F386512

General Info

Members Datasets Scaffolds Average Seq Length
284 206 568 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006427114
Length 274
Sequence VRRGAATVRTLGRMSGGGEGRGRQPLVAVFSGAGISTDSGIPDYRGPAGLWRRDPEAQKLVTYGYYMGDPEIRRRSWQMRRKNRTLHAEPNAAHRAVAGLERAGVPVRVITQNVDGLHQRAGMPERKVLELHGSARSVVCTGCGDRGPMRDTLARVEAGEEDPPCRQCGGILKSATVMFGESLDTAVLSEALAIAKACEVFVAVGTSLQVQPAAGLAGIAADHGARLIIVNAEPTPYDALADEIVREPIGTALPELLRRLGGAAGGGPAPDGRG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
43 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
46 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
49 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
52 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
53 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
54 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
55 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
56 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
79 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
83 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
155 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
156 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
161 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
162 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
163 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
164 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
165 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
166 2643221647 Streptomyces sp. Root369 Isolate Unclassified
167 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
168 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
169 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
170 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
171 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
172 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
173 2808606448 Streptomyces sp. 193411 Isolate Unclassified
174 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
175 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
176 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
177 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
178 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
179 2862574272 Streptomyces sp. AcE210 Isolate Nodule
180 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
181 2867428634 Streptomyces sp. RP5T Isolate Unclassified
182 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
183 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
184 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
185 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
186 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
187 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
188 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
189 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
190 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
191 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
192 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
193 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
194 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
195 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
196 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
197 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
198 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
199 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
200 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
201 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
202 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
203 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
204 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
205 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
206 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.75
Metatranscriptomes 0.7
Isolates 16.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 1.06
Rhizoplane 0.35
Rhizosphere 78.17
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10028553 3300003215 Bacteria 1931
2 rootH1_10049217 3300003316 Bacteria 4226
3 JGI25160J50197_1008650 3300003354 Bacteria 3859
4 Ga0006562J51391_1054169 3300003578 Bacteria 5218
5 Ga0006562J51391_1054170 3300003578 Bacteria 2530
6 Ga0070658_10400929 3300005327 Bacteria 1178
7 Ga0070683_100035723 3300005329 Bacteria 4543
8 Ga0070680_100002178 3300005336 Bacteria 14445
9 Ga0070669_100461702 3300005353 Bacteria 1048
10 Ga0070708_100002228 3300005445 Bacteria 14985
11 Ga0070681_10000019 3300005458 Bacteria 124774
12 Ga0070679_100000124 3300005530 Bacteria 61752
13 Ga0070684_100021483 3300005535 Bacteria 5373
14 Ga0068853_100627013 3300005539 Bacteria 1022
15 Ga0068856_100442791 3300005614 Bacteria 1320
16 Ga0068852_100139381 3300005616 Unclassified 2243
17 Ga0075365_10034488 3300006038 Bacteria 3268
18 Ga0075428_100002565 3300006844 Bacteria 19724
19 Ga0075434_100067820 3300006871 Unclassified 3553
20 Ga0105251_10074789 3300009011 Bacteria 1573
21 Ga0111539_10013776 3300009094 Bacteria 10101
22 Ga0105238_10296615 3300009551 Bacteria 1600
23 Ga0157372_10620008 3300013307 Bacteria 1261
24 Ga0182008_10004451 3300014497 Bacteria 8191
25 Ga0182007_10000483 3300015262 Bacteria 23980
26 Ga0183367_1001 3300015688 Bacteria 1225545
27 Ga0209758_1003365 3300025297 Bacteria 14652
28 Ga0207426_1001041 3300025302 Bacteria 26411
29 Ga0207426_1006064 3300025302 Bacteria 5337
30 Ga0207426_1009317 3300025302 Bacteria 3895
31 Ga0207713_1057436 3300025735 Bacteria 1504
32 Ga0207707_10000046 3300025912 Bacteria 119404
33 Ga0207660_10001766 3300025917 Bacteria 14459
34 Ga0207652_10000476 3300025921 Bacteria 41111
35 Ga0207661_10106209 3300025944 Bacteria 2367
36 Ga0207639_10584089 3300026041 Bacteria 1029
37 Ga0307517_10015711 3300028786 Bacteria 10030
38 Ga0307515_10000055 3300028794 Bacteria 264365
39 Ga0307515_10059058 3300028794 Bacteria 5506
40 Ga0307515_10275635 3300028794 Bacteria 1396
41 Ga0307512_10041156 3300030522 Bacteria 3844
42 Ga0307513_10014983 3300031456 Bacteria 9416
43 Ga0307509_10011170 3300031507 Bacteria 10922
44 Ga0307509_10066259 3300031507 Bacteria 3790
45 Ga0307508_10006304 3300031616 Bacteria 11169
46 Ga0307508_10010508 3300031616 Bacteria 8474
47 Ga0307508_10028244 3300031616 Bacteria 5073
48 Ga0307514_10112190 3300031649 Bacteria 1928
49 Ga0265314_10198764 3300031711 Bacteria 1187
50 Ga0307516_10006065 3300031730 Bacteria 14278
51 Ga0307516_10140029 3300031730 Bacteria 2190
52 Ga0307518_10022120 3300031838 Bacteria 4575
53 Ga0307518_10147454 3300031838 Bacteria 1632
54 Ga0307518_10157615 3300031838 Bacteria 1564
55 Ga0307518_10160012 3300031838 Bacteria 1548
56 Ga0307411_10060125 3300032005 Bacteria 2522
57 Ga0307507_10033671 3300033179 Bacteria 5314
58 Ga0307510_10002804 3300033180 Bacteria 19984
59 Ga0307510_10026320 3300033180 Bacteria 6688
60 Ga0307510_10197044 3300033180 Bacteria 1554
61 Ga0373943_0304125 3300035170 Bacteria 906
62 Ga0439436_0014228 3300041404 Bacteria 2404
63 Ga0439436_0025769 3300041404 Bacteria 1726
64 Ga0451849_0591873 3300041505 Bacteria 1453
65 Ga0451853_0457605 3300041512 Bacteria 4103
66 Ga0439433_0000798 3300041999 Bacteria 6224
67 Ga0439433_0009958 3300041999 Bacteria 2075
68 Ga0439448_0007545 3300042005 Bacteria 3156
69 Ga0439449_0001910 3300042007 Bacteria 8180
70 Ga0439449_0023817 3300042007 Bacteria 2289
71 Ga0439455_0012236 3300042012 Bacteria 1923
72 Ga0439457_002239 3300042014 Bacteria 5592
73 Ga0439458_0016226 3300042157 Bacteria 1694
74 Ga0466972_0009029 3300044658 Bacteria 5003
75 Ga0466965_0002000 3300044683 Bacteria 8531
76 Ga0466966_0006777 3300044684 Bacteria 7583
77 Ga0466961_0002525 3300044693 Bacteria 11352
78 Ga0466963_0001955 3300044694 Bacteria 11302
79 Ga0466963_0007816 3300044694 Bacteria 6397
80 Ga0466964_0002683 3300044706 Bacteria 6372
81 Ga0466970_0000307 3300044765 Bacteria 23833
82 Ga0466957_0000665 3300044842 Bacteria 17463
83 Ga0466960_0003443 3300044901 Bacteria 6087
84 Ga0466959_0002620 3300045049 Bacteria 11545
85 Ga0466958_0001616 3300045836 Bacteria 10842
86 Ga0466967_0028551 3300045976 Bacteria 4658
87 Ga0466967_0055170 3300045976 Bacteria 3500
88 Ga0495627_055948 3300046453 Bacteria 1177
89 Ga0495592_0007175 3300046454 Bacteria 8349
90 Ga0495592_0012416 3300046454 Bacteria 6469
91 Ga0495603_0001229 3300046455 Bacteria 14941
92 Ga0495603_0012050 3300046455 Bacteria 5234
93 Ga0495603_0015161 3300046455 Bacteria 4662
94 Ga0495603_0018153 3300046455 Bacteria 4255
95 Ga0495590_0045072 3300046457 Bacteria 1538
96 Ga0495629_0000847 3300046459 Bacteria 24697
97 Ga0495629_0001484 3300046459 Bacteria 18484
98 Ga0495629_0004198 3300046459 Bacteria 10818
99 Ga0495629_0011946 3300046459 Bacteria 6298
100 Ga0495629_0012829 3300046459 Bacteria 6062
101 Ga0495629_0074327 3300046459 Bacteria 2373
102 Ga0495638_0049969 3300046460 Bacteria 2613
103 Ga0495651_0002010 3300046462 Bacteria 15697
104 Ga0495653_0097356 3300046463 Bacteria 2138
105 Ga0495582_0032031 3300046473 Bacteria 2892
106 Ga0495582_0281528 3300046473 Bacteria 955
107 Ga0495605_0014501 3300046474 Bacteria 4314
108 Ga0495662_0000855 3300046476 Bacteria 14863
109 Ga0495662_0002545 3300046476 Bacteria 9201
110 Ga0495662_0008999 3300046476 Bacteria 4902
111 Ga0495664_0001856 3300046477 Bacteria 11237
112 Ga0495585_0044599 3300046492 Bacteria 2477
113 Ga0495594_0051497 3300046499 Bacteria 2265
114 Ga0495594_0086072 3300046499 Bacteria 1758
115 Ga0495594_0203758 3300046499 Bacteria 1128
116 Ga0495596_0072711 3300046500 Bacteria 1335
117 Ga0495607_0016377 3300046501 Bacteria 4784
118 Ga0495583_0012299 3300046506 Bacteria 4855
119 Ga0495583_0178296 3300046506 Bacteria 870
120 Ga0495606_0003749 3300046507 Bacteria 15814
121 Ga0495606_0143675 3300046507 Bacteria 1407
122 Ga0495608_0102027 3300046511 Bacteria 1849
123 Ga0495616_0043893 3300046513 Bacteria 2269
124 Ga0495618_0022095 3300046514 Bacteria 3927
125 Ga0495618_0144928 3300046514 Bacteria 1518
126 Ga0495620_0008571 3300046515 Bacteria 5483
127 Ga0495620_0083080 3300046515 Bacteria 1293
128 Ga0495620_0117389 3300046515 Bacteria 1051
129 Ga0495628_0029706 3300046516 Bacteria 4430
130 Ga0495630_0057215 3300046517 Bacteria 2922
131 Ga0495630_0333227 3300046517 Bacteria 1161
132 Ga0495631_0020216 3300046518 Bacteria 3113
133 Ga0495637_0040672 3300046520 Bacteria 2000
134 Ga0495643_0004604 3300046522 Bacteria 9598
135 Ga0495648_0052203 3300046524 Bacteria 2485
136 Ga0495666_0025120 3300046526 Bacteria 2944
137 Ga0495652_0021304 3300046529 Bacteria 5763
138 Ga0495640_0034198 3300046533 Bacteria 3607
139 Ga0495586_0029684 3300046535 Bacteria 2927
140 Ga0495586_0270504 3300046535 Bacteria 971
141 Ga0495587_0022517 3300046536 Bacteria 3879
142 Ga0495609_0147082 3300046538 Bacteria 1003
143 Ga0495597_0005330 3300046542 Bacteria 6819
144 Ga0495597_0041765 3300046542 Bacteria 2047
145 Ga0495645_0008266 3300046543 Bacteria 7258
146 Ga0495622_0002886 3300046557 Bacteria 8203
147 Ga0495622_0012934 3300046557 Bacteria 3870
148 Ga0495633_0155987 3300046558 Bacteria 1053
149 Ga0495668_0012449 3300046616 Bacteria 5044
150 Ga0495634_0000714 3300046642 Bacteria 32209
151 Ga0495611_0053110 3300046648 Bacteria 1829
152 Ga0495611_0203334 3300046648 Bacteria 923
153 Ga0495625_0014129 3300046660 Bacteria 6389
154 Ga0495625_0024060 3300046660 Bacteria 4642
155 Ga0495625_0089627 3300046660 Bacteria 2129
156 Ga0495625_0238640 3300046660 Bacteria 1184
157 Ga0495635_0005774 3300046663 Bacteria 8625
158 Ga0495635_0025676 3300046663 Bacteria 4105
159 Ga0495588_0017769 3300046674 Bacteria 3459
160 Ga0495657_0001440 3300046675 Bacteria 20589
161 Ga0495657_0005729 3300046675 Bacteria 9782
162 Ga0495657_0085687 3300046675 Bacteria 2030
163 Ga0495657_0249911 3300046675 Bacteria 1068
164 Ga0495623_0049288 3300046679 Bacteria 2669
165 Ga0495646_0000700 3300046680 Bacteria 18542
166 Ga0495658_0009361 3300046683 Bacteria 4881
167 Ga0495613_0002765 3300046689 Bacteria 13182
168 Ga0495613_0002977 3300046689 Bacteria 12684
169 Ga0495613_0007022 3300046689 Bacteria 8387
170 Ga0495613_0089207 3300046689 Bacteria 2233
171 Ga0495624_0166726 3300046690 Bacteria 1344
172 Ga0495670_0059906 3300046691 Bacteria 1912
173 Ga0495670_0079521 3300046691 Bacteria 1669
174 Ga0495671_0052206 3300046692 Bacteria 2032
175 Ga0495671_0197100 3300046692 Bacteria 977
176 Ga0495649_0043556 3300046694 Bacteria 2450
177 Ga0495589_0004093 3300046794 Bacteria 7808
178 Ga0495589_0012786 3300046794 Bacteria 4340
179 Ga0495589_0014644 3300046794 Bacteria 4035
180 Ga0495589_0117407 3300046794 Bacteria 1282
181 Ga0495600_0002015 3300046809 Bacteria 11424
182 Ga0495600_0182718 3300046809 Bacteria 1351
183 Ga0495660_0095102 3300046810 Bacteria 1541
184 Ga0495581_0001372 3300047315 Bacteria 13473
185 Ga0495581_0059292 3300047315 Bacteria 2212
186 Ga0495581_0092051 3300047315 Bacteria 1760
187 Ga0495581_0271443 3300047315 Bacteria 991
188 Ga0495604_0000534 3300047317 Bacteria 33497
189 Ga0495604_0121576 3300047317 Bacteria 1889
190 Ga0495636_0082870 3300047318 Bacteria 1383
191 Ga0495676_0002545 3300047321 Bacteria 16235
192 Ga0495676_0011057 3300047321 Bacteria 8159
193 Ga0495676_0032951 3300047321 Bacteria 4367
194 Ga0495676_0053722 3300047321 Bacteria 3207
195 Ga0495676_0293260 3300047321 Bacteria 1098
196 Ga0495687_001846 3300047443 Bacteria 18529
197 Ga0495687_009420 3300047443 Bacteria 5459
198 Ga0495687_009908 3300047443 Bacteria 5273
199 Ga0495687_010946 3300047443 Bacteria 4919
200 Ga0495675_0018414 3300047444 Bacteria 4432
201 Ga0495675_0150058 3300047444 Bacteria 1440
202 Ga0495675_0252933 3300047444 Bacteria 1057
203 Ga0495685_010070 3300047447 Bacteria 3167
204 Ga0495685_014502 3300047447 Bacteria 2678
205 Ga0495685_070530 3300047447 Bacteria 1171
206 Ga0495673_0080159 3300047469 Bacteria 1354
207 Ga0495681_0001537 3300047470 Bacteria 17227
208 Ga0495681_0045466 3300047470 Bacteria 2101
209 Ga0495684_0118696 3300047471 Bacteria 1993
210 Ga0495684_0487174 3300047471 Bacteria 850
211 Ga0495686_0203754 3300047472 Bacteria 1134
212 Ga0495593_0001922 3300047673 Bacteria 12393
213 Ga0495602_0015004 3300048088 Bacteria 7836
214 Ga0495614_0009212 3300048089 Bacteria 4372
215 Ga0495614_0014442 3300048089 Bacteria 3456
216 Ga0495614_0025266 3300048089 Bacteria 2561
217 Ga0495626_0080653 3300048091 Bacteria 1446
218 Ga0496109_0028279 3300048912 Bacteria 5012
219 Ga0495678_080376 3300049459 Bacteria 1172
220 Ga0501033_0279185 3300049570 Bacteria 1179
221 Ga0501047_0049826 3300049581 Bacteria 4043
222 Ga0501070_0197363 3300049586 Bacteria 1653
223 Ga0501080_0041691 3300049742 Bacteria 4276
224 Ga0501035_0450038 3300049822 Bacteria 1065
225 nmdc:mga03n38_94212_c1 3300050490 Bacteria 1432
226 nmdc:mga0qj67_18309_c1 3300050509 Bacteria 5338
227 nmdc:mga06r32_92680_c1 3300050510 Bacteria 2954
228 nmdc:mga08y16_68453_c1 3300050511 Bacteria 3701
229 Ga0495612_0034705 3300053078 Bacteria 2043
230 Ga0500610_0160616 3300053079 Bacteria 1118
231 Ga0495619_0183928 3300053085 Bacteria 1446
232 Ga0500640_008319 3300053095 Bacteria 4097
233 Ga0500572_004424 3300053111 Bacteria 3187
234 Ga0500614_055886 3300053123 Bacteria 1049
235 Ga0500573_0045543 3300053140 Bacteria 2529
236 Ga0500600_0180114 3300053149 Bacteria 1018
237 Ga0466962_0000548 3300061719 Bacteria 16567
238 3006427114 3006425503 Bacteria 6491253
239 2547410280 2547132111 Bacteria 8013147
240 2585298130 2582581312 Bacteria 7308206
241 2585304623 2582581313 Bacteria 10042643
242 2585314754 2582581314 Bacteria 11452267
243 2616698166 2616644814 Bacteria 11555299
244 2644261988 2643221647 Bacteria 10741251
245 2644442817 2643221678 Bacteria 9540101
246 2784591624 2784132148 Bacteria 8627943
247 2785340111 2784746763 Bacteria 9783172
248 2785372626 2784746768 Bacteria 10036182
249 2786675370 2786546132 Bacteria 10419719
250 2808844981 2808606359 Bacteria 9866990
251 2809235255 2808606448 Bacteria 8656184
252 2811843547 2808606982 Bacteria 7791042
253 2812354706 2811994879 Bacteria 9313447
254 2852636330 2852635781 Bacteria 8251373
255 2862283427 2862281513 Bacteria 9621493
256 2862383758 2862382967 Bacteria 10317375
257 2862576457 2862574272 Bacteria 10567477
258 2863409855 2863404153 Bacteria 9672205
259 2867434470 2867428634 Bacteria 9590268
260 2875397685 2875391855 Bacteria 7600475
261 2877678093 2877676314 Bacteria 9512378
262 2912716328 2912715099 Bacteria 9460473
263 2912729240 2912723979 Bacteria 8557534
264 2946070957 2946064051 Bacteria 8957905
265 2947225768 2947224130 Bacteria 9938529
266 2954009947 2954002825 Bacteria 9173742
267 2954382875 2954380949 Bacteria 10050426
268 2954680003 2954673503 Bacteria 9685905
269 2954684147 2954682443 Bacteria 9862841
270 2954693704 2954691527 Bacteria 10720516
271 2954708799 2954701450 Bacteria 10834262
272 2954713346 2954711539 Bacteria 10867210
273 2954723307 2954721474 Bacteria 10456478
274 2954738521 2954731030 Bacteria 10243860
275 2954742213 2954740390 Bacteria 10229294
276 2954757380 2954749733 Bacteria 10366972
277 2954761191 2954759201 Bacteria 9358192
278 2997603487 2997600082 Bacteria 9896405
279 3006494205 3006493962 Bacteria 8825450
280 8008563949 8008558824 Bacteria 10610750
281 8008576113 8008574985 Bacteria 7815457
282 8025479398 8025478263 Bacteria 8209203
283 8025533044 8025530807 Bacteria 8495698
284 8048407039 8048406513 Bacteria 8936924
285 JGI25153J46596_10028553
286 rootH1_10049217
287 JGI25160J50197_1008650
288 Ga0006562J51391_1054169
289 Ga0006562J51391_1054170
290 Ga0070658_10400929
291 Ga0070683_100035723
292 Ga0070680_100002178
293 Ga0070669_100461702
294 Ga0070708_100002228
295 Ga0070681_10000019
296 Ga0070679_100000124
297 Ga0070684_100021483
298 Ga0068853_100627013
299 Ga0068856_100442791
300 Ga0068852_100139381
301 Ga0075365_10034488
302 Ga0075428_100002565
303 Ga0075434_100067820
304 Ga0105251_10074789
305 Ga0111539_10013776
306 Ga0105238_10296615
307 Ga0157372_10620008
308 Ga0182008_10004451
309 Ga0182007_10000483
310 Ga0183367_1001
311 Ga0209758_1003365
312 Ga0207426_1001041
313 Ga0207426_1006064
314 Ga0207426_1009317
315 Ga0207713_1057436
316 Ga0207707_10000046
317 Ga0207660_10001766
318 Ga0207652_10000476
319 Ga0207661_10106209
320 Ga0207639_10584089
321 Ga0307517_10015711
322 Ga0307515_10000055
323 Ga0307515_10059058
324 Ga0307515_10275635
325 Ga0307512_10041156
326 Ga0307513_10014983
327 Ga0307509_10011170
328 Ga0307509_10066259
329 Ga0307508_10006304
330 Ga0307508_10010508
331 Ga0307508_10028244
332 Ga0307514_10112190
333 Ga0265314_10198764
334 Ga0307516_10006065
335 Ga0307516_10140029
336 Ga0307518_10022120
337 Ga0307518_10147454
338 Ga0307518_10157615
339 Ga0307518_10160012
340 Ga0307411_10060125
341 Ga0307507_10033671
342 Ga0307510_10002804
343 Ga0307510_10026320
344 Ga0307510_10197044
345 Ga0373943_0304125
346 Ga0439436_0014228
347 Ga0439436_0025769
348 Ga0451849_0591873
349 Ga0451853_0457605
350 Ga0439433_0000798
351 Ga0439433_0009958
352 Ga0439448_0007545
353 Ga0439449_0001910
354 Ga0439449_0023817
355 Ga0439455_0012236
356 Ga0439457_002239
357 Ga0439458_0016226
358 Ga0466972_0009029
359 Ga0466965_0002000
360 Ga0466966_0006777
361 Ga0466961_0002525
362 Ga0466963_0001955
363 Ga0466963_0007816
364 Ga0466964_0002683
365 Ga0466970_0000307
366 Ga0466957_0000665
367 Ga0466960_0003443
368 Ga0466959_0002620
369 Ga0466958_0001616
370 Ga0466967_0028551
371 Ga0466967_0055170
372 Ga0495627_055948
373 Ga0495592_0007175
374 Ga0495592_0012416
375 Ga0495603_0001229
376 Ga0495603_0012050
377 Ga0495603_0015161
378 Ga0495603_0018153
379 Ga0495590_0045072
380 Ga0495629_0000847
381 Ga0495629_0001484
382 Ga0495629_0004198
383 Ga0495629_0011946
384 Ga0495629_0012829
385 Ga0495629_0074327
386 Ga0495638_0049969
387 Ga0495651_0002010
388 Ga0495653_0097356
389 Ga0495582_0032031
390 Ga0495582_0281528
391 Ga0495605_0014501
392 Ga0495662_0000855
393 Ga0495662_0002545
394 Ga0495662_0008999
395 Ga0495664_0001856
396 Ga0495585_0044599
397 Ga0495594_0051497
398 Ga0495594_0086072
399 Ga0495594_0203758
400 Ga0495596_0072711
401 Ga0495607_0016377
402 Ga0495583_0012299
403 Ga0495583_0178296
404 Ga0495606_0003749
405 Ga0495606_0143675
406 Ga0495608_0102027
407 Ga0495616_0043893
408 Ga0495618_0022095
409 Ga0495618_0144928
410 Ga0495620_0008571
411 Ga0495620_0083080
412 Ga0495620_0117389
413 Ga0495628_0029706
414 Ga0495630_0057215
415 Ga0495630_0333227
416 Ga0495631_0020216
417 Ga0495637_0040672
418 Ga0495643_0004604
419 Ga0495648_0052203
420 Ga0495666_0025120
421 Ga0495652_0021304
422 Ga0495640_0034198
423 Ga0495586_0029684
424 Ga0495586_0270504
425 Ga0495587_0022517
426 Ga0495609_0147082
427 Ga0495597_0005330
428 Ga0495597_0041765
429 Ga0495645_0008266
430 Ga0495622_0002886
431 Ga0495622_0012934
432 Ga0495633_0155987
433 Ga0495668_0012449
434 Ga0495634_0000714
435 Ga0495611_0053110
436 Ga0495611_0203334
437 Ga0495625_0014129
438 Ga0495625_0024060
439 Ga0495625_0089627
440 Ga0495625_0238640
441 Ga0495635_0005774
442 Ga0495635_0025676
443 Ga0495588_0017769
444 Ga0495657_0001440
445 Ga0495657_0005729
446 Ga0495657_0085687
447 Ga0495657_0249911
448 Ga0495623_0049288
449 Ga0495646_0000700
450 Ga0495658_0009361
451 Ga0495613_0002765
452 Ga0495613_0002977
453 Ga0495613_0007022
454 Ga0495613_0089207
455 Ga0495624_0166726
456 Ga0495670_0059906
457 Ga0495670_0079521
458 Ga0495671_0052206
459 Ga0495671_0197100
460 Ga0495649_0043556
461 Ga0495589_0004093
462 Ga0495589_0012786
463 Ga0495589_0014644
464 Ga0495589_0117407
465 Ga0495600_0002015
466 Ga0495600_0182718
467 Ga0495660_0095102
468 Ga0495581_0001372
469 Ga0495581_0059292
470 Ga0495581_0092051
471 Ga0495581_0271443
472 Ga0495604_0000534
473 Ga0495604_0121576
474 Ga0495636_0082870
475 Ga0495676_0002545
476 Ga0495676_0011057
477 Ga0495676_0032951
478 Ga0495676_0053722
479 Ga0495676_0293260
480 Ga0495687_001846
481 Ga0495687_009420
482 Ga0495687_009908
483 Ga0495687_010946
484 Ga0495675_0018414
485 Ga0495675_0150058
486 Ga0495675_0252933
487 Ga0495685_010070
488 Ga0495685_014502
489 Ga0495685_070530
490 Ga0495673_0080159
491 Ga0495681_0001537
492 Ga0495681_0045466
493 Ga0495684_0118696
494 Ga0495684_0487174
495 Ga0495686_0203754
496 Ga0495593_0001922
497 Ga0495602_0015004
498 Ga0495614_0009212
499 Ga0495614_0014442
500 Ga0495614_0025266
501 Ga0495626_0080653
502 Ga0496109_0028279
503 Ga0495678_080376
504 Ga0501033_0279185
505 Ga0501047_0049826
506 Ga0501070_0197363
507 Ga0501080_0041691
508 Ga0501035_0450038
509 nmdc:mga03n38_94212_c1
510 nmdc:mga0qj67_18309_c1
511 nmdc:mga06r32_92680_c1
512 nmdc:mga08y16_68453_c1
513 Ga0495612_0034705
514 Ga0500610_0160616
515 Ga0495619_0183928
516 Ga0500640_008319
517 Ga0500572_004424
518 Ga0500614_055886
519 Ga0500573_0045543
520 Ga0500600_0180114
521 Ga0466962_0000548
522 3006427114
523 2547410280
524 2585298130
525 2585304623
526 2585314754
527 2616698166
528 2644261988
529 2644442817
530 2784591624
531 2785340111
532 2785372626
533 2786675370
534 2808844981
535 2809235255
536 2811843547
537 2812354706
538 2852636330
539 2862283427
540 2862383758
541 2862576457
542 2863409855
543 2867434470
544 2875397685
545 2877678093
546 2912716328
547 2912729240
548 2946070957
549 2947225768
550 2954009947
551 2954382875
552 2954680003
553 2954684147
554 2954693704
555 2954708799
556 2954713346
557 2954723307
558 2954738521
559 2954742213
560 2954757380
561 2954761191
562 2997603487
563 3006494205
564 8008563949
565 8008576113
566 8025479398
567 8025533044
568 8048407039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

32

212

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yc5-assembly1.cif.gz_A sir2-p53 peptide-nicotinamide 0.9141 2 238
2h2g-assembly1.cif.gz_A the structural basis of sirtuin substrate affinity 0.9045 2 238
3d4b-assembly1.cif.gz_A crystal structure of sir2tm in complex with acetyl p53 peptide and dadme-nad+ 0.8942 2 244
1m2k-assembly1.cif.gz_A sir2 homologue f159a mutant-adp ribose complex 0.8942 2 246
2h4j-assembly1.cif.gz_A sir2-deacetylated peptide (from enzymatic turnover in crystal) 0.8918 2 246
ID Description Score Start End Superfamily
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.922 2 239 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9133 2 239 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.905 3 239 3.40.50.1220
af_F1QHM6_40_305_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8973 2 232 3.40.50.1220
af_Q53700_9_242_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8705 2 236 3.40.50.1220
ID Description Score Start End GO Terms
AF-J2K6V3-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9865 1 240 GO:0017136
GO:0046872
GO:0070403
AF-A0A401M8I0-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9834 1 241 GO:0017136
GO:0046872
GO:0070403
AF-A0A495CLQ0-F1-model_v4 deleted 0.9806 1 240
AF-A0A3D9LS72-F1-model_v4 deleted 0.9785 4 239
AF-A0A537B9W5-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9782 41 236 GO:0017136
GO:0046872
GO:0070403

Map