F386385

General Info

Members Datasets Scaffolds Average Seq Length
284 151 568 177

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0026519|Ga0495656_0026519_410_994
Length 194
Sequence VVGLKKFQLQKTQFKKIRALLAAVLMAAGLGVLAPAPAAADPYCGQVWGSLSKADPAMSQAKVVNVRTGQHYCFDRLVIDLNGPVAGYSVRYVPEVVQDGSGLPVPLRGQAFIQLTVNAPAYDDAGNPTYNPANKSELADVAGYQTFRQVAWAGSFEGYSNIGLGVRARLPFRVLTLSGPGTGSRFVVDVAHFW

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
79 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
80 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
83 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
84 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
88 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
127 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
132 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
133 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
134 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
136 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
137 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
138 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
139 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
140 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
141 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
142 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
143 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
144 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
145 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
146 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
147 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
148 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
149 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
150 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
151 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.25
Metatranscriptomes 0.7
Isolates 7.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 11.62
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0026519 3300046615 Bacteria 2307
2 LJQas_1000431 3300000549 Bacteria 6984
3 JGI24033J26618_1003689 3300002155 Bacteria 1624
4 rootH2_10010773 3300003320 Bacteria 3319
5 rootL2_10302822 3300003322 Bacteria 3361
6 rootL2_10335379 3300003322 Bacteria 1031
7 Ga0055542_1011793 3300003762 Bacteria 1536
8 Ga0055542_1026628 3300003762 Bacteria 777
9 Ga0065714_10075640 3300005288 Bacteria 2872
10 Ga0065714_10149089 3300005288 Bacteria 1105
11 Ga0065714_10231993 3300005288 Bacteria 814
12 Ga0070676_10058613 3300005328 Bacteria 2282
13 Ga0070676_10633908 3300005328 Bacteria 774
14 Ga0070683_100007039 3300005329 Bacteria 9468
15 Ga0070690_100014427 3300005330 Viruses 4688
16 Ga0070670_100010397 3300005331 Bacteria 7941
17 Ga0070670_100162762 3300005331 Bacteria 1934
18 Ga0070677_10029973 3300005333 Bacteria 2067
19 Ga0070677_10111079 3300005333 Bacteria 1224
20 Ga0070666_10158697 3300005335 Bacteria 1580
21 Ga0070689_100002254 3300005340 Bacteria 12526
22 Ga0070668_100067056 3300005347 Bacteria 2787
23 Ga0070669_100010580 3300005353 Bacteria 6550
24 Ga0070675_100004238 3300005354 Bacteria 10909
25 Ga0070671_100040839 3300005355 Bacteria 3855
26 Ga0070674_100348267 3300005356 Bacteria 1196
27 Ga0070674_101028563 3300005356 Bacteria 724
28 Ga0070688_100009754 3300005365 Bacteria 5271
29 Ga0070659_100018747 3300005366 Bacteria 5223
30 Ga0070667_100211575 3300005367 Bacteria 1723
31 Ga0070678_100035898 3300005456 Bacteria 3465
32 Ga0070678_100087263 3300005456 Bacteria 2382
33 Ga0070685_10001810 3300005466 Bacteria 11133
34 Ga0070679_100009432 3300005530 Bacteria 9231
35 Ga0070684_100009535 3300005535 Bacteria 7650
36 Ga0070672_100227058 3300005543 Bacteria 1567
37 Ga0070665_100366838 3300005548 Bacteria 1446
38 Ga0068854_100105311 3300005578 Bacteria 2120
39 Ga0068852_100004447 3300005616 Bacteria 9908
40 Ga0075432_10000095 3300006058 Bacteria 18569
41 Ga0075432_10037274 3300006058 Bacteria 1692
42 Ga0105251_10014085 3300009011 Bacteria 4441
43 Ga0105244_10110177 3300009036 Bacteria 1340
44 Ga0105245_10943788 3300009098 Bacteria 905
45 Ga0105243_10082436 3300009148 Bacteria 2628
46 Ga0105248_10051753 3300009177 Bacteria 4608
47 Ga0105246_10013664 3300011119 Bacteria 5095
48 Ga0157373_10017677 3300013100 Bacteria 5191
49 Ga0157369_10233393 3300013105 Bacteria 1923
50 Ga0157369_10770269 3300013105 Bacteria 989
51 Ga0163162_10423029 3300013306 Bacteria 1464
52 Ga0163162_10537561 3300013306 Bacteria 1297
53 Ga0157375_10111005 3300013308 Bacteria 2840
54 Ga0207697_10000805 3300025315 Bacteria 17773
55 Ga0207697_10111443 3300025315 Unclassified 1172
56 Ga0207655_1019029 3300025728 Bacteria 3612
57 Ga0207682_10017360 3300025893 Bacteria 2811
58 Ga0207688_10001066 3300025901 Unclassified 14035
59 Ga0207705_10018212 3300025909 Archaea 5021
60 Ga0207652_10084639 3300025921 Bacteria 2779
61 Ga0207650_10017213 3300025925 Bacteria 5059
62 Ga0207659_10041133 3300025926 Bacteria 3236
63 Ga0207690_10107043 3300025932 Bacteria 2007
64 Ga0207709_10137538 3300025935 Bacteria 1675
65 Ga0207670_10001534 3300025936 Bacteria 12136
66 Ga0207691_10004975 3300025940 Bacteria 12820
67 Ga0207661_10017971 3300025944 Bacteria 5247
68 Ga0207668_10281569 3300025972 Bacteria 1364
69 Ga0207677_10185819 3300026023 Bacteria 1639
70 Ga0207683_10010818 3300026121 Bacteria 7780
71 Ga0207683_10038659 3300026121 Bacteria 4161
72 Ga0207698_10002439 3300026142 Bacteria 11016
73 Ga0207428_10064782 3300027907 Bacteria 2885
74 Ga0265334_10000324 3300028573 Bacteria 26133
75 Ga0307408_100012850 3300031548 Bacteria 5552
76 Ga0307408_100025071 3300031548 Bacteria 4080
77 Ga0307408_100046928 3300031548 Bacteria 3091
78 Ga0307408_100060446 3300031548 Bacteria 2762
79 Ga0307408_100082556 3300031548 Bacteria 2405
80 Ga0307408_100090653 3300031548 Bacteria 2307
81 Ga0307408_100127806 3300031548 Bacteria 1979
82 Ga0307408_100203980 3300031548 Bacteria 1602
83 Ga0307408_100207345 3300031548 Bacteria 1590
84 Ga0307408_100209694 3300031548 Bacteria 1582
85 Ga0307408_100262710 3300031548 Bacteria 1429
86 Ga0307405_10026907 3300031731 Bacteria 3326
87 Ga0307405_10036286 3300031731 Bacteria 2952
88 Ga0307405_10038791 3300031731 Bacteria 2874
89 Ga0307405_10135170 3300031731 Bacteria 1710
90 Ga0307405_10152920 3300031731 Bacteria 1625
91 Ga0307405_10458346 3300031731 Bacteria 1012
92 Ga0307405_10621513 3300031731 Bacteria 884
93 Ga0307405_11053735 3300031731 Bacteria 696
94 Ga0307413_10044125 3300031824 Bacteria 2633
95 Ga0307413_10057335 3300031824 Bacteria 2381
96 Ga0307413_10083742 3300031824 Bacteria 2053
97 Ga0307413_10089520 3300031824 Bacteria 2000
98 Ga0307413_10228102 3300031824 Bacteria 1365
99 Ga0307413_10265848 3300031824 Bacteria 1281
100 Ga0307413_10302164 3300031824 Bacteria 1214
101 Ga0307413_10326497 3300031824 Bacteria 1174
102 Ga0307413_10433765 3300031824 Bacteria 1038
103 Ga0307410_10031157 3300031852 Bacteria 3418
104 Ga0307410_10059502 3300031852 Bacteria 2608
105 Ga0307410_10125785 3300031852 Bacteria 1876
106 Ga0307410_10182034 3300031852 Bacteria 1591
107 Ga0307410_10339397 3300031852 Bacteria 1197
108 Ga0307410_10524995 3300031852 Bacteria 977
109 Ga0307410_10562338 3300031852 Bacteria 946
110 Ga0307406_10011442 3300031901 Bacteria 5037
111 Ga0307406_10335305 3300031901 Bacteria 1176
112 Ga0307407_10006943 3300031903 Bacteria 5088
113 Ga0307407_10009663 3300031903 Bacteria 4505
114 Ga0307407_10020216 3300031903 Bacteria 3407
115 Ga0307407_10024425 3300031903 Bacteria 3169
116 Ga0307407_10028154 3300031903 Bacteria 3000
117 Ga0307407_10108600 3300031903 Bacteria 1737
118 Ga0307412_10026404 3300031911 Bacteria 3609
119 Ga0307412_10043247 3300031911 Bacteria 2932
120 Ga0307412_10051118 3300031911 Bacteria 2730
121 Ga0307412_10059226 3300031911 Bacteria 2565
122 Ga0307412_10325982 3300031911 Bacteria 1224
123 Ga0307412_10390793 3300031911 Bacteria 1129
124 Ga0307412_10553563 3300031911 Bacteria 966
125 Ga0307412_10717043 3300031911 Bacteria 860
126 Ga0307409_100012546 3300031995 Bacteria 5406
127 Ga0307409_100017936 3300031995 Bacteria 4736
128 Ga0307409_100098780 3300031995 Bacteria 2415
129 Ga0307409_100112573 3300031995 Bacteria 2285
130 Ga0307409_100168365 3300031995 Bacteria 1925
131 Ga0307409_100199861 3300031995 Bacteria 1787
132 Ga0307409_100217463 3300031995 Bacteria 1722
133 Ga0307409_100236784 3300031995 Bacteria 1659
134 Ga0307409_100419992 3300031995 Bacteria 1283
135 Ga0307409_100451617 3300031995 Bacteria 1241
136 Ga0307409_101484461 3300031995 Bacteria 705
137 Ga0307416_100010248 3300032002 Bacteria 6181
138 Ga0307416_100022190 3300032002 Bacteria 4576
139 Ga0307416_100073941 3300032002 Bacteria 2844
140 Ga0307416_100150261 3300032002 Bacteria 2135
141 Ga0307416_100253208 3300032002 Bacteria 1715
142 Ga0307416_100456048 3300032002 Bacteria 1332
143 Ga0307416_100462447 3300032002 Bacteria 1324
144 Ga0307416_100479921 3300032002 Bacteria 1303
145 Ga0307416_100481982 3300032002 Bacteria 1300
146 Ga0307416_100680091 3300032002 Bacteria 1116
147 Ga0307416_100686972 3300032002 Bacteria 1111
148 Ga0307414_10101681 3300032004 Bacteria 2165
149 Ga0307414_10106457 3300032004 Bacteria 2123
150 Ga0307414_10183661 3300032004 Bacteria 1685
151 Ga0307414_10380840 3300032004 Bacteria 1220
152 Ga0307414_10399830 3300032004 Bacteria 1193
153 Ga0307411_10085163 3300032005 Bacteria 2188
154 Ga0307411_10099774 3300032005 Bacteria 2050
155 Ga0307411_10330458 3300032005 Bacteria 1235
156 Ga0307415_100051845 3300032126 Bacteria 2787
157 Ga0307415_100095292 3300032126 Bacteria 2166
158 Ga0307415_100158279 3300032126 Bacteria 1752
159 Ga0307415_100523480 3300032126 Bacteria 1041
160 Ga0395899_0015764 3300037312 Bacteria 5762
161 Ga0395899_0077383 3300037312 Bacteria 2426
162 Ga0395900_0037495 3300037418 Bacteria 4997
163 Ga0395898_0156154 3300037466 Bacteria 2182
164 Ga0395905_0314377 3300037471 Bacteria 1455
165 Ga0439436_0068153 3300041404 Bacteria 992
166 Ga0439438_027724 3300041405 Bacteria 1527
167 Ga0439439_0022896 3300041406 Bacteria 1563
168 Ga0439439_0094597 3300041406 Bacteria 819
169 Ga0439447_071677 3300041407 Bacteria 805
170 Ga0439466_0019964 3300041411 Bacteria 2394
171 Ga0439466_0043898 3300041411 Bacteria 1483
172 Ga0439433_0000691 3300041999 Bacteria 6540
173 Ga0439433_0007470 3300041999 Bacteria 2361
174 Ga0439433_0009155 3300041999 Bacteria 2155
175 Ga0439433_0196725 3300041999 Bacteria 532
176 Ga0439442_000146 3300042002 Bacteria 17613
177 Ga0439442_018453 3300042002 Bacteria 1442
178 Ga0439442_037278 3300042002 Bacteria 1018
179 Ga0439445_0087156 3300042004 Bacteria 877
180 Ga0439432_019021 3300042006 Bacteria 2292
181 Ga0439449_0009605 3300042007 Bacteria 3661
182 Ga0439449_0021816 3300042007 Bacteria 2396
183 Ga0439449_0043029 3300042007 Bacteria 1677
184 Ga0439457_020928 3300042014 Bacteria 1450
185 Ga0439462_0017566 3300042015 Bacteria 1853
186 Ga0450920_001370 3300042122 Bacteria 4020
187 Ga0450920_002695 3300042122 Bacteria 3043
188 Ga0450907_001287 3300042146 Bacteria 5599
189 Ga0450910_013005 3300042147 Bacteria 1208
190 Ga0439434_0008178 3300042435 Bacteria 3065
191 Ga0439434_0112351 3300042435 Bacteria 883
192 Ga0450918_001231 3300042531 Bacteria 5203
193 Ga0466958_0304842 3300045836 Bacteria 1023
194 Ga0495580_0000736 3300046472 Bacteria 28009
195 Ga0495582_0441439 3300046473 Bacteria 751
196 Ga0495582_0769342 3300046473 Bacteria 557
197 Ga0495639_0003981 3300046475 Bacteria 6340
198 Ga0495631_0191783 3300046518 Bacteria 875
199 Ga0495642_0007275 3300046528 Bacteria 4250
200 Ga0495642_0011590 3300046528 Bacteria 3390
201 Ga0495586_0295680 3300046535 Bacteria 927
202 Ga0495622_0039536 3300046557 Bacteria 2197
203 Ga0495633_0116886 3300046558 Bacteria 1236
204 Ga0495656_0121349 3300046615 Bacteria 1234
205 Ga0495668_0146676 3300046616 Bacteria 1292
206 Ga0495588_0002307 3300046674 Bacteria 8162
207 Ga0495588_0041103 3300046674 Bacteria 2360
208 Ga0495588_0048051 3300046674 Bacteria 2192
209 Ga0495670_0023597 3300046691 Bacteria 3035
210 Ga0495670_0117369 3300046691 Bacteria 1381
211 Ga0495670_0132837 3300046691 Bacteria 1298
212 Ga0495670_0155368 3300046691 Bacteria 1200
213 Ga0495600_0043261 3300046809 Bacteria 2937
214 Ga0495636_0018823 3300047318 Bacteria 2772
215 Ga0495677_0061635 3300047445 Bacteria 1391
216 Ga0495685_057638 3300047447 Bacteria 1312
217 Ga0496100_0133689 3300048903 Bacteria 1750
218 Ga0496102_0139150 3300048905 Bacteria 2275
219 Ga0496102_0245408 3300048905 Bacteria 1688
220 Ga0496102_0743679 3300048905 Bacteria 903
221 Ga0496103_0096982 3300048906 Bacteria 1863
222 Ga0496103_0143188 3300048906 Bacteria 1529
223 Ga0496103_0357677 3300048906 Bacteria 938
224 Ga0496103_0460536 3300048906 Bacteria 815
225 Ga0496104_0048377 3300048907 Bacteria 4009
226 Ga0496105_0362769 3300048908 Bacteria 1155
227 Ga0496106_0234221 3300048909 Bacteria 1466
228 Ga0496106_0608025 3300048909 Bacteria 875
229 Ga0496106_0620187 3300048909 Bacteria 865
230 Ga0496106_0707716 3300048909 Bacteria 802
231 Ga0496107_0029630 3300048910 Bacteria 3895
232 Ga0496107_0315438 3300048910 Bacteria 1163
233 Ga0496108_0126952 3300048911 Bacteria 2190
234 Ga0496108_0342262 3300048911 Bacteria 1305
235 Ga0496108_0901935 3300048911 Bacteria 759
236 Ga0496108_1535953 3300048911 Bacteria 553
237 Ga0496110_0672954 3300048913 Bacteria 935
238 Ga0496111_0010066 3300048914 Bacteria 6327
239 Ga0496111_0189140 3300048914 Bacteria 1530
240 Ga0496111_0368645 3300048914 Bacteria 1063
241 Ga0496111_0445496 3300048914 Bacteria 955
242 Ga0496112_0167257 3300048915 Bacteria 2165
243 Ga0496112_0736306 3300048915 Bacteria 913
244 Ga0496112_0982803 3300048915 Bacteria 764
245 Ga0496113_0357057 3300048916 Bacteria 1172
246 Ga0496113_0451763 3300048916 Bacteria 1032
247 Ga0496114_0042083 3300048917 Bacteria 3785
248 Ga0496114_0043091 3300048917 Bacteria 3742
249 Ga0496115_0042761 3300048918 Bacteria 3611
250 Ga0496119_0202988 3300048922 Bacteria 1025
251 Ga0496124_0044844 3300048927 Bacteria 3792
252 Ga0496125_0371768 3300048928 Bacteria 846
253 Ga0496125_0532702 3300048928 Bacteria 654
254 Ga0501320_045835 3300049536 Bacteria 584
255 Ga0501038_0027134 3300049574 Bacteria 5097
256 Ga0501038_0426658 3300049574 Bacteria 1022
257 Ga0501038_0565808 3300049574 Bacteria 863
258 Ga0501043_0106669 3300049579 Bacteria 2200
259 Ga0501227_135869 3300049665 Bacteria 672
260 Ga0501243_013137 3300049675 Bacteria 1311
261 Ga0501261_084882 3300049690 Bacteria 579
262 Ga0501279_025174 3300049775 Bacteria 864
263 Ga0501279_031365 3300049775 Bacteria 789
264 Ga0587072_001875 3300059643 Bacteria 2715
265 2691512739 2690315906 Bacteria 4517044
266 2775658939 2775506735 Bacteria 4556596
267 2808876278 2808606366 Bacteria 4415912
268 2808894269 2808606370 Bacteria 4942454
269 2808897779 2808606371 Bacteria 4251511
270 2812318205 2811994871 Bacteria 4497550
271 2919395301 2919391150 Bacteria 4884741
272 2919395683 2919391150 Bacteria 4884741
273 2939599328 2939598168 Bacteria 4687164
274 2945920306 2945916053 Bacteria 4555517
275 2945923832 2945920336 Bacteria 4501603
276 2945944509 2945941187 Bacteria 4682474
277 2945957301 2945956166 Bacteria 5110334
278 2945958524 2945956166 Bacteria 5110334
279 2945959452 2945956166 Bacteria 5110334
280 2946040424 2946037020 Bacteria 4900426
281 2946064021 2946059875 Bacteria 4386623
282 2954001689 2953998280 Bacteria 4812144
283 2974303858 2974302888 Bacteria 4369871
284 8054109749 8054107350 Bacteria 5022511
285 Ga0495656_0026519
286 LJQas_1000431
287 JGI24033J26618_1003689
288 rootH2_10010773
289 rootL2_10302822
290 rootL2_10335379
291 Ga0055542_1011793
292 Ga0055542_1026628
293 Ga0065714_10075640
294 Ga0065714_10149089
295 Ga0065714_10231993
296 Ga0070676_10058613
297 Ga0070676_10633908
298 Ga0070683_100007039
299 Ga0070690_100014427
300 Ga0070670_100010397
301 Ga0070670_100162762
302 Ga0070677_10029973
303 Ga0070677_10111079
304 Ga0070666_10158697
305 Ga0070689_100002254
306 Ga0070668_100067056
307 Ga0070669_100010580
308 Ga0070675_100004238
309 Ga0070671_100040839
310 Ga0070674_100348267
311 Ga0070674_101028563
312 Ga0070688_100009754
313 Ga0070659_100018747
314 Ga0070667_100211575
315 Ga0070678_100035898
316 Ga0070678_100087263
317 Ga0070685_10001810
318 Ga0070679_100009432
319 Ga0070684_100009535
320 Ga0070672_100227058
321 Ga0070665_100366838
322 Ga0068854_100105311
323 Ga0068852_100004447
324 Ga0075432_10000095
325 Ga0075432_10037274
326 Ga0105251_10014085
327 Ga0105244_10110177
328 Ga0105245_10943788
329 Ga0105243_10082436
330 Ga0105248_10051753
331 Ga0105246_10013664
332 Ga0157373_10017677
333 Ga0157369_10233393
334 Ga0157369_10770269
335 Ga0163162_10423029
336 Ga0163162_10537561
337 Ga0157375_10111005
338 Ga0207697_10000805
339 Ga0207697_10111443
340 Ga0207655_1019029
341 Ga0207682_10017360
342 Ga0207688_10001066
343 Ga0207705_10018212
344 Ga0207652_10084639
345 Ga0207650_10017213
346 Ga0207659_10041133
347 Ga0207690_10107043
348 Ga0207709_10137538
349 Ga0207670_10001534
350 Ga0207691_10004975
351 Ga0207661_10017971
352 Ga0207668_10281569
353 Ga0207677_10185819
354 Ga0207683_10010818
355 Ga0207683_10038659
356 Ga0207698_10002439
357 Ga0207428_10064782
358 Ga0265334_10000324
359 Ga0307408_100012850
360 Ga0307408_100025071
361 Ga0307408_100046928
362 Ga0307408_100060446
363 Ga0307408_100082556
364 Ga0307408_100090653
365 Ga0307408_100127806
366 Ga0307408_100203980
367 Ga0307408_100207345
368 Ga0307408_100209694
369 Ga0307408_100262710
370 Ga0307405_10026907
371 Ga0307405_10036286
372 Ga0307405_10038791
373 Ga0307405_10135170
374 Ga0307405_10152920
375 Ga0307405_10458346
376 Ga0307405_10621513
377 Ga0307405_11053735
378 Ga0307413_10044125
379 Ga0307413_10057335
380 Ga0307413_10083742
381 Ga0307413_10089520
382 Ga0307413_10228102
383 Ga0307413_10265848
384 Ga0307413_10302164
385 Ga0307413_10326497
386 Ga0307413_10433765
387 Ga0307410_10031157
388 Ga0307410_10059502
389 Ga0307410_10125785
390 Ga0307410_10182034
391 Ga0307410_10339397
392 Ga0307410_10524995
393 Ga0307410_10562338
394 Ga0307406_10011442
395 Ga0307406_10335305
396 Ga0307407_10006943
397 Ga0307407_10009663
398 Ga0307407_10020216
399 Ga0307407_10024425
400 Ga0307407_10028154
401 Ga0307407_10108600
402 Ga0307412_10026404
403 Ga0307412_10043247
404 Ga0307412_10051118
405 Ga0307412_10059226
406 Ga0307412_10325982
407 Ga0307412_10390793
408 Ga0307412_10553563
409 Ga0307412_10717043
410 Ga0307409_100012546
411 Ga0307409_100017936
412 Ga0307409_100098780
413 Ga0307409_100112573
414 Ga0307409_100168365
415 Ga0307409_100199861
416 Ga0307409_100217463
417 Ga0307409_100236784
418 Ga0307409_100419992
419 Ga0307409_100451617
420 Ga0307409_101484461
421 Ga0307416_100010248
422 Ga0307416_100022190
423 Ga0307416_100073941
424 Ga0307416_100150261
425 Ga0307416_100253208
426 Ga0307416_100456048
427 Ga0307416_100462447
428 Ga0307416_100479921
429 Ga0307416_100481982
430 Ga0307416_100680091
431 Ga0307416_100686972
432 Ga0307414_10101681
433 Ga0307414_10106457
434 Ga0307414_10183661
435 Ga0307414_10380840
436 Ga0307414_10399830
437 Ga0307411_10085163
438 Ga0307411_10099774
439 Ga0307411_10330458
440 Ga0307415_100051845
441 Ga0307415_100095292
442 Ga0307415_100158279
443 Ga0307415_100523480
444 Ga0395899_0015764
445 Ga0395899_0077383
446 Ga0395900_0037495
447 Ga0395898_0156154
448 Ga0395905_0314377
449 Ga0439436_0068153
450 Ga0439438_027724
451 Ga0439439_0022896
452 Ga0439439_0094597
453 Ga0439447_071677
454 Ga0439466_0019964
455 Ga0439466_0043898
456 Ga0439433_0000691
457 Ga0439433_0007470
458 Ga0439433_0009155
459 Ga0439433_0196725
460 Ga0439442_000146
461 Ga0439442_018453
462 Ga0439442_037278
463 Ga0439445_0087156
464 Ga0439432_019021
465 Ga0439449_0009605
466 Ga0439449_0021816
467 Ga0439449_0043029
468 Ga0439457_020928
469 Ga0439462_0017566
470 Ga0450920_001370
471 Ga0450920_002695
472 Ga0450907_001287
473 Ga0450910_013005
474 Ga0439434_0008178
475 Ga0439434_0112351
476 Ga0450918_001231
477 Ga0466958_0304842
478 Ga0495580_0000736
479 Ga0495582_0441439
480 Ga0495582_0769342
481 Ga0495639_0003981
482 Ga0495631_0191783
483 Ga0495642_0007275
484 Ga0495642_0011590
485 Ga0495586_0295680
486 Ga0495622_0039536
487 Ga0495633_0116886
488 Ga0495656_0121349
489 Ga0495668_0146676
490 Ga0495588_0002307
491 Ga0495588_0041103
492 Ga0495588_0048051
493 Ga0495670_0023597
494 Ga0495670_0117369
495 Ga0495670_0132837
496 Ga0495670_0155368
497 Ga0495600_0043261
498 Ga0495636_0018823
499 Ga0495677_0061635
500 Ga0495685_057638
501 Ga0496100_0133689
502 Ga0496102_0139150
503 Ga0496102_0245408
504 Ga0496102_0743679
505 Ga0496103_0096982
506 Ga0496103_0143188
507 Ga0496103_0357677
508 Ga0496103_0460536
509 Ga0496104_0048377
510 Ga0496105_0362769
511 Ga0496106_0234221
512 Ga0496106_0608025
513 Ga0496106_0620187
514 Ga0496106_0707716
515 Ga0496107_0029630
516 Ga0496107_0315438
517 Ga0496108_0126952
518 Ga0496108_0342262
519 Ga0496108_0901935
520 Ga0496108_1535953
521 Ga0496110_0672954
522 Ga0496111_0010066
523 Ga0496111_0189140
524 Ga0496111_0368645
525 Ga0496111_0445496
526 Ga0496112_0167257
527 Ga0496112_0736306
528 Ga0496112_0982803
529 Ga0496113_0357057
530 Ga0496113_0451763
531 Ga0496114_0042083
532 Ga0496114_0043091
533 Ga0496115_0042761
534 Ga0496119_0202988
535 Ga0496124_0044844
536 Ga0496125_0371768
537 Ga0496125_0532702
538 Ga0501320_045835
539 Ga0501038_0027134
540 Ga0501038_0426658
541 Ga0501038_0565808
542 Ga0501043_0106669
543 Ga0501227_135869
544 Ga0501243_013137
545 Ga0501261_084882
546 Ga0501279_025174
547 Ga0501279_031365
548 Ga0587072_001875
549 2691512739
550 2775658939
551 2808876278
552 2808894269
553 2808897779
554 2812318205
555 2919395301
556 2919395683
557 2939599328
558 2945920306
559 2945923832
560 2945944509
561 2945957301
562 2945958524
563 2945959452
564 2946040424
565 2946064021
566 2954001689
567 2974303858
568 8054109749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24837

61

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khb-assembly4.cif.gz_G structure of the spt16d pob3n heterodimer 0.7583 52 74
4khb-assembly1.cif.gz_A structure of the spt16d pob3n heterodimer 0.7518 52 74
4khb-assembly2.cif.gz_C structure of the spt16d pob3n heterodimer 0.7337 52 74
4khb-assembly3.cif.gz_E structure of the spt16d pob3n heterodimer 0.7324 52 76
4bwg-assembly2.cif.gz_K structural basis of subtilase cytotoxin subab assembly 0.7237 49 71
ID Description Score Start End Superfamily
4khbG00 Mainly Beta;Roll;PH-domain like;FACT complex subunit Spt16p/Cdc68p 0.7583 52 74 2.30.29.210
4bwgK00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7237 49 71 2.40.50.110
af_P26365_18_127_2.60.40.3500 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7079 48 181 2.60.40.3500
af_P26365_18_127_2.60.40.3500 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6855 48 181 2.60.40.3500
4exrA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.66 50 79 3.10.450.40
ID Description Score Start End GO Terms
AF-A0A4R4X7A4-F1-model_v4 DUF4352 domain-containing protein 0.9683 34 184
AF-A0A1J0W3U6-F1-model_v4 Allene oxide cyclase barrel-like domain-containing protein 0.9653 32 184
AF-A0A3B9W4W4-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.9623 112 184
AF-A0A7X5V4J6-F1-model_v4 Uncharacterized protein 0.9608 70 184
AF-A0A4R4QGL3-F1-model_v4 Secreted protein 0.9538 34 184

Map