Ga0207711_10004330 Ga0207711_100043309 362
59 3300025945 Ga0207679_10026979 Ga0207679_100269792 362
60 3300025960 Ga0207651_10019038 Ga0207651_100190382 362
61 3300025986 Ga0207658_10045574 Ga0207658_100455742 362
62 3300026088 Ga0207641_10001650 Ga0207641_100016509 362
63 3300026095 Ga0207676_10155816 Ga0207676_101558161 362
64 3300028381 Ga0268264_10069822 Ga0268264_100698222 362
65 3300037418 Ga0395900_0441768 Ga0395900_0441768_29_1147 362
66 3300050507 nmdc:mga05p37_2475_c1 nmdc:mga05p37_2475_c1_7647_8795 362
67 3300050511 nmdc:mga08y16_13579_c1 nmdc:mga08y16_13579_c1_3121_4269 362
68 3300050512 nmdc:mga0n895_10968_c1 nmdc:mga0n895_10968_c1_5588_6736 362
69 3300050515 nmdc:mga0a205_41022_c1 nmdc:mga0a205_41022_c1_2437_3585 362
70 3300005330 Ga0070690_100010019 Ga0070690_1000100192 365
71 3300005343 Ga0070687_100051876 Ga0070687_1000518762 365
72 3300005438 Ga0070701_10006647 Ga0070701_100066472 365
73 3300005440 Ga0070705_100026546 Ga0070705_1000265462 365
74 3300005444 Ga0070694_100017293 Ga0070694_1000172933 365
75 3300005544 Ga0070686_100013974 Ga0070686_1000139742 365
76 3300005549 Ga0070704_100026079 Ga0070704_1000260792 365
77 3300045051 Ga0451576_0138683 Ga0451576_0138683_472_1632 365
78 3300005544 Ga0070686_100024588 Ga0070686_1000245882 366
79 3300035119 Ga0373956_0020622 Ga0373956_0020622_399_1586 366
80 3300042876 Ga0451577_0001244 Ga0451577_0001244_20721_21869 366
81 3300045051 Ga0451576_0064758 Ga0451576_0064758_2026_3174 366
82 3300046454 Ga0495592_0173215 Ga0495592_0173215_222_1409 367
83 3300046517 Ga0495630_0174762 Ga0495630_0174762_66_1253 367
84 3300046642 Ga0495634_0031994 Ga0495634_0031994_2203_3390 367
85 3300028800 Ga0265338_10001209 Ga0265338_1000120920 369
86 3300046535 Ga0495586_0004896 Ga0495586_0004896_3838_4956 370
87 3300046642 Ga0495634_0166651 Ga0495634_0166651_190_1308 370
88 3300046681 Ga0495647_0031901 Ga0495647_0031901_814_1932 370
89 3300046683 Ga0495658_0028547 Ga0495658_0028547_1874_2992 370
90 3300046689 Ga0495613_0076080 Ga0495613_0076080_925_2043 370
91 3300031249 Ga0265339_10067163 Ga0265339_100671632 371
92 3300028800 Ga0265338_10163531 Ga0265338_101635312 375
93 3300031711 Ga0265314_10123626 Ga0265314_101236262 375
94 3300042876 Ga0451577_0001420 Ga0451577_0001420_22633_23781 375
95 3300044712 Ga0453684_0079718 Ga0453684_0079718_2657_3805 375
96 3300006846 Ga0075430_100056764 Ga0075430_1000567643 378
97 3300006847 Ga0075431_100008485 Ga0075431_10000848511 378
98 3300037471 Ga0395905_0011375 Ga0395905_0011375_4079_5227 378
99 3300042876 Ga0451577_0120612 Ga0451577_0120612_185_1333 378
100 3300005330 Ga0070690_100013712 Ga0070690_1000137124 379
101 3300005544 Ga0070686_100163504 Ga0070686_1001635041 379
102 3300005563 Ga0068855_100021430 Ga0068855_1000214305 379
103 3300005563 Ga0068855_100060216 Ga0068855_1000602163 379
104 3300005614 Ga0068856_100000079 Ga0068856_10000007966 379
105 3300005617 Ga0068859_100022598 Ga0068859_1000225982 379
106 3300005842 Ga0068858_100249668 Ga0068858_1002496682 379
107 3300006931 Ga0097620_100022598 Ga0097620_1000225982 379
108 3300025949 Ga0207667_10075438 Ga0207667_100754383 379
109 3300026078 Ga0207702_10000669 Ga0207702_1000066928 379
110 3300026078 Ga0207702_10002497 Ga0207702_1000249713 379
111 3300028556 Ga0265337_1000077 Ga0265337_100007720 379
112 3300028556 Ga0265337_1025990 Ga0265337_10259902 379
113 3300028558 Ga0265326_10010588 Ga0265326_100105883 379
114 3300028563 Ga0265319_1013723 Ga0265319_10137232 379
115 3300028653 Ga0265323_10000058 Ga0265323_1000005812 379
116 3300028654 Ga0265322_10022428 Ga0265322_100224282 379
117 3300028666 Ga0265336_10001988 Ga0265336_100019885 379
118 3300028800 Ga0265338_10000214 Ga0265338_1000021454 379
119 3300028800 Ga0265338_10000276 Ga0265338_1000027656 379
120 3300028800 Ga0265338_10000439 Ga0265338_1000043956 379
121 3300028800 Ga0265338_10000533 Ga0265338_1000053335 379
122 3300028800 Ga0265338_10000843 Ga0265338_1000084319 379
123 3300028800 Ga0265338_10004557 Ga0265338_100045576 379
124 3300028800 Ga0265338_10005205 Ga0265338_1000520510 379
125 3300028800 Ga0265338_10005988 Ga0265338_1000598817 379
126 3300028800 Ga0265338_10007101 Ga0265338_100071015 379
127 3300029957 Ga0265324_10000237 Ga0265324_1000023721 379
128 3300031240 Ga0265320_10000242 Ga0265320_1000024234 379
129 3300031240 Ga0265320_10000364 Ga0265320_1000036428 379
130 3300031240 Ga0265320_10058233 Ga0265320_100582332 379
131 3300031241 Ga0265325_10007970 Ga0265325_100079705 379
132 3300031241 Ga0265325_10013206 Ga0265325_100132064 379
133 3300031247 Ga0265340_10000246 Ga0265340_100002469 379
134 3300031249 Ga0265339_10013546 Ga0265339_100135463 379
135 3300031249 Ga0265339_10029683 Ga0265339_100296834 379
136 3300031344 Ga0265316_10001480 Ga0265316_1000148013 379
137 3300031344 Ga0265316_10005378 Ga0265316_100053783 379
138 3300031344 Ga0265316_10007636 Ga0265316_100076369 379
139 3300031344 Ga0265316_10021474 Ga0265316_100214744 379
140 3300031344 Ga0265316_10047472 Ga0265316_100474723 379
141 3300031344 Ga0265316_10069028 Ga0265316_100690283 379
142 3300031595 Ga0265313_10013895 Ga0265313_100138954 379
143 3300031711 Ga0265314_10061098 Ga0265314_100610982 379
144 3300035118 Ga0373954_0001248 Ga0373954_0001248_1104_2252 379
145 3300036401 Ga0373937_0001257 Ga0373937_0001257_19163_20311 379
146 3300045051 Ga0451576_0297475 Ga0451576_0297475_362_1507 379
147 3300046535 Ga0495586_0000548 Ga0495586_0000548_5140_6288 379
148 3300046642 Ga0495634_0000889 Ga0495634_0000889_23642_24790 379
149 3300047319 Ga0495674_0110435 Ga0495674_0110435_805_1953 379
150 3300047322 Ga0495680_0042956 Ga0495680_0042956_689_1837 379
151 3300047471 Ga0495684_0106204 Ga0495684_0106204_733_1881 379
152 3300005338 Ga0068868_100062267 Ga0068868_1000622672 380
153 3300005340 Ga0070689_100221501 Ga0070689_1002215012 380
154 3300005354 Ga0070675_100191505 Ga0070675_1001915052 380
155 3300005439 Ga0070711_100184271 Ga0070711_1001842712 380
156 3300005545 Ga0070695_100183540 Ga0070695_1001835402 380
157 3300005577 Ga0068857_100002523 Ga0068857_1000025233 380
158 3300005577 Ga0068857_100043616 Ga0068857_1000436162 380
159 3300005617 Ga0068859_100080687 Ga0068859_1000806872 380
160 3300005618 Ga0068864_100249343 Ga0068864_1002493433 380
161 3300005841 Ga0068863_100047618 Ga0068863_1000476185 380
162 3300005842 Ga0068858_100357201 Ga0068858_1003572012 380
163 3300006237 Ga0097621_100053230 Ga0097621_1000532302 380
164 3300006358 Ga0068871_100169937 Ga0068871_1001699372 380
165 3300006844 Ga0075428_100548189 Ga0075428_1005481891 380
166 3300006847 Ga0075431_100314557 Ga0075431_1003145572 380
167 3300006931 Ga0097620_100080691 Ga0097620_1000806913 380
168 3300009093 Ga0105240_10002780 Ga0105240_1000278011 380
169 3300009093 Ga0105240_10062830 Ga0105240_100628304 380
170 3300009098 Ga0105245_10157920 Ga0105245_101579202 380
171 3300009176 Ga0105242_10040908 Ga0105242_100409082 380
172 3300014325 Ga0163163_10000194 Ga0163163_1000019412 380
173 3300014325 Ga0163163_10015916 Ga0163163_100159167 380
174 3300025913 Ga0207695_10022689 Ga0207695_100226896 380
175 3300025913 Ga0207695_10045676 Ga0207695_100456764 380
176 3300025916 Ga0207663_10154914 Ga0207663_101549141 380
177 3300025927 Ga0207687_10136053 Ga0207687_101360532 380
178 3300026023 Ga0207677_10139504 Ga0207677_101395042 380
179 3300026116 Ga0207674_10015568 Ga0207674_100155683 380
180 3300028380 Ga0268265_10168952 Ga0268265_101689523 380
181 3300031239 Ga0265328_10011966 Ga0265328_100119662 380
182 3300031241 Ga0265325_10057682 Ga0265325_100576822 380
183 3300031242 Ga0265329_10000325 Ga0265329_100003256 380
184 3300031344 Ga0265316_10127303 Ga0265316_101273032 380
185 3300031711 Ga0265314_10000214 Ga0265314_1000021429 380
186 3300031727 Ga0316576_10174895 Ga0316576_101748952 380
187 3300035171 Ga0373946_0023148 Ga0373946_0023148_541_1689 380
188 3300035695 Ga0373927_0057753 Ga0373927_0057753_1218_2366 380
189 3300035725 Ga0373947_0061870 Ga0373947_0061870_1110_2258 380
190 3300037068 Ga0373925_0009077 Ga0373925_0009077_3743_4891 380
191 3300042876 Ga0451577_0004245 Ga0451577_0004245_9013_10167 380
192 3300042876 Ga0451577_0014324 Ga0451577_0014324_67_1215 380
193 3300044712 Ga0453684_0022726 Ga0453684_0022726_7794_8942 380
194 3300045051 Ga0451576_0030294 Ga0451576_0030294_2719_3867 380
195 3300045051 Ga0451576_0058186 Ga0451576_0058186_712_1860 380
196 3300045051 Ga0451576_0068329 Ga0451576_0068329_236_1384 380
197 3300045051 Ga0451576_0071283 Ga0451576_0071283_1268_2416 380
198 3300045051 Ga0451576_0161229 Ga0451576_0161229_126_1280 380
199 3300046454 Ga0495592_0000101 Ga0495592_0000101_66347_67495 380
200 3300046514 Ga0495618_0001806 Ga0495618_0001806_8232_9380 380
201 3300046516 Ga0495628_0001655 Ga0495628_0001655_7980_9128 380
202 3300046517 Ga0495630_0036449 Ga0495630_0036449_1017_2165 380
203 3300046533 Ga0495640_0015495 Ga0495640_0015495_3151_4299 380
204 3300046535 Ga0495586_0000348 Ga0495586_0000348_9791_10939 380
205 3300046678 Ga0495599_0012567 Ga0495599_0012567_3392_4540 380
206 3300047317 Ga0495604_0106790 Ga0495604_0106790_492_1640 380
207 3300047319 Ga0495674_0006476 Ga0495674_0006476_2226_3374 380
208 3300049571 Ga0501034_0085672 Ga0501034_0085672_1757_2905 380
209 3300049572 Ga0501036_0117347 Ga0501036_0117347_73_1221 380
210 3300049686 Ga0501257_010413 Ga0501257_010413_115_1263 380
211 3300050510 nmdc:mga06r32_312141_c1 nmdc:mga06r32_312141_c1_298_1455 380
212 3300050511 nmdc:mga08y16_98393_c1 nmdc:mga08y16_98393_c1_1543_2691 380
213 3300046683 Ga0495658_0004210 Ga0495658_0004210_4553_5713 382
214 3300028800 Ga0265338_10042086 Ga0265338_100420862 384
215 3300045051 Ga0451576_0029710 Ga0451576_0029710_602_1759 384
216 3300028800 Ga0265338_10069685 Ga0265338_100696854 386
217 3300031240 Ga0265320_10025300 Ga0265320_100253002 386
218 3300045051 Ga0451576_0036675 Ga0451576_0036675_1486_2673 386
219 3300046511 Ga0495608_0052528 Ga0495608_0052528_1347_2543 386
220 3300046535 Ga0495586_0032801 Ga0495586_0032801_299_1495 386
221 3300028800 Ga0265338_10000038 Ga0265338_10000038191 388
222 3300031249 Ga0265339_10019883 Ga0265339_100198833 388
223 3300034818 Ga0373950_0001488 Ga0373950_0001488_1611_2795 390
224 3300035091 Ga0373951_0008722 Ga0373951_0008722_434_1618 390
225 3300035112 Ga0373932_0000001 Ga0373932_0000001_242153_243337 390
226 3300035116 Ga0373945_0005248 Ga0373945_0005248_416_1600 390
227 3300035171 Ga0373946_0043383 Ga0373946_0043383_38_1222 390
228 3300035691 Ga0373931_0000004 Ga0373931_0000004_242162_243346 390
229 3300037068 Ga0373925_0001025 Ga0373925_0001025_8940_10124 390
230 3300028800 Ga0265338_10003168 Ga0265338_1000316819 391
231 3300029957 Ga0265324_10000865 Ga0265324_100008654 391
232 3300037068 Ga0373925_0019312 Ga0373925_0019312_2990_4180 392
233 3300046517 Ga0495630_0000073 Ga0495630_0000073_14171_15355 392
234 3300046526 Ga0495666_0001768 Ga0495666_0001768_5489_6673 392
235 3300046533 Ga0495640_0029893 Ga0495640_0029893_1376_2560 392
236 3300046535 Ga0495586_0000040 Ga0495586_0000040_14171_15355 392
237 3300046642 Ga0495634_0008406 Ga0495634_0008406_2504_3688 392
238 3300046689 Ga0495613_0008133 Ga0495613_0008133_5646_6830 392
239 3300047315 Ga0495581_0095952 Ga0495581_0095952_435_1619 392
240 3300047319 Ga0495674_0002615 Ga0495674_0002615_14093_15277 392
241 3300047321 Ga0495676_0006224 Ga0495676_0006224_921_2105 392
242 3300003320 rootH2_10035288 rootH2_100352882 393
243 3300005340 Ga0070689_100114883 Ga0070689_1001148832 393
244 3300005341 Ga0070691_10013697 Ga0070691_100136972 393
245 3300005439 Ga0070711_100002309 Ga0070711_1000023094 393
246 3300005466 Ga0070685_10014966 Ga0070685_100149663 393
247 3300005544 Ga0070686_100155058 Ga0070686_1001550581 393
248 3300005563 Ga0068855_100142009 Ga0068855_1001420093 393
249 3300005841 Ga0068863_100189857 Ga0068863_1001898572 393
250 3300005844 Ga0068862_100218106 Ga0068862_1002181061 393
251 3300005937 Ga0081455_10199528 Ga0081455_101995281 393
252 3300009093 Ga0105240_10120624 Ga0105240_101206244 393
253 3300009093 Ga0105240_10177679 Ga0105240_101776791 393
254 3300009551 Ga0105238_10095745 Ga0105238_100957454 393
255 3300013104 Ga0157370_10110034 Ga0157370_101100342 393
256 3300013307 Ga0157372_10215118 Ga0157372_102151182 393
257 3300025916 Ga0207663_10001297 Ga0207663_1000129710 393
258 3300025924 Ga0207694_10100018 Ga0207694_101000181 393
259 3300025936 Ga0207670_10068706 Ga0207670_100687062 393
260 3300025944 Ga0207661_10200818 Ga0207661_102008182 393
261 3300025949 Ga0207667_10178588 Ga0207667_101785882 393
262 3300028563 Ga0265319_1000004 Ga0265319_100000491 393
263 3300028800 Ga0265338_10000630 Ga0265338_1000063057 393
264 3300028800 Ga0265338_10004206 Ga0265338_100042067 393
265 3300028800 Ga0265338_10010977 Ga0265338_100109773 393
266 3300028800 Ga0265338_10049724 Ga0265338_100497243 393
267 3300028800 Ga0265338_10157554 Ga0265338_101575542 393
268 3300028800 Ga0265338_10263419 Ga0265338_102634191 393
269 3300029957 Ga0265324_10018035 Ga0265324_100180352 393
270 3300029957 Ga0265324_10019675 Ga0265324_100196752 393
271 3300029957 Ga0265324_10027960 Ga0265324_100279602 393
272 3300031247 Ga0265340_10044978 Ga0265340_100449782 393
273 3300031251 Ga0265327_10001439 Ga0265327_1000143913 393
274 3300031595 Ga0265313_10004915 Ga0265313_100049154 393
275 3300046615 Ga0495656_0076364 Ga0495656_0076364_125_1309 393
276 3300049568 Ga0501031_0000004 Ga0501031_0000004_135378_136562 393
277 3300049568 Ga0501031_0018937 Ga0501031_0018937_1491_2675 393
278 3300049569 Ga0501032_0005152 Ga0501032_0005152_334_1518 393
279 3300049569 Ga0501032_0052606 Ga0501032_0052606_683_1867 393
280 3300049570 Ga0501033_0011982 Ga0501033_0011982_1696_2880 393
281 3300049742 Ga0501080_0088193 Ga0501080_0088193_780_1961 393
282 3300049822 Ga0501035_0040887 Ga0501035_0040887_116_1300 393
283 3300049822 Ga0501035_0186142 Ga0501035_0186142_327_1511 393
284 3300049823 Ga0501044_0001072 Ga0501044_0001072_1515_2699 393
285 3300049823 Ga0501044_0029088 Ga0501044_0029088_4436_5620 393

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

83

95

0.97

PF00953

Glycos_transf_4

Glycosyl transferase family 4

112

318

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9595 33 391
6oyz-assembly1.cif.gz_A crystal structure of mray bound to capuramycin 0.955 34 391
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9546 34 391
6oyh-assembly2.cif.gz_C crystal structure of mray bound to carbacaprazamycin 0.9544 34 391
6oyh-assembly3.cif.gz_B crystal structure of mray bound to carbacaprazamycin 0.9536 34 391
ID Description Score Start End Superfamily
af_B6SP54_8_261_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2964 204 393 1.20.1250.20
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.286 205 391 1.20.1250.20
af_A0A1D8PJN2_21_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2858 118 388 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.275 204 387 1.20.1250.20
af_O01840_1_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2699 201 387 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A382HE65-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase 0.9873 205 393 GO:0005886
GO:0008963
GO:0044038
GO:0071555
AF-A0A661TJ11-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9841 227 393 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0051992
GO:0071555
AF-A0A536UQL1-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9811 236 393 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A7C7VBU3-F1-model_v4 deleted 0.9787 204 393
AF-A0A3C0DUC1-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9781 200 337 GO:0005886
GO:0008963
GO:0044038
GO:0046872
GO:0051992
GO:0071555

Feature Viewer

pLDDT pTM Quality
85.96 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map