F386643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 285 | 149 | 285 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100002309|Ga0070711_1000023094 |
| Length | 399 |
| Sequence | MLYYLSQKLLEWTNGTPWADHLSALRLFRYITVRSAGAAVTALLLSWWLGPKIIHWLKQLKFGQDYADKAEEAGGLAARVLSKKGTPTMGGVLIVMVLVFSTMLWTEWNAQVELTALAVLVLAGLGFYDDYAKIIQQSGGGTPPRLKLIVQIAAALFVGIYLWQLPATSELRLSENKNVITSYLVSDLMLPFYKYPIHMGAIAGIPVAGLVVVLLAIVGSSNAVNLTDGLDGLAIGCALITAFVFLVFTYVAGNVKAAAYLQIPYVSGAGELTVFCAALIGAGLGFLWFNCHPAQVFMGDTGSLALGGAFGIMAVLIHQPFVLVIAGGVFVLEAVSVMLQTGWFKFTRMRTGTGRRIFLMAPLHHHFEKKGWYESQVVMRFYILCVLFAVVALATLKLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 83 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 84 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 85 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 89 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 91 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 93 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 99 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 108 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 109 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 114 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 142 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10035288 | 3300003320 | Bacteria | 5501 |
| 2 | Ga0070683_100283051 | 3300005329 | Unclassified | 1577 |
| 3 | Ga0070690_100010019 | 3300005330 | Bacteria | 5502 |
| 4 | Ga0070690_100013712 | 3300005330 | Bacteria | 4799 |
| 5 | Ga0070690_100051168 | 3300005330 | Bacteria | 2636 |
| 6 | Ga0068868_100062267 | 3300005338 | Bacteria | 2957 |
| 7 | Ga0070689_100050058 | 3300005340 | Bacteria | 3227 |
| 8 | Ga0070689_100114883 | 3300005340 | Bacteria | 2145 |
| 9 | Ga0070689_100221501 | 3300005340 | Bacteria | 1552 |
| 10 | Ga0070691_10013697 | 3300005341 | Bacteria | 3718 |
| 11 | Ga0070687_100051876 | 3300005343 | Bacteria | 2126 |
| 12 | Ga0070675_100000804 | 3300005354 | Bacteria | 22072 |
| 13 | Ga0070675_100101707 | 3300005354 | Bacteria | 2421 |
| 14 | Ga0070675_100191505 | 3300005354 | Bacteria | 1772 |
| 15 | Ga0070673_100068122 | 3300005364 | Bacteria | 2849 |
| 16 | Ga0070688_100042696 | 3300005365 | Bacteria | 2790 |
| 17 | Ga0070667_100061131 | 3300005367 | Bacteria | 3189 |
| 18 | Ga0070701_10006647 | 3300005438 | Bacteria | 4880 |
| 19 | Ga0070711_100002309 | 3300005439 | Bacteria | 10823 |
| 20 | Ga0070711_100184271 | 3300005439 | Bacteria | 1600 |
| 21 | Ga0070705_100026546 | 3300005440 | Bacteria | 3153 |
| 22 | Ga0070694_100017293 | 3300005444 | Bacteria | 4554 |
| 23 | Ga0070685_10014966 | 3300005466 | Bacteria | 4117 |
| 24 | Ga0070672_100103891 | 3300005543 | Bacteria | 2308 |
| 25 | Ga0070686_100013974 | 3300005544 | Bacteria | 4613 |
| 26 | Ga0070686_100024588 | 3300005544 | Bacteria | 3612 |
| 27 | Ga0070686_100155058 | 3300005544 | Unclassified | 1607 |
| 28 | Ga0070686_100163504 | 3300005544 | Bacteria | 1569 |
| 29 | Ga0070695_100183540 | 3300005545 | Bacteria | 1484 |
| 30 | Ga0070665_100258107 | 3300005548 | Bacteria | 1744 |
| 31 | Ga0070704_100026079 | 3300005549 | Bacteria | 3856 |
| 32 | Ga0070704_100117070 | 3300005549 | Bacteria | 2039 |
| 33 | Ga0068855_100021430 | 3300005563 | Bacteria | 7749 |
| 34 | Ga0068855_100060216 | 3300005563 | Bacteria | 4441 |
| 35 | Ga0068855_100142009 | 3300005563 | Bacteria | 2736 |
| 36 | Ga0070664_100004318 | 3300005564 | Bacteria | 11426 |
| 37 | Ga0068857_100002523 | 3300005577 | Bacteria | 14985 |
| 38 | Ga0068857_100043616 | 3300005577 | Bacteria | 3978 |
| 39 | Ga0068856_100000079 | 3300005614 | Bacteria | 92486 |
| 40 | Ga0068859_100000581 | 3300005617 | Bacteria | 36448 |
| 41 | Ga0068859_100020422 | 3300005617 | Bacteria | 6648 |
| 42 | Ga0068859_100022598 | 3300005617 | Bacteria | 6306 |
| 43 | Ga0068859_100022748 | 3300005617 | Bacteria | 6285 |
| 44 | Ga0068859_100080687 | 3300005617 | Bacteria | 3294 |
| 45 | Ga0068864_100155689 | 3300005618 | Bacteria | 2074 |
| 46 | Ga0068864_100249343 | 3300005618 | Bacteria | 1648 |
| 47 | Ga0068863_100002577 | 3300005841 | Bacteria | 17972 |
| 48 | Ga0068863_100047618 | 3300005841 | Bacteria | 4066 |
| 49 | Ga0068863_100189857 | 3300005841 | Bacteria | 1974 |
| 50 | Ga0068858_100019960 | 3300005842 | Bacteria | 6267 |
| 51 | Ga0068858_100249668 | 3300005842 | Bacteria | 1685 |
| 52 | Ga0068858_100357201 | 3300005842 | Bacteria | 1400 |
| 53 | Ga0068860_100001970 | 3300005843 | Bacteria | 21702 |
| 54 | Ga0068862_100218106 | 3300005844 | Bacteria | 1726 |
| 55 | Ga0081455_10199528 | 3300005937 | Bacteria | 1499 |
| 56 | Ga0097621_100011178 | 3300006237 | Bacteria | 6607 |
| 57 | Ga0097621_100053230 | 3300006237 | Bacteria | 3299 |
| 58 | Ga0068871_100004387 | 3300006358 | Bacteria | 9807 |
| 59 | Ga0068871_100169937 | 3300006358 | Bacteria | 1868 |
| 60 | Ga0075428_100020061 | 3300006844 | Bacteria | 7402 |
| 61 | Ga0075428_100032920 | 3300006844 | Bacteria | 5724 |
| 62 | Ga0075428_100548189 | 3300006844 | Bacteria | 1236 |
| 63 | Ga0075430_100056764 | 3300006846 | Bacteria | 3293 |
| 64 | Ga0075431_100008485 | 3300006847 | Bacteria | 10289 |
| 65 | Ga0075431_100314557 | 3300006847 | Bacteria | 1580 |
| 66 | Ga0075433_10014318 | 3300006852 | Bacteria | 6479 |
| 67 | Ga0075434_100023706 | 3300006871 | Bacteria | 5986 |
| 68 | Ga0097620_100000581 | 3300006931 | Bacteria | 36448 |
| 69 | Ga0097620_100020422 | 3300006931 | Bacteria | 6648 |
| 70 | Ga0097620_100022598 | 3300006931 | Bacteria | 6306 |
| 71 | Ga0097620_100022748 | 3300006931 | Bacteria | 6285 |
| 72 | Ga0097620_100080691 | 3300006931 | Bacteria | 3294 |
| 73 | Ga0105240_10002780 | 3300009093 | Bacteria | 27659 |
| 74 | Ga0105240_10062830 | 3300009093 | Bacteria | 4622 |
| 75 | Ga0105240_10120624 | 3300009093 | Bacteria | 3158 |
| 76 | Ga0105240_10177679 | 3300009093 | Bacteria | 2515 |
| 77 | Ga0111539_10011188 | 3300009094 | Bacteria | 11277 |
| 78 | Ga0111539_10023482 | 3300009094 | Bacteria | 7576 |
| 79 | Ga0105245_10157920 | 3300009098 | Bacteria | 2149 |
| 80 | Ga0114129_10000254 | 3300009147 | Bacteria | 60253 |
| 81 | Ga0105242_10040908 | 3300009176 | Bacteria | 3736 |
| 82 | Ga0105248_10000381 | 3300009177 | Bacteria | 51763 |
| 83 | Ga0105238_10095745 | 3300009551 | Bacteria | 2955 |
| 84 | Ga0157370_10110034 | 3300013104 | Bacteria | 2575 |
| 85 | Ga0157374_10017540 | 3300013296 | Bacteria | 6306 |
| 86 | Ga0157374_10057460 | 3300013296 | Bacteria | 3634 |
| 87 | Ga0163162_10012410 | 3300013306 | Bacteria | 8321 |
| 88 | Ga0157372_10215118 | 3300013307 | Bacteria | 2227 |
| 89 | Ga0157375_10000017 | 3300013308 | Bacteria | 286152 |
| 90 | Ga0157375_10000440 | 3300013308 | Bacteria | 37608 |
| 91 | Ga0163163_10000194 | 3300014325 | Bacteria | 62568 |
| 92 | Ga0163163_10015916 | 3300014325 | Bacteria | 6966 |
| 93 | Ga0163163_10044401 | 3300014325 | Bacteria | 4360 |
| 94 | Ga0157377_10085674 | 3300014745 | Bacteria | 1850 |
| 95 | Ga0157379_10000263 | 3300014968 | Bacteria | 41237 |
| 96 | Ga0157376_10044774 | 3300014969 | Bacteria | 3639 |
| 97 | Ga0163161_10068482 | 3300017792 | Bacteria | 2593 |
| 98 | Ga0207695_10022689 | 3300025913 | Bacteria | 7114 |
| 99 | Ga0207695_10045676 | 3300025913 | Bacteria | 4648 |
| 100 | Ga0207663_10001297 | 3300025916 | Bacteria | 11584 |
| 101 | Ga0207663_10154914 | 3300025916 | Bacteria | 1611 |
| 102 | Ga0207694_10100018 | 3300025924 | Bacteria | 2297 |
| 103 | Ga0207659_10000432 | 3300025926 | Bacteria | 25126 |
| 104 | Ga0207659_10004454 | 3300025926 | Bacteria | 8479 |
| 105 | Ga0207659_10009724 | 3300025926 | Bacteria | 6014 |
| 106 | Ga0207687_10136053 | 3300025927 | Bacteria | 1858 |
| 107 | Ga0207670_10005501 | 3300025936 | Bacteria | 6963 |
| 108 | Ga0207670_10068706 | 3300025936 | Bacteria | 2442 |
| 109 | Ga0207691_10061338 | 3300025940 | Bacteria | 3416 |
| 110 | Ga0207691_10263897 | 3300025940 | Bacteria | 1484 |
| 111 | Ga0207711_10004330 | 3300025941 | Bacteria | 12121 |
| 112 | Ga0207661_10200818 | 3300025944 | Bacteria | 1753 |
| 113 | Ga0207679_10026979 | 3300025945 | Bacteria | 3967 |
| 114 | Ga0207667_10075438 | 3300025949 | Bacteria | 3501 |
| 115 | Ga0207667_10178588 | 3300025949 | Bacteria | 2181 |
| 116 | Ga0207651_10019038 | 3300025960 | Bacteria | 4104 |
| 117 | Ga0207658_10045574 | 3300025986 | Bacteria | 3197 |
| 118 | Ga0207677_10139504 | 3300026023 | Bacteria | 1854 |
| 119 | Ga0207702_10000669 | 3300026078 | Bacteria | 37291 |
| 120 | Ga0207702_10002497 | 3300026078 | Bacteria | 17366 |
| 121 | Ga0207641_10001650 | 3300026088 | Bacteria | 21778 |
| 122 | Ga0207641_10019516 | 3300026088 | Bacteria | 5565 |
| 123 | Ga0207676_10155816 | 3300026095 | Bacteria | 1973 |
| 124 | Ga0207674_10015568 | 3300026116 | Bacteria | 8352 |
| 125 | Ga0207675_100077546 | 3300026118 | Bacteria | 3113 |
| 126 | Ga0268266_10309046 | 3300028379 | Bacteria | 1477 |
| 127 | Ga0268265_10168952 | 3300028380 | Bacteria | 1867 |
| 128 | Ga0268264_10069822 | 3300028381 | Bacteria | 2972 |
| 129 | Ga0265337_1000077 | 3300028556 | Bacteria | 46215 |
| 130 | Ga0265337_1025990 | 3300028556 | Bacteria | 1778 |
| 131 | Ga0265326_10010588 | 3300028558 | Bacteria | 2734 |
| 132 | Ga0265319_1000004 | 3300028563 | Bacteria | 305085 |
| 133 | Ga0265319_1013723 | 3300028563 | Bacteria | 3206 |
| 134 | Ga0265323_10000058 | 3300028653 | Bacteria | 61416 |
| 135 | Ga0265323_10045041 | 3300028653 | Bacteria | 1587 |
| 136 | Ga0265322_10022428 | 3300028654 | Bacteria | 1806 |
| 137 | Ga0265336_10001988 | 3300028666 | Bacteria | 8733 |
| 138 | Ga0265338_10000038 | 3300028800 | Bacteria | 237195 |
| 139 | Ga0265338_10000214 | 3300028800 | Bacteria | 106870 |
| 140 | Ga0265338_10000276 | 3300028800 | Bacteria | 93585 |
| 141 | Ga0265338_10000439 | 3300028800 | Bacteria | 74770 |
| 142 | Ga0265338_10000533 | 3300028800 | Bacteria | 66710 |
| 143 | Ga0265338_10000630 | 3300028800 | Bacteria | 61283 |
| 144 | Ga0265338_10000843 | 3300028800 | Bacteria | 51673 |
| 145 | Ga0265338_10001209 | 3300028800 | Bacteria | 42710 |
| 146 | Ga0265338_10003168 | 3300028800 | Bacteria | 23481 |
| 147 | Ga0265338_10004206 | 3300028800 | Bacteria | 19630 |
| 148 | Ga0265338_10004557 | 3300028800 | Bacteria | 18651 |
| 149 | Ga0265338_10005205 | 3300028800 | Bacteria | 17062 |
| 150 | Ga0265338_10005988 | 3300028800 | Bacteria | 15643 |
| 151 | Ga0265338_10007101 | 3300028800 | Bacteria | 14031 |
| 152 | Ga0265338_10010977 | 3300028800 | Bacteria | 10526 |
| 153 | Ga0265338_10042086 | 3300028800 | Bacteria | 4261 |
| 154 | Ga0265338_10049724 | 3300028800 | Bacteria | 3797 |
| 155 | Ga0265338_10069685 | 3300028800 | Bacteria | 3019 |
| 156 | Ga0265338_10157554 | 3300028800 | Bacteria | 1757 |
| 157 | Ga0265338_10163531 | 3300028800 | Bacteria | 1716 |
| 158 | Ga0265338_10263419 | 3300028800 | Bacteria | 1266 |
| 159 | Ga0265324_10000237 | 3300029957 | Bacteria | 41672 |
| 160 | Ga0265324_10000865 | 3300029957 | Bacteria | 19451 |
| 161 | Ga0265324_10018035 | 3300029957 | Bacteria | 2560 |
| 162 | Ga0265324_10019675 | 3300029957 | Bacteria | 2430 |
| 163 | Ga0265324_10027960 | 3300029957 | Bacteria | 1990 |
| 164 | Ga0265328_10011966 | 3300031239 | Bacteria | 3460 |
| 165 | Ga0265320_10000242 | 3300031240 | Bacteria | 45162 |
| 166 | Ga0265320_10000364 | 3300031240 | Bacteria | 36776 |
| 167 | Ga0265320_10025300 | 3300031240 | Bacteria | 3123 |
| 168 | Ga0265320_10058233 | 3300031240 | Bacteria | 1850 |
| 169 | Ga0265325_10007970 | 3300031241 | Bacteria | 6287 |
| 170 | Ga0265325_10013206 | 3300031241 | Bacteria | 4706 |
| 171 | Ga0265325_10057682 | 3300031241 | Bacteria | 1980 |
| 172 | Ga0265329_10000325 | 3300031242 | Bacteria | 25315 |
| 173 | Ga0265340_10000246 | 3300031247 | Bacteria | 28156 |
| 174 | Ga0265340_10044978 | 3300031247 | Bacteria | 2158 |
| 175 | Ga0265339_10013546 | 3300031249 | Bacteria | 4938 |
| 176 | Ga0265339_10019883 | 3300031249 | Bacteria | 3931 |
| 177 | Ga0265339_10029683 | 3300031249 | Bacteria | 3101 |
| 178 | Ga0265339_10067163 | 3300031249 | Bacteria | 1918 |
| 179 | Ga0265327_10001439 | 3300031251 | Bacteria | 30023 |
| 180 | Ga0265316_10001480 | 3300031344 | Bacteria | 25164 |
| 181 | Ga0265316_10005378 | 3300031344 | Bacteria | 12458 |
| 182 | Ga0265316_10007636 | 3300031344 | Bacteria | 10157 |
| 183 | Ga0265316_10021474 | 3300031344 | Bacteria | 5466 |
| 184 | Ga0265316_10047472 | 3300031344 | Bacteria | 3397 |
| 185 | Ga0265316_10069028 | 3300031344 | Bacteria | 2728 |
| 186 | Ga0265316_10127303 | 3300031344 | Bacteria | 1920 |
| 187 | Ga0265313_10004915 | 3300031595 | Bacteria | 10017 |
| 188 | Ga0265313_10013895 | 3300031595 | Bacteria | 4795 |
| 189 | Ga0265314_10000214 | 3300031711 | Bacteria | 85787 |
| 190 | Ga0265314_10061098 | 3300031711 | Bacteria | 2568 |
| 191 | Ga0265314_10123626 | 3300031711 | Bacteria | 1625 |
| 192 | Ga0316576_10174895 | 3300031727 | Bacteria | 1620 |
| 193 | Ga0373950_0001488 | 3300034818 | Bacteria | 3063 |
| 194 | Ga0373951_0008722 | 3300035091 | Bacteria | 2285 |
| 195 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 196 | Ga0373945_0005248 | 3300035116 | Bacteria | 4143 |
| 197 | Ga0373954_0001248 | 3300035118 | Bacteria | 10248 |
| 198 | Ga0373956_0020622 | 3300035119 | Bacteria | 2807 |
| 199 | Ga0373946_0023148 | 3300035171 | Bacteria | 2425 |
| 200 | Ga0373946_0043383 | 3300035171 | Bacteria | 1853 |
| 201 | Ga0373931_0000004 | 3300035691 | Bacteria | 535140 |
| 202 | Ga0373927_0057753 | 3300035695 | Bacteria | 2509 |
| 203 | Ga0373947_0061870 | 3300035725 | Bacteria | 2276 |
| 204 | Ga0373937_0001257 | 3300036401 | Bacteria | 21283 |
| 205 | Ga0373937_0239249 | 3300036401 | Bacteria | 1710 |
| 206 | Ga0373925_0001025 | 3300037068 | Bacteria | 25280 |
| 207 | Ga0373925_0009077 | 3300037068 | Bacteria | 7239 |
| 208 | Ga0373925_0019312 | 3300037068 | Bacteria | 4956 |
| 209 | Ga0395900_0441768 | 3300037418 | Bacteria | 1258 |
| 210 | Ga0395905_0011375 | 3300037471 | Bacteria | 8603 |
| 211 | Ga0451577_0001244 | 3300042876 | Bacteria | 35254 |
| 212 | Ga0451577_0001420 | 3300042876 | Bacteria | 31947 |
| 213 | Ga0451577_0004245 | 3300042876 | Bacteria | 15254 |
| 214 | Ga0451577_0014324 | 3300042876 | Bacteria | 7393 |
| 215 | Ga0451577_0045227 | 3300042876 | Bacteria | 3940 |
| 216 | Ga0451577_0120612 | 3300042876 | Bacteria | 2349 |
| 217 | Ga0453684_0005468 | 3300044712 | Bacteria | 25149 |
| 218 | Ga0453684_0022726 | 3300044712 | Bacteria | 9289 |
| 219 | Ga0453684_0079718 | 3300044712 | Bacteria | 4092 |
| 220 | Ga0451576_0029710 | 3300045051 | Bacteria | 5847 |
| 221 | Ga0451576_0030294 | 3300045051 | Bacteria | 5784 |
| 222 | Ga0451576_0036675 | 3300045051 | Bacteria | 5196 |
| 223 | Ga0451576_0058186 | 3300045051 | Bacteria | 4040 |
| 224 | Ga0451576_0064758 | 3300045051 | Bacteria | 3807 |
| 225 | Ga0451576_0068329 | 3300045051 | Bacteria | 3698 |
| 226 | Ga0451576_0071283 | 3300045051 | Bacteria | 3616 |
| 227 | Ga0451576_0082396 | 3300045051 | Bacteria | 3346 |
| 228 | Ga0451576_0138683 | 3300045051 | Bacteria | 2537 |
| 229 | Ga0451576_0161229 | 3300045051 | Bacteria | 2341 |
| 230 | Ga0451576_0297475 | 3300045051 | Bacteria | 1688 |
| 231 | Ga0495592_0000101 | 3300046454 | Bacteria | 75856 |
| 232 | Ga0495592_0173215 | 3300046454 | Bacteria | 1476 |
| 233 | Ga0495608_0052528 | 3300046511 | Bacteria | 2698 |
| 234 | Ga0495618_0001806 | 3300046514 | Bacteria | 14162 |
| 235 | Ga0495628_0001655 | 3300046516 | Bacteria | 20382 |
| 236 | Ga0495630_0000073 | 3300046517 | Bacteria | 79321 |
| 237 | Ga0495630_0036449 | 3300046517 | Bacteria | 3677 |
| 238 | Ga0495630_0174762 | 3300046517 | Bacteria | 1637 |
| 239 | Ga0495666_0001768 | 3300046526 | Bacteria | 10663 |
| 240 | Ga0495640_0015495 | 3300046533 | Bacteria | 5734 |
| 241 | Ga0495640_0029893 | 3300046533 | Bacteria | 3905 |
| 242 | Ga0495586_0000040 | 3300046535 | Bacteria | 79335 |
| 243 | Ga0495586_0000348 | 3300046535 | Bacteria | 29056 |
| 244 | Ga0495586_0000548 | 3300046535 | Bacteria | 21893 |
| 245 | Ga0495586_0004896 | 3300046535 | Bacteria | 7163 |
| 246 | Ga0495586_0032801 | 3300046535 | Bacteria | 2785 |
| 247 | Ga0495656_0076364 | 3300046615 | Bacteria | 1501 |
| 248 | Ga0495634_0000889 | 3300046642 | Bacteria | 28667 |
| 249 | Ga0495634_0008406 | 3300046642 | Bacteria | 7691 |
| 250 | Ga0495634_0031994 | 3300046642 | Bacteria | 3620 |
| 251 | Ga0495634_0166651 | 3300046642 | Bacteria | 1386 |
| 252 | Ga0495599_0012567 | 3300046678 | Bacteria | 5222 |
| 253 | Ga0495647_0031901 | 3300046681 | Bacteria | 1961 |
| 254 | Ga0495658_0004210 | 3300046683 | Bacteria | 7083 |
| 255 | Ga0495658_0028547 | 3300046683 | Bacteria | 3013 |
| 256 | Ga0495613_0008133 | 3300046689 | Bacteria | 7802 |
| 257 | Ga0495613_0076080 | 3300046689 | Bacteria | 2443 |
| 258 | Ga0495581_0095952 | 3300047315 | Bacteria | 1722 |
| 259 | Ga0495604_0106790 | 3300047317 | Bacteria | 2047 |
| 260 | Ga0495674_0002615 | 3300047319 | Bacteria | 17520 |
| 261 | Ga0495674_0006476 | 3300047319 | Bacteria | 11226 |
| 262 | Ga0495674_0110435 | 3300047319 | Bacteria | 2332 |
| 263 | Ga0495676_0006224 | 3300047321 | Bacteria | 10981 |
| 264 | Ga0495676_0123381 | 3300047321 | Bacteria | 1881 |
| 265 | Ga0495680_0042956 | 3300047322 | Bacteria | 3583 |
| 266 | Ga0495684_0106204 | 3300047471 | Bacteria | 2121 |
| 267 | Ga0501031_0000004 | 3300049568 | Bacteria | 202781 |
| 268 | Ga0501031_0018937 | 3300049568 | Bacteria | 4482 |
| 269 | Ga0501032_0005152 | 3300049569 | Bacteria | 9747 |
| 270 | Ga0501032_0052606 | 3300049569 | Bacteria | 2744 |
| 271 | Ga0501033_0011982 | 3300049570 | Bacteria | 6622 |
| 272 | Ga0501034_0085672 | 3300049571 | Bacteria | 3152 |
| 273 | Ga0501036_0117347 | 3300049572 | Bacteria | 2248 |
| 274 | Ga0501257_010413 | 3300049686 | Bacteria | 2110 |
| 275 | Ga0501080_0088193 | 3300049742 | Bacteria | 2882 |
| 276 | Ga0501035_0040887 | 3300049822 | Bacteria | 4187 |
| 277 | Ga0501035_0186142 | 3300049822 | Bacteria | 1787 |
| 278 | Ga0501044_0001072 | 3300049823 | Bacteria | 32802 |
| 279 | Ga0501044_0029088 | 3300049823 | Bacteria | 5827 |
| 280 | nmdc:mga05p37_2475_c1 | 3300050507 | Bacteria | 21484 |
| 281 | nmdc:mga06r32_312141_c1 | 3300050510 | Bacteria | 1558 |
| 282 | nmdc:mga08y16_13579_c1 | 3300050511 | Bacteria | 8572 |
| 283 | nmdc:mga08y16_98393_c1 | 3300050511 | Bacteria | 3046 |
| 284 | nmdc:mga0n895_10968_c1 | 3300050512 | Bacteria | 8053 |
| 285 | nmdc:mga0a205_41022_c1 | 3300050515 | Bacteria | 4457 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047321 | Ga0495676_0123381 | Ga0495676_0123381_838_1830 | 328 |
| 2 | 3300005549 | Ga0070704_100117070 | Ga0070704_1001170702 | 338 |
| 3 | 3300005617 | Ga0068859_100000581 | Ga0068859_10000058122 | 338 |
| 4 | 3300006931 | Ga0097620_100000581 | Ga0097620_10000058122 | 338 |
| 5 | 3300009094 | Ga0111539_10023482 | Ga0111539_100234824 | 338 |
| 6 | 3300025926 | Ga0207659_10009724 | Ga0207659_100097244 | 338 |
| 7 | 3300026118 | Ga0207675_100077546 | Ga0207675_1000775462 | 338 |
| 8 | 3300042876 | Ga0451577_0045227 | Ga0451577_0045227_1476_2627 | 342 |
| 9 | 3300044712 | Ga0453684_0005468 | Ga0453684_0005468_13619_14770 | 342 |
| 10 | 3300028653 | Ga0265323_10045041 | Ga0265323_100450412 | 351 |
| 11 | 3300013308 | Ga0157375_10000017 | Ga0157375_10000017166 | 353 |
| 12 | 3300014969 | Ga0157376_10044774 | Ga0157376_100447741 | 353 |
| 13 | 3300005548 | Ga0070665_100258107 | Ga0070665_1002581072 | 354 |
| 14 | 3300006844 | Ga0075428_100020061 | Ga0075428_1000200615 | 354 |
| 15 | 3300025926 | Ga0207659_10004454 | Ga0207659_100044542 | 354 |
| 16 | 3300028379 | Ga0268266_10309046 | Ga0268266_103090462 | 354 |
| 17 | 3300005329 | Ga0070683_100283051 | Ga0070683_1002830511 | 355 |
| 18 | 3300013296 | Ga0157374_10017540 | Ga0157374_100175404 | 355 |
| 19 | 3300036401 | Ga0373937_0239249 | Ga0373937_0239249_244_1392 | 355 |
| 20 | 3300045051 | Ga0451576_0082396 | Ga0451576_0082396_1542_2705 | 357 |
| 21 | 3300005365 | Ga0070688_100042696 | Ga0070688_1000426962 | 361 |
| 22 | 3300005617 | Ga0068859_100020422 | Ga0068859_1000204225 | 361 |
| 23 | 3300006931 | Ga0097620_100020422 | Ga0097620_1000204223 | 361 |
| 24 | 3300025936 | Ga0207670_10005501 | Ga0207670_100055012 | 361 |
| 25 | 3300026088 | Ga0207641_10019516 | Ga0207641_100195163 | 361 |
| 26 | 3300005330 | Ga0070690_100051168 | Ga0070690_1000511682 | 362 |
| 27 | 3300005340 | Ga0070689_100050058 | Ga0070689_1000500582 | 362 |
| 28 | 3300005354 | Ga0070675_100000804 | Ga0070675_10000080416 | 362 |
| 29 | 3300005354 | Ga0070675_100101707 | Ga0070675_1001017072 | 362 |
| 30 | 3300005364 | Ga0070673_100068122 | Ga0070673_1000681222 | 362 |
| 31 | 3300005367 | Ga0070667_100061131 | Ga0070667_1000611312 | 362 |
| 32 | 3300005543 | Ga0070672_100103891 | Ga0070672_1001038912 | 362 |
| 33 | 3300005564 | Ga0070664_100004318 | Ga0070664_1000043188 | 362 |
| 34 | 3300005617 | Ga0068859_100022748 | Ga0068859_1000227484 | 362 |
| 35 | 3300005618 | Ga0068864_100155689 | Ga0068864_1001556892 | 362 |
| 36 | 3300005841 | Ga0068863_100002577 | Ga0068863_1000025777 | 362 |
| 37 | 3300005842 | Ga0068858_100019960 | Ga0068858_1000199602 | 362 |
| 38 | 3300005843 | Ga0068860_100001970 | Ga0068860_10000197012 | 362 |
| 39 | 3300006237 | Ga0097621_100011178 | Ga0097621_1000111782 | 362 |
| 40 | 3300006358 | Ga0068871_100004387 | Ga0068871_1000043873 | 362 |
| 41 | 3300006844 | Ga0075428_100032920 | Ga0075428_1000329202 | 362 |
| 42 | 3300006852 | Ga0075433_10014318 | Ga0075433_100143186 | 362 |
| 43 | 3300006871 | Ga0075434_100023706 | Ga0075434_1000237062 | 362 |
| 44 | 3300006931 | Ga0097620_100022748 | Ga0097620_1000227484 | 362 |
| 45 | 3300009094 | Ga0111539_10011188 | Ga0111539_100111888 | 362 |
| 46 | 3300009147 | Ga0114129_10000254 | Ga0114129_1000025437 | 362 |
| 47 | 3300009177 | Ga0105248_10000381 | Ga0105248_1000038140 | 362 |
| 48 | 3300013296 | Ga0157374_10057460 | Ga0157374_100574601 | 362 |
| 49 | 3300013306 | Ga0163162_10012410 | Ga0163162_100124107 | 362 |
| 50 | 3300013308 | Ga0157375_10000440 | Ga0157375_100004408 | 362 |
| 51 | 3300014325 | Ga0163163_10044401 | Ga0163163_100444013 | 362 |
| 52 | 3300014745 | Ga0157377_10085674 | Ga0157377_100856742 | 362 |
| 53 | 3300014968 | Ga0157379_10000263 | Ga0157379_1000026310 | 362 |
| 54 | 3300017792 | Ga0163161_10068482 | Ga0163161_100684822 | 362 |
| 55 | 3300025926 | Ga0207659_10000432 | Ga0207659_1000043220 | 362 |
| 56 | 3300025940 | Ga0207691_10061338 | Ga0207691_100613383 | 362 |
| 57 | 3300025940 | Ga0207691_10263897 | Ga0207691_102638972 | 362 |
| 58 | 3300025941 | Ga0207711_10004330 | Ga0207711_100043309 | 362 |
| 59 | 3300025945 | Ga0207679_10026979 | Ga0207679_100269792 | 362 |
| 60 | 3300025960 | Ga0207651_10019038 | Ga0207651_100190382 | 362 |
| 61 | 3300025986 | Ga0207658_10045574 | Ga0207658_100455742 | 362 |
| 62 | 3300026088 | Ga0207641_10001650 | Ga0207641_100016509 | 362 |
| 63 | 3300026095 | Ga0207676_10155816 | Ga0207676_101558161 | 362 |
| 64 | 3300028381 | Ga0268264_10069822 | Ga0268264_100698222 | 362 |
| 65 | 3300037418 | Ga0395900_0441768 | Ga0395900_0441768_29_1147 | 362 |
| 66 | 3300050507 | nmdc:mga05p37_2475_c1 | nmdc:mga05p37_2475_c1_7647_8795 | 362 |
| 67 | 3300050511 | nmdc:mga08y16_13579_c1 | nmdc:mga08y16_13579_c1_3121_4269 | 362 |
| 68 | 3300050512 | nmdc:mga0n895_10968_c1 | nmdc:mga0n895_10968_c1_5588_6736 | 362 |
| 69 | 3300050515 | nmdc:mga0a205_41022_c1 | nmdc:mga0a205_41022_c1_2437_3585 | 362 |
| 70 | 3300005330 | Ga0070690_100010019 | Ga0070690_1000100192 | 365 |
| 71 | 3300005343 | Ga0070687_100051876 | Ga0070687_1000518762 | 365 |
| 72 | 3300005438 | Ga0070701_10006647 | Ga0070701_100066472 | 365 |
| 73 | 3300005440 | Ga0070705_100026546 | Ga0070705_1000265462 | 365 |
| 74 | 3300005444 | Ga0070694_100017293 | Ga0070694_1000172933 | 365 |
| 75 | 3300005544 | Ga0070686_100013974 | Ga0070686_1000139742 | 365 |
| 76 | 3300005549 | Ga0070704_100026079 | Ga0070704_1000260792 | 365 |
| 77 | 3300045051 | Ga0451576_0138683 | Ga0451576_0138683_472_1632 | 365 |
| 78 | 3300005544 | Ga0070686_100024588 | Ga0070686_1000245882 | 366 |
| 79 | 3300035119 | Ga0373956_0020622 | Ga0373956_0020622_399_1586 | 366 |
| 80 | 3300042876 | Ga0451577_0001244 | Ga0451577_0001244_20721_21869 | 366 |
| 81 | 3300045051 | Ga0451576_0064758 | Ga0451576_0064758_2026_3174 | 366 |
| 82 | 3300046454 | Ga0495592_0173215 | Ga0495592_0173215_222_1409 | 367 |
| 83 | 3300046517 | Ga0495630_0174762 | Ga0495630_0174762_66_1253 | 367 |
| 84 | 3300046642 | Ga0495634_0031994 | Ga0495634_0031994_2203_3390 | 367 |
| 85 | 3300028800 | Ga0265338_10001209 | Ga0265338_1000120920 | 369 |
| 86 | 3300046535 | Ga0495586_0004896 | Ga0495586_0004896_3838_4956 | 370 |
| 87 | 3300046642 | Ga0495634_0166651 | Ga0495634_0166651_190_1308 | 370 |
| 88 | 3300046681 | Ga0495647_0031901 | Ga0495647_0031901_814_1932 | 370 |
| 89 | 3300046683 | Ga0495658_0028547 | Ga0495658_0028547_1874_2992 | 370 |
| 90 | 3300046689 | Ga0495613_0076080 | Ga0495613_0076080_925_2043 | 370 |
| 91 | 3300031249 | Ga0265339_10067163 | Ga0265339_100671632 | 371 |
| 92 | 3300028800 | Ga0265338_10163531 | Ga0265338_101635312 | 375 |
| 93 | 3300031711 | Ga0265314_10123626 | Ga0265314_101236262 | 375 |
| 94 | 3300042876 | Ga0451577_0001420 | Ga0451577_0001420_22633_23781 | 375 |
| 95 | 3300044712 | Ga0453684_0079718 | Ga0453684_0079718_2657_3805 | 375 |
| 96 | 3300006846 | Ga0075430_100056764 | Ga0075430_1000567643 | 378 |
| 97 | 3300006847 | Ga0075431_100008485 | Ga0075431_10000848511 | 378 |
| 98 | 3300037471 | Ga0395905_0011375 | Ga0395905_0011375_4079_5227 | 378 |
| 99 | 3300042876 | Ga0451577_0120612 | Ga0451577_0120612_185_1333 | 378 |
| 100 | 3300005330 | Ga0070690_100013712 | Ga0070690_1000137124 | 379 |
| 101 | 3300005544 | Ga0070686_100163504 | Ga0070686_1001635041 | 379 |
| 102 | 3300005563 | Ga0068855_100021430 | Ga0068855_1000214305 | 379 |
| 103 | 3300005563 | Ga0068855_100060216 | Ga0068855_1000602163 | 379 |
| 104 | 3300005614 | Ga0068856_100000079 | Ga0068856_10000007966 | 379 |
| 105 | 3300005617 | Ga0068859_100022598 | Ga0068859_1000225982 | 379 |
| 106 | 3300005842 | Ga0068858_100249668 | Ga0068858_1002496682 | 379 |
| 107 | 3300006931 | Ga0097620_100022598 | Ga0097620_1000225982 | 379 |
| 108 | 3300025949 | Ga0207667_10075438 | Ga0207667_100754383 | 379 |
| 109 | 3300026078 | Ga0207702_10000669 | Ga0207702_1000066928 | 379 |
| 110 | 3300026078 | Ga0207702_10002497 | Ga0207702_1000249713 | 379 |
| 111 | 3300028556 | Ga0265337_1000077 | Ga0265337_100007720 | 379 |
| 112 | 3300028556 | Ga0265337_1025990 | Ga0265337_10259902 | 379 |
| 113 | 3300028558 | Ga0265326_10010588 | Ga0265326_100105883 | 379 |
| 114 | 3300028563 | Ga0265319_1013723 | Ga0265319_10137232 | 379 |
| 115 | 3300028653 | Ga0265323_10000058 | Ga0265323_1000005812 | 379 |
| 116 | 3300028654 | Ga0265322_10022428 | Ga0265322_100224282 | 379 |
| 117 | 3300028666 | Ga0265336_10001988 | Ga0265336_100019885 | 379 |
| 118 | 3300028800 | Ga0265338_10000214 | Ga0265338_1000021454 | 379 |
| 119 | 3300028800 | Ga0265338_10000276 | Ga0265338_1000027656 | 379 |
| 120 | 3300028800 | Ga0265338_10000439 | Ga0265338_1000043956 | 379 |
| 121 | 3300028800 | Ga0265338_10000533 | Ga0265338_1000053335 | 379 |
| 122 | 3300028800 | Ga0265338_10000843 | Ga0265338_1000084319 | 379 |
| 123 | 3300028800 | Ga0265338_10004557 | Ga0265338_100045576 | 379 |
| 124 | 3300028800 | Ga0265338_10005205 | Ga0265338_1000520510 | 379 |
| 125 | 3300028800 | Ga0265338_10005988 | Ga0265338_1000598817 | 379 |
| 126 | 3300028800 | Ga0265338_10007101 | Ga0265338_100071015 | 379 |
| 127 | 3300029957 | Ga0265324_10000237 | Ga0265324_1000023721 | 379 |
| 128 | 3300031240 | Ga0265320_10000242 | Ga0265320_1000024234 | 379 |
| 129 | 3300031240 | Ga0265320_10000364 | Ga0265320_1000036428 | 379 |
| 130 | 3300031240 | Ga0265320_10058233 | Ga0265320_100582332 | 379 |
| 131 | 3300031241 | Ga0265325_10007970 | Ga0265325_100079705 | 379 |
| 132 | 3300031241 | Ga0265325_10013206 | Ga0265325_100132064 | 379 |
| 133 | 3300031247 | Ga0265340_10000246 | Ga0265340_100002469 | 379 |
| 134 | 3300031249 | Ga0265339_10013546 | Ga0265339_100135463 | 379 |
| 135 | 3300031249 | Ga0265339_10029683 | Ga0265339_100296834 | 379 |
| 136 | 3300031344 | Ga0265316_10001480 | Ga0265316_1000148013 | 379 |
| 137 | 3300031344 | Ga0265316_10005378 | Ga0265316_100053783 | 379 |
| 138 | 3300031344 | Ga0265316_10007636 | Ga0265316_100076369 | 379 |
| 139 | 3300031344 | Ga0265316_10021474 | Ga0265316_100214744 | 379 |
| 140 | 3300031344 | Ga0265316_10047472 | Ga0265316_100474723 | 379 |
| 141 | 3300031344 | Ga0265316_10069028 | Ga0265316_100690283 | 379 |
| 142 | 3300031595 | Ga0265313_10013895 | Ga0265313_100138954 | 379 |
| 143 | 3300031711 | Ga0265314_10061098 | Ga0265314_100610982 | 379 |
| 144 | 3300035118 | Ga0373954_0001248 | Ga0373954_0001248_1104_2252 | 379 |
| 145 | 3300036401 | Ga0373937_0001257 | Ga0373937_0001257_19163_20311 | 379 |
| 146 | 3300045051 | Ga0451576_0297475 | Ga0451576_0297475_362_1507 | 379 |
| 147 | 3300046535 | Ga0495586_0000548 | Ga0495586_0000548_5140_6288 | 379 |
| 148 | 3300046642 | Ga0495634_0000889 | Ga0495634_0000889_23642_24790 | 379 |
| 149 | 3300047319 | Ga0495674_0110435 | Ga0495674_0110435_805_1953 | 379 |
| 150 | 3300047322 | Ga0495680_0042956 | Ga0495680_0042956_689_1837 | 379 |
| 151 | 3300047471 | Ga0495684_0106204 | Ga0495684_0106204_733_1881 | 379 |
| 152 | 3300005338 | Ga0068868_100062267 | Ga0068868_1000622672 | 380 |
| 153 | 3300005340 | Ga0070689_100221501 | Ga0070689_1002215012 | 380 |
| 154 | 3300005354 | Ga0070675_100191505 | Ga0070675_1001915052 | 380 |
| 155 | 3300005439 | Ga0070711_100184271 | Ga0070711_1001842712 | 380 |
| 156 | 3300005545 | Ga0070695_100183540 | Ga0070695_1001835402 | 380 |
| 157 | 3300005577 | Ga0068857_100002523 | Ga0068857_1000025233 | 380 |
| 158 | 3300005577 | Ga0068857_100043616 | Ga0068857_1000436162 | 380 |
| 159 | 3300005617 | Ga0068859_100080687 | Ga0068859_1000806872 | 380 |
| 160 | 3300005618 | Ga0068864_100249343 | Ga0068864_1002493433 | 380 |
| 161 | 3300005841 | Ga0068863_100047618 | Ga0068863_1000476185 | 380 |
| 162 | 3300005842 | Ga0068858_100357201 | Ga0068858_1003572012 | 380 |
| 163 | 3300006237 | Ga0097621_100053230 | Ga0097621_1000532302 | 380 |
| 164 | 3300006358 | Ga0068871_100169937 | Ga0068871_1001699372 | 380 |
| 165 | 3300006844 | Ga0075428_100548189 | Ga0075428_1005481891 | 380 |
| 166 | 3300006847 | Ga0075431_100314557 | Ga0075431_1003145572 | 380 |
| 167 | 3300006931 | Ga0097620_100080691 | Ga0097620_1000806913 | 380 |
| 168 | 3300009093 | Ga0105240_10002780 | Ga0105240_1000278011 | 380 |
| 169 | 3300009093 | Ga0105240_10062830 | Ga0105240_100628304 | 380 |
| 170 | 3300009098 | Ga0105245_10157920 | Ga0105245_101579202 | 380 |
| 171 | 3300009176 | Ga0105242_10040908 | Ga0105242_100409082 | 380 |
| 172 | 3300014325 | Ga0163163_10000194 | Ga0163163_1000019412 | 380 |
| 173 | 3300014325 | Ga0163163_10015916 | Ga0163163_100159167 | 380 |
| 174 | 3300025913 | Ga0207695_10022689 | Ga0207695_100226896 | 380 |
| 175 | 3300025913 | Ga0207695_10045676 | Ga0207695_100456764 | 380 |
| 176 | 3300025916 | Ga0207663_10154914 | Ga0207663_101549141 | 380 |
| 177 | 3300025927 | Ga0207687_10136053 | Ga0207687_101360532 | 380 |
| 178 | 3300026023 | Ga0207677_10139504 | Ga0207677_101395042 | 380 |
| 179 | 3300026116 | Ga0207674_10015568 | Ga0207674_100155683 | 380 |
| 180 | 3300028380 | Ga0268265_10168952 | Ga0268265_101689523 | 380 |
| 181 | 3300031239 | Ga0265328_10011966 | Ga0265328_100119662 | 380 |
| 182 | 3300031241 | Ga0265325_10057682 | Ga0265325_100576822 | 380 |
| 183 | 3300031242 | Ga0265329_10000325 | Ga0265329_100003256 | 380 |
| 184 | 3300031344 | Ga0265316_10127303 | Ga0265316_101273032 | 380 |
| 185 | 3300031711 | Ga0265314_10000214 | Ga0265314_1000021429 | 380 |
| 186 | 3300031727 | Ga0316576_10174895 | Ga0316576_101748952 | 380 |
| 187 | 3300035171 | Ga0373946_0023148 | Ga0373946_0023148_541_1689 | 380 |
| 188 | 3300035695 | Ga0373927_0057753 | Ga0373927_0057753_1218_2366 | 380 |
| 189 | 3300035725 | Ga0373947_0061870 | Ga0373947_0061870_1110_2258 | 380 |
| 190 | 3300037068 | Ga0373925_0009077 | Ga0373925_0009077_3743_4891 | 380 |
| 191 | 3300042876 | Ga0451577_0004245 | Ga0451577_0004245_9013_10167 | 380 |
| 192 | 3300042876 | Ga0451577_0014324 | Ga0451577_0014324_67_1215 | 380 |
| 193 | 3300044712 | Ga0453684_0022726 | Ga0453684_0022726_7794_8942 | 380 |
| 194 | 3300045051 | Ga0451576_0030294 | Ga0451576_0030294_2719_3867 | 380 |
| 195 | 3300045051 | Ga0451576_0058186 | Ga0451576_0058186_712_1860 | 380 |
| 196 | 3300045051 | Ga0451576_0068329 | Ga0451576_0068329_236_1384 | 380 |
| 197 | 3300045051 | Ga0451576_0071283 | Ga0451576_0071283_1268_2416 | 380 |
| 198 | 3300045051 | Ga0451576_0161229 | Ga0451576_0161229_126_1280 | 380 |
| 199 | 3300046454 | Ga0495592_0000101 | Ga0495592_0000101_66347_67495 | 380 |
| 200 | 3300046514 | Ga0495618_0001806 | Ga0495618_0001806_8232_9380 | 380 |
| 201 | 3300046516 | Ga0495628_0001655 | Ga0495628_0001655_7980_9128 | 380 |
| 202 | 3300046517 | Ga0495630_0036449 | Ga0495630_0036449_1017_2165 | 380 |
| 203 | 3300046533 | Ga0495640_0015495 | Ga0495640_0015495_3151_4299 | 380 |
| 204 | 3300046535 | Ga0495586_0000348 | Ga0495586_0000348_9791_10939 | 380 |
| 205 | 3300046678 | Ga0495599_0012567 | Ga0495599_0012567_3392_4540 | 380 |
| 206 | 3300047317 | Ga0495604_0106790 | Ga0495604_0106790_492_1640 | 380 |
| 207 | 3300047319 | Ga0495674_0006476 | Ga0495674_0006476_2226_3374 | 380 |
| 208 | 3300049571 | Ga0501034_0085672 | Ga0501034_0085672_1757_2905 | 380 |
| 209 | 3300049572 | Ga0501036_0117347 | Ga0501036_0117347_73_1221 | 380 |
| 210 | 3300049686 | Ga0501257_010413 | Ga0501257_010413_115_1263 | 380 |
| 211 | 3300050510 | nmdc:mga06r32_312141_c1 | nmdc:mga06r32_312141_c1_298_1455 | 380 |
| 212 | 3300050511 | nmdc:mga08y16_98393_c1 | nmdc:mga08y16_98393_c1_1543_2691 | 380 |
| 213 | 3300046683 | Ga0495658_0004210 | Ga0495658_0004210_4553_5713 | 382 |
| 214 | 3300028800 | Ga0265338_10042086 | Ga0265338_100420862 | 384 |
| 215 | 3300045051 | Ga0451576_0029710 | Ga0451576_0029710_602_1759 | 384 |
| 216 | 3300028800 | Ga0265338_10069685 | Ga0265338_100696854 | 386 |
| 217 | 3300031240 | Ga0265320_10025300 | Ga0265320_100253002 | 386 |
| 218 | 3300045051 | Ga0451576_0036675 | Ga0451576_0036675_1486_2673 | 386 |
| 219 | 3300046511 | Ga0495608_0052528 | Ga0495608_0052528_1347_2543 | 386 |
| 220 | 3300046535 | Ga0495586_0032801 | Ga0495586_0032801_299_1495 | 386 |
| 221 | 3300028800 | Ga0265338_10000038 | Ga0265338_10000038191 | 388 |
| 222 | 3300031249 | Ga0265339_10019883 | Ga0265339_100198833 | 388 |
| 223 | 3300034818 | Ga0373950_0001488 | Ga0373950_0001488_1611_2795 | 390 |
| 224 | 3300035091 | Ga0373951_0008722 | Ga0373951_0008722_434_1618 | 390 |
| 225 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_242153_243337 | 390 |
| 226 | 3300035116 | Ga0373945_0005248 | Ga0373945_0005248_416_1600 | 390 |
| 227 | 3300035171 | Ga0373946_0043383 | Ga0373946_0043383_38_1222 | 390 |
| 228 | 3300035691 | Ga0373931_0000004 | Ga0373931_0000004_242162_243346 | 390 |
| 229 | 3300037068 | Ga0373925_0001025 | Ga0373925_0001025_8940_10124 | 390 |
| 230 | 3300028800 | Ga0265338_10003168 | Ga0265338_1000316819 | 391 |
| 231 | 3300029957 | Ga0265324_10000865 | Ga0265324_100008654 | 391 |
| 232 | 3300037068 | Ga0373925_0019312 | Ga0373925_0019312_2990_4180 | 392 |
| 233 | 3300046517 | Ga0495630_0000073 | Ga0495630_0000073_14171_15355 | 392 |
| 234 | 3300046526 | Ga0495666_0001768 | Ga0495666_0001768_5489_6673 | 392 |
| 235 | 3300046533 | Ga0495640_0029893 | Ga0495640_0029893_1376_2560 | 392 |
| 236 | 3300046535 | Ga0495586_0000040 | Ga0495586_0000040_14171_15355 | 392 |
| 237 | 3300046642 | Ga0495634_0008406 | Ga0495634_0008406_2504_3688 | 392 |
| 238 | 3300046689 | Ga0495613_0008133 | Ga0495613_0008133_5646_6830 | 392 |
| 239 | 3300047315 | Ga0495581_0095952 | Ga0495581_0095952_435_1619 | 392 |
| 240 | 3300047319 | Ga0495674_0002615 | Ga0495674_0002615_14093_15277 | 392 |
| 241 | 3300047321 | Ga0495676_0006224 | Ga0495676_0006224_921_2105 | 392 |
| 242 | 3300003320 | rootH2_10035288 | rootH2_100352882 | 393 |
| 243 | 3300005340 | Ga0070689_100114883 | Ga0070689_1001148832 | 393 |
| 244 | 3300005341 | Ga0070691_10013697 | Ga0070691_100136972 | 393 |
| 245 | 3300005439 | Ga0070711_100002309 | Ga0070711_1000023094 | 393 |
| 246 | 3300005466 | Ga0070685_10014966 | Ga0070685_100149663 | 393 |
| 247 | 3300005544 | Ga0070686_100155058 | Ga0070686_1001550581 | 393 |
| 248 | 3300005563 | Ga0068855_100142009 | Ga0068855_1001420093 | 393 |
| 249 | 3300005841 | Ga0068863_100189857 | Ga0068863_1001898572 | 393 |
| 250 | 3300005844 | Ga0068862_100218106 | Ga0068862_1002181061 | 393 |
| 251 | 3300005937 | Ga0081455_10199528 | Ga0081455_101995281 | 393 |
| 252 | 3300009093 | Ga0105240_10120624 | Ga0105240_101206244 | 393 |
| 253 | 3300009093 | Ga0105240_10177679 | Ga0105240_101776791 | 393 |
| 254 | 3300009551 | Ga0105238_10095745 | Ga0105238_100957454 | 393 |
| 255 | 3300013104 | Ga0157370_10110034 | Ga0157370_101100342 | 393 |
| 256 | 3300013307 | Ga0157372_10215118 | Ga0157372_102151182 | 393 |
| 257 | 3300025916 | Ga0207663_10001297 | Ga0207663_1000129710 | 393 |
| 258 | 3300025924 | Ga0207694_10100018 | Ga0207694_101000181 | 393 |
| 259 | 3300025936 | Ga0207670_10068706 | Ga0207670_100687062 | 393 |
| 260 | 3300025944 | Ga0207661_10200818 | Ga0207661_102008182 | 393 |
| 261 | 3300025949 | Ga0207667_10178588 | Ga0207667_101785882 | 393 |
| 262 | 3300028563 | Ga0265319_1000004 | Ga0265319_100000491 | 393 |
| 263 | 3300028800 | Ga0265338_10000630 | Ga0265338_1000063057 | 393 |
| 264 | 3300028800 | Ga0265338_10004206 | Ga0265338_100042067 | 393 |
| 265 | 3300028800 | Ga0265338_10010977 | Ga0265338_100109773 | 393 |
| 266 | 3300028800 | Ga0265338_10049724 | Ga0265338_100497243 | 393 |
| 267 | 3300028800 | Ga0265338_10157554 | Ga0265338_101575542 | 393 |
| 268 | 3300028800 | Ga0265338_10263419 | Ga0265338_102634191 | 393 |
| 269 | 3300029957 | Ga0265324_10018035 | Ga0265324_100180352 | 393 |
| 270 | 3300029957 | Ga0265324_10019675 | Ga0265324_100196752 | 393 |
| 271 | 3300029957 | Ga0265324_10027960 | Ga0265324_100279602 | 393 |
| 272 | 3300031247 | Ga0265340_10044978 | Ga0265340_100449782 | 393 |
| 273 | 3300031251 | Ga0265327_10001439 | Ga0265327_1000143913 | 393 |
| 274 | 3300031595 | Ga0265313_10004915 | Ga0265313_100049154 | 393 |
| 275 | 3300046615 | Ga0495656_0076364 | Ga0495656_0076364_125_1309 | 393 |
| 276 | 3300049568 | Ga0501031_0000004 | Ga0501031_0000004_135378_136562 | 393 |
| 277 | 3300049568 | Ga0501031_0018937 | Ga0501031_0018937_1491_2675 | 393 |
| 278 | 3300049569 | Ga0501032_0005152 | Ga0501032_0005152_334_1518 | 393 |
| 279 | 3300049569 | Ga0501032_0052606 | Ga0501032_0052606_683_1867 | 393 |
| 280 | 3300049570 | Ga0501033_0011982 | Ga0501033_0011982_1696_2880 | 393 |
| 281 | 3300049742 | Ga0501080_0088193 | Ga0501080_0088193_780_1961 | 393 |
| 282 | 3300049822 | Ga0501035_0040887 | Ga0501035_0040887_116_1300 | 393 |
| 283 | 3300049822 | Ga0501035_0186142 | Ga0501035_0186142_327_1511 | 393 |
| 284 | 3300049823 | Ga0501044_0001072 | Ga0501044_0001072_1515_2699 | 393 |
| 285 | 3300049823 | Ga0501044_0029088 | Ga0501044_0029088_4436_5620 | 393 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cxr-assembly4.cif.gz_D | crystal structure of mray bound to a sphaerimicin analogue | 0.9595 | 33 | 391 |
| 6oyz-assembly1.cif.gz_A | crystal structure of mray bound to capuramycin | 0.955 | 34 | 391 |
| 6oz6-assembly4.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9546 | 34 | 391 |
| 6oyh-assembly2.cif.gz_C | crystal structure of mray bound to carbacaprazamycin | 0.9544 | 34 | 391 |
| 6oyh-assembly3.cif.gz_B | crystal structure of mray bound to carbacaprazamycin | 0.9536 | 34 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6SP54_8_261_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2964 | 204 | 393 | 1.20.1250.20 |
| af_Q55EC8_162_384_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.286 | 205 | 391 | 1.20.1250.20 |
| af_A0A1D8PJN2_21_242_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2858 | 118 | 388 | 1.20.1250.20 |
| af_P9WG91_8_214_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.275 | 204 | 387 | 1.20.1250.20 |
| af_O01840_1_384_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2699 | 201 | 387 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382HE65-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase | 0.9873 | 205 | 393 |
GO:0005886
GO:0008963 GO:0044038 GO:0071555 |
| AF-A0A661TJ11-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9841 | 227 | 393 |
GO:0005886
GO:0008963 GO:0009252 GO:0046872 GO:0051992 GO:0071555 |
| AF-A0A536UQL1-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9811 | 236 | 393 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |
| AF-A0A7C7VBU3-F1-model_v4 | deleted | 0.9787 | 204 | 393 |
|
| AF-A0A3C0DUC1-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9781 | 200 | 337 |
GO:0005886
GO:0008963 GO:0044038 GO:0046872 GO:0051992 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar