F386353

General Info

Members Datasets Scaffolds Average Seq Length
284 194 568 325

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0000013|Ga0466960_0000013_24128_25213
Length 361
Sequence LKFSGNHGTLLRVTSNAIEARGLVKRYGDKRALDGVDLAVARGEVCALLGPNGAGKTTAVRVLTTLTLPDEGTAQVAGHDVVADPVAVRRRLGLAAQDATVDGLLTGQENLVMIGELHHLGRKRAQARATELLEQFSLSDAADKLAKDYSGGMRRRLDLAATLVAEPEVLFLDEPTTGLDPRARNELWDVLDRLVAGGATLLLTTQYLEEADRLADDIVVVDHGRVIARGDARSLKRQVGGDQLRVVAARRDDVGEVARIVERVAGVAPVVDPGARSVIAPAVDAAGARADGDXAGHGVAVLGALADALSAAGVAVEDLGLAQPTLDDVFLTLTGKPAEDGTAAEGSAAGSSEPVAEEAAR

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
179 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
180 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
181 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
182 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
183 2808606448 Streptomyces sp. 193411 Isolate Unclassified
184 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
185 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
186 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
187 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
188 2891562705 Microbispora tritici MT50 Isolate Unclassified
189 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
190 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
191 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
192 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
193 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
194 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 2.46
Rhizosphere 90.14
Stem 0
Stem Tuber 0.35
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0000013 3300044901 Bacteria 58320
2 Ga0070658_10329080 3300005327 Bacteria 1305
3 Ga0070683_100046076 3300005329 Bacteria 4026
4 Ga0070680_100031492 3300005336 Bacteria 4264
5 Ga0068868_100270296 3300005338 Bacteria 1436
6 Ga0070660_100007261 3300005339 Bacteria 7715
7 Ga0070691_10039558 3300005341 Bacteria 2228
8 Ga0070668_100002895 3300005347 Bacteria 12667
9 Ga0070663_100000592 3300005455 Bacteria 19281
10 Ga0070681_10050987 3300005458 Bacteria 4128
11 Ga0070685_10165598 3300005466 Bacteria 1413
12 Ga0070707_100323302 3300005468 Bacteria 1499
13 Ga0070698_100001263 3300005471 Bacteria 28255
14 Ga0070699_100004468 3300005518 Bacteria 12365
15 Ga0070679_100029034 3300005530 Bacteria 5455
16 Ga0070684_100003680 3300005535 Bacteria 11570
17 Ga0070684_100025954 3300005535 Bacteria 4930
18 Ga0070684_100169004 3300005535 Bacteria 1986
19 Ga0070696_100002914 3300005546 Bacteria 11373
20 Ga0070665_100133845 3300005548 Bacteria 2481
21 Ga0070664_100150385 3300005564 Bacteria 2055
22 Ga0068857_100186571 3300005577 Bacteria 1888
23 Ga0068852_100181437 3300005616 Bacteria 1980
24 Ga0068852_100353257 3300005616 Bacteria 1436
25 Ga0081455_10003111 3300005937 Bacteria 19318
26 Ga0081539_10041066 3300005985 Bacteria 2709
27 Ga0075430_100012387 3300006846 Bacteria 7254
28 Ga0075431_100186415 3300006847 Bacteria 2127
29 Ga0075434_100008206 3300006871 Bacteria 9689
30 Ga0075435_100004410 3300007076 Bacteria 9659
31 Ga0105240_10045536 3300009093 Bacteria 5564
32 Ga0105245_10116695 3300009098 Bacteria 2489
33 Ga0105243_10148925 3300009148 Bacteria 2005
34 Ga0105238_10236517 3300009551 Bacteria 1804
35 Ga0105239_10015119 3300010375 Bacteria 8556
36 Ga0157369_10002414 3300013105 Bacteria 22442
37 Ga0157369_10038714 3300013105 Bacteria 5214
38 Ga0157369_10229613 3300013105 Bacteria 1940
39 Ga0157372_10030957 3300013307 Bacteria 5856
40 Ga0157372_10081838 3300013307 Bacteria 3655
41 Ga0157372_10513228 3300013307 Bacteria 1397
42 Ga0163163_10222181 3300014325 Bacteria 1938
43 Ga0157377_10162056 3300014745 Bacteria 1392
44 Ga0207660_10019667 3300025917 Bacteria 4518
45 Ga0207657_10014816 3300025919 Bacteria 7590
46 Ga0207694_10129502 3300025924 Bacteria 2022
47 Ga0207687_10146002 3300025927 Bacteria 1800
48 Ga0207690_10165379 3300025932 Bacteria 1653
49 Ga0207661_10115282 3300025944 Bacteria 2279
50 Ga0207661_10183933 3300025944 Bacteria 1828
51 Ga0207667_10026046 3300025949 Bacteria 6395
52 Ga0207668_10002980 3300025972 Bacteria 9924
53 Ga0207677_10093707 3300026023 Bacteria 2190
54 Ga0207678_10000279 3300026067 Bacteria 46272
55 Ga0207678_10104418 3300026067 Bacteria 2418
56 Ga0207702_10041247 3300026078 Bacteria 3870
57 Ga0207674_10110566 3300026116 Bacteria 2723
58 Ga0207698_10149551 3300026142 Bacteria 2024
59 Ga0207698_10156434 3300026142 Bacteria 1987
60 Ga0207428_10129699 3300027907 Bacteria 1930
61 Ga0265319_1000580 3300028563 Bacteria 24559
62 Ga0265334_10026880 3300028573 Bacteria 2320
63 Ga0265318_10004985 3300028577 Bacteria 6319
64 Ga0265323_10005168 3300028653 Bacteria 5555
65 Ga0265322_10006461 3300028654 Bacteria 3451
66 Ga0265322_10010729 3300028654 Bacteria 2660
67 Ga0307515_10084085 3300028794 Bacteria 4092
68 Ga0265338_10017691 3300028800 Bacteria 7664
69 Ga0265338_10028045 3300028800 Bacteria 5629
70 Ga0265324_10000610 3300029957 Bacteria 24400
71 Ga0265330_10001613 3300031235 Bacteria 12878
72 Ga0265330_10004457 3300031235 Bacteria 7103
73 Ga0265330_10005630 3300031235 Bacteria 6228
74 Ga0265330_10005866 3300031235 Bacteria 6087
75 Ga0265330_10008310 3300031235 Bacteria 5000
76 Ga0265330_10008903 3300031235 Bacteria 4795
77 Ga0265330_10010685 3300031235 Bacteria 4321
78 Ga0265330_10024391 3300031235 Bacteria 2743
79 Ga0265332_10028426 3300031238 Bacteria 2448
80 Ga0265325_10001010 3300031241 Bacteria 20255
81 Ga0265329_10000410 3300031242 Bacteria 22503
82 Ga0265329_10025822 3300031242 Bacteria 1939
83 Ga0265340_10002197 3300031247 Bacteria 11163
84 Ga0265340_10015227 3300031247 Bacteria 4000
85 Ga0265340_10025414 3300031247 Bacteria 2999
86 Ga0265339_10000014 3300031249 Bacteria 187463
87 Ga0265339_10020510 3300031249 Bacteria 3859
88 Ga0265339_10143007 3300031249 Bacteria 1215
89 Ga0265331_10006851 3300031250 Bacteria 6662
90 Ga0265331_10019036 3300031250 Bacteria 3549
91 Ga0265316_10000046 3300031344 Bacteria 129393
92 Ga0265316_10000243 3300031344 Bacteria 62692
93 Ga0265316_10000640 3300031344 Bacteria 39010
94 Ga0265316_10001114 3300031344 Bacteria 29114
95 Ga0265316_10014182 3300031344 Bacteria 7029
96 Ga0265316_10076118 3300031344 Bacteria 2579
97 Ga0265316_10110712 3300031344 Bacteria 2079
98 Ga0307509_10327671 3300031507 Bacteria 1265
99 Ga0265313_10014423 3300031595 Bacteria 4670
100 Ga0265313_10047419 3300031595 Bacteria 2079
101 Ga0307508_10115113 3300031616 Bacteria 2290
102 Ga0265314_10000213 3300031711 Bacteria 85993
103 Ga0265314_10000650 3300031711 Bacteria 42508
104 Ga0265314_10003770 3300031711 Bacteria 14491
105 Ga0265314_10016501 3300031711 Bacteria 5827
106 Ga0265342_10000634 3300031712 Bacteria 36844
107 Ga0265342_10001561 3300031712 Bacteria 21197
108 Ga0265342_10004290 3300031712 Bacteria 11290
109 Ga0265342_10007436 3300031712 Bacteria 8014
110 Ga0265342_10020979 3300031712 Bacteria 4179
111 Ga0316576_10000433 3300031727 Bacteria 19438
112 Ga0316576_10108730 3300031727 Bacteria 2077
113 Ga0316578_10016160 3300031728 Bacteria 4033
114 Ga0316577_10002808 3300031733 Bacteria 8690
115 Ga0307407_10024362 3300031903 Bacteria 3173
116 Ga0307407_10030243 3300031903 Bacteria 2920
117 Ga0307507_10012902 3300033179 Bacteria 10245
118 Ga0307507_10014669 3300033179 Bacteria 9315
119 Ga0307510_10173575 3300033180 Bacteria 1730
120 Ga0373954_0048778 3300035118 Bacteria 1984
121 Ga0373955_0006232 3300035172 Bacteria 5427
122 Ga0316574_0232488 3300035398 Bacteria 1179
123 Ga0373933_0132735 3300035724 Bacteria 1567
124 Ga0373937_0028063 3300036401 Bacteria 5093
125 Ga0373937_0034392 3300036401 Bacteria 4610
126 Ga0316582_0088590 3300036647 Bacteria 2033
127 Ga0316584_0045445 3300036712 Bacteria 3278
128 Ga0373925_0025170 3300037068 Bacteria 4345
129 Ga0395898_0042534 3300037466 Bacteria 4481
130 Ga0395898_0090245 3300037466 Bacteria 2949
131 Ga0395898_0253709 3300037466 Bacteria 1677
132 Ga0395905_0175680 3300037471 Bacteria 2011
133 Ga0395901_0002042 3300038443 Bacteria 20725
134 Ga0395901_0010697 3300038443 Bacteria 9303
135 Ga0395901_0051745 3300038443 Bacteria 4270
136 Ga0395901_0121084 3300038443 Bacteria 2750
137 Ga0466965_0019123 3300044683 Bacteria 3289
138 Ga0466965_0072197 3300044683 Bacteria 1737
139 Ga0466966_0149372 3300044684 Bacteria 1426
140 Ga0466966_0200769 3300044684 Bacteria 1207
141 Ga0466963_0095566 3300044694 Bacteria 2028
142 Ga0466964_0017444 3300044706 Bacteria 2747
143 Ga0466971_0007680 3300044719 Bacteria 4703
144 Ga0466970_0134955 3300044765 Bacteria 1357
145 Ga0466957_0005891 3300044842 Bacteria 6910
146 Ga0466957_0319864 3300044842 Bacteria 1047
147 Ga0466960_0045569 3300044901 Bacteria 2096
148 Ga0466960_0057803 3300044901 Bacteria 1893
149 Ga0466960_0081876 3300044901 Bacteria 1628
150 Ga0466958_0049415 3300045836 Bacteria 2545
151 Ga0466958_0053314 3300045836 Bacteria 2451
152 Ga0466967_0031679 3300045976 Bacteria 4455
153 Ga0466967_0115759 3300045976 Bacteria 2469
154 Ga0466967_0386735 3300045976 Bacteria 1359
155 Ga0495592_0010649 3300046454 Bacteria 6933
156 Ga0495592_0015554 3300046454 Bacteria 5773
157 Ga0495603_0009390 3300046455 Bacteria 5910
158 Ga0495629_0314201 3300046459 Bacteria 1071
159 Ga0495651_0001084 3300046462 Bacteria 21005
160 Ga0495651_0015471 3300046462 Bacteria 5902
161 Ga0495651_0028253 3300046462 Bacteria 4372
162 Ga0495653_0067599 3300046463 Bacteria 2683
163 Ga0495650_0000188 3300046471 Bacteria 134775
164 Ga0495582_0028498 3300046473 Bacteria 3064
165 Ga0495662_0001092 3300046476 Bacteria 13336
166 Ga0495664_0007932 3300046477 Bacteria 5910
167 Ga0495594_0242867 3300046499 Bacteria 1026
168 Ga0495608_0000389 3300046511 Bacteria 30638
169 Ga0495608_0002731 3300046511 Bacteria 12679
170 Ga0495628_0057447 3300046516 Bacteria 3061
171 Ga0495630_0014912 3300046517 Bacteria 5667
172 Ga0495586_0055753 3300046535 Bacteria 2142
173 Ga0495587_0007459 3300046536 Bacteria 7084
174 Ga0495587_0044787 3300046536 Bacteria 2631
175 Ga0495645_0016133 3300046543 Bacteria 5325
176 Ga0495645_0042700 3300046543 Bacteria 3306
177 Ga0495622_0118264 3300046557 Bacteria 1211
178 Ga0495667_0006100 3300046559 Bacteria 8158
179 Ga0495667_0036029 3300046559 Bacteria 3305
180 Ga0495667_0038164 3300046559 Bacteria 3199
181 Ga0495634_0006610 3300046642 Bacteria 8794
182 Ga0495635_0011488 3300046663 Bacteria 6208
183 Ga0495635_0029901 3300046663 Bacteria 3787
184 Ga0495635_0030402 3300046663 Bacteria 3753
185 Ga0495657_0007384 3300046675 Bacteria 8492
186 Ga0495657_0009671 3300046675 Bacteria 7294
187 Ga0495657_0020747 3300046675 Bacteria 4723
188 Ga0495657_0270980 3300046675 Bacteria 1018
189 Ga0495646_0001046 3300046680 Bacteria 16023
190 Ga0495646_0055118 3300046680 Bacteria 2389
191 Ga0495658_0036474 3300046683 Bacteria 2713
192 Ga0495613_0003712 3300046689 Bacteria 11455
193 Ga0495600_0030819 3300046809 Bacteria 3473
194 Ga0495581_0006810 3300047315 Bacteria 6626
195 Ga0495604_0000410 3300047317 Bacteria 38721
196 Ga0495674_0003012 3300047319 Bacteria 16410
197 Ga0495674_0045307 3300047319 Bacteria 3906
198 Ga0495676_0003902 3300047321 Bacteria 13558
199 Ga0495680_0027449 3300047322 Bacteria 4677
200 Ga0495680_0029664 3300047322 Bacteria 4477
201 Ga0495675_0072715 3300047444 Bacteria 2169
202 Ga0495684_0134493 3300047471 Bacteria 1856
203 Ga0495686_0007172 3300047472 Bacteria 8392
204 Ga0495593_0000306 3300047673 Bacteria 26814
205 Ga0495602_0003747 3300048088 Bacteria 15784
206 Ga0495602_0039704 3300048088 Bacteria 4330
207 Ga0495614_0001434 3300048089 Bacteria 10298
208 Ga0496105_0038820 3300048908 Bacteria 3923
209 Ga0496109_0153725 3300048912 Bacteria 2155
210 Ga0496109_0201876 3300048912 Bacteria 1869
211 Ga0496109_0375258 3300048912 Bacteria 1343
212 Ga0496111_0060069 3300048914 Bacteria 2755
213 Ga0496112_0002688 3300048915 Bacteria 14375
214 Ga0496112_0393584 3300048915 Bacteria 1326
215 Ga0496121_0022114 3300048924 Bacteria 6188
216 Ga0496126_0229250 3300048929 Bacteria 1557
217 Ga0501032_0004041 3300049569 Bacteria 11129
218 Ga0501034_0010038 3300049571 Bacteria 9888
219 Ga0501036_0035759 3300049572 Bacteria 4203
220 Ga0501037_0071358 3300049573 Bacteria 2526
221 Ga0501037_0241398 3300049573 Bacteria 1266
222 Ga0501038_0001868 3300049574 Bacteria 19451
223 Ga0501038_0061869 3300049574 Bacteria 3201
224 Ga0501038_0094135 3300049574 Bacteria 2505
225 Ga0501039_0008107 3300049575 Bacteria 8002
226 Ga0501040_0009950 3300049576 Bacteria 6209
227 Ga0501046_0005122 3300049580 Bacteria 11755
228 Ga0501047_0000088 3300049581 Bacteria 117495
229 Ga0501047_0236925 3300049581 Bacteria 1676
230 Ga0501048_0008967 3300049582 Bacteria 7531
231 Ga0501067_0042732 3300049583 Bacteria 2516
232 Ga0501068_0003079 3300049584 Bacteria 8907
233 Ga0501068_0197379 3300049584 Bacteria 1276
234 Ga0501070_0016312 3300049586 Bacteria 6238
235 Ga0501070_0023306 3300049586 Bacteria 5185
236 Ga0501071_0006726 3300049587 Bacteria 7479
237 Ga0501072_0047973 3300049588 Bacteria 3363
238 Ga0501074_0026861 3300049590 Bacteria 4173
239 Ga0501075_0043029 3300049591 Bacteria 3387
240 Ga0501076_0000352 3300049592 Bacteria 28454
241 Ga0501077_0079291 3300049593 Bacteria 2080
242 Ga0501079_0149833 3300049741 Bacteria 1818
243 Ga0501080_0399976 3300049742 Bacteria 1236
244 Ga0501081_0112080 3300049743 Bacteria 1936
245 Ga0501035_0000177 3300049822 Bacteria 78057
246 Ga0501035_0034753 3300049822 Bacteria 4579
247 Ga0501035_0114396 3300049822 Bacteria 2363
248 Ga0501044_0003260 3300049823 Bacteria 18249
249 Ga0501044_0241596 3300049823 Bacteria 1749
250 Ga0501045_0031767 3300049824 Bacteria 3824
251 nmdc:mga0qj67_9599_c1 3300050509 Bacteria 7213
252 nmdc:mga06r32_249_c6 3300050510 Bacteria 22012
253 nmdc:mga0n895_16454_c1 3300050512 Bacteria 6788
254 nmdc:mga0n895_667708_c1 3300050512 Bacteria 1037
255 nmdc:mga0rr50_20861_c1 3300050513 Bacteria 4461
256 nmdc:mga0a205_193121_c1 3300050515 Bacteria 1927
257 Ga0495612_0068274 3300053078 Bacteria 1479
258 Ga0495595_0022994 3300053084 Bacteria 2741
259 Ga0495619_0034847 3300053085 Bacteria 3273
260 Ga0495619_0051988 3300053085 Bacteria 2708
261 Ga0495619_0056626 3300053085 Bacteria 2599
262 Ga0495619_0181398 3300053085 Bacteria 1456
263 Ga0500640_009671 3300053095 Bacteria 3862
264 Ga0500616_0008068 3300053153 Bacteria 6591
265 Ga0501084_0025493 3300054114 Bacteria 4933
266 Ga0501082_0011286 3300060353 Bacteria 7680
267 Ga0466962_0041935 3300061719 Bacteria 2190
268 Ga0530510_0321206 3300061734 Bacteria 1160
269 2547411623 2547132111 Bacteria 8013147
270 2686536995 2684623035 Bacteria 8032739
271 2729908065 2728369276 Bacteria 5610032
272 2784589389 2784132148 Bacteria 8627943
273 2809233051 2808606448 Bacteria 8656184
274 2856748528 2856741275 Bacteria 8096094
275 2857483005 2857481737 Bacteria 4761446
276 2866616110 2866612099 Bacteria 7543886
277 2868089030 2868088558 Bacteria 7609351
278 2891569515 2891562705 Bacteria 8039471
279 2895883454 2895880812 Bacteria 11255272
280 2899376409 2899370129 Bacteria 6781179
281 2947227277 2947224130 Bacteria 9938529
282 3006500332 3006493962 Bacteria 8825450
283 8003319163 8003314358 Bacteria 10575343
284 8023629567 8023623736 Bacteria 8593882
285 Ga0466960_0000013
286 Ga0070658_10329080
287 Ga0070683_100046076
288 Ga0070680_100031492
289 Ga0068868_100270296
290 Ga0070660_100007261
291 Ga0070691_10039558
292 Ga0070668_100002895
293 Ga0070663_100000592
294 Ga0070681_10050987
295 Ga0070685_10165598
296 Ga0070707_100323302
297 Ga0070698_100001263
298 Ga0070699_100004468
299 Ga0070679_100029034
300 Ga0070684_100003680
301 Ga0070684_100025954
302 Ga0070684_100169004
303 Ga0070696_100002914
304 Ga0070665_100133845
305 Ga0070664_100150385
306 Ga0068857_100186571
307 Ga0068852_100181437
308 Ga0068852_100353257
309 Ga0081455_10003111
310 Ga0081539_10041066
311 Ga0075430_100012387
312 Ga0075431_100186415
313 Ga0075434_100008206
314 Ga0075435_100004410
315 Ga0105240_10045536
316 Ga0105245_10116695
317 Ga0105243_10148925
318 Ga0105238_10236517
319 Ga0105239_10015119
320 Ga0157369_10002414
321 Ga0157369_10038714
322 Ga0157369_10229613
323 Ga0157372_10030957
324 Ga0157372_10081838
325 Ga0157372_10513228
326 Ga0163163_10222181
327 Ga0157377_10162056
328 Ga0207660_10019667
329 Ga0207657_10014816
330 Ga0207694_10129502
331 Ga0207687_10146002
332 Ga0207690_10165379
333 Ga0207661_10115282
334 Ga0207661_10183933
335 Ga0207667_10026046
336 Ga0207668_10002980
337 Ga0207677_10093707
338 Ga0207678_10000279
339 Ga0207678_10104418
340 Ga0207702_10041247
341 Ga0207674_10110566
342 Ga0207698_10149551
343 Ga0207698_10156434
344 Ga0207428_10129699
345 Ga0265319_1000580
346 Ga0265334_10026880
347 Ga0265318_10004985
348 Ga0265323_10005168
349 Ga0265322_10006461
350 Ga0265322_10010729
351 Ga0307515_10084085
352 Ga0265338_10017691
353 Ga0265338_10028045
354 Ga0265324_10000610
355 Ga0265330_10001613
356 Ga0265330_10004457
357 Ga0265330_10005630
358 Ga0265330_10005866
359 Ga0265330_10008310
360 Ga0265330_10008903
361 Ga0265330_10010685
362 Ga0265330_10024391
363 Ga0265332_10028426
364 Ga0265325_10001010
365 Ga0265329_10000410
366 Ga0265329_10025822
367 Ga0265340_10002197
368 Ga0265340_10015227
369 Ga0265340_10025414
370 Ga0265339_10000014
371 Ga0265339_10020510
372 Ga0265339_10143007
373 Ga0265331_10006851
374 Ga0265331_10019036
375 Ga0265316_10000046
376 Ga0265316_10000243
377 Ga0265316_10000640
378 Ga0265316_10001114
379 Ga0265316_10014182
380 Ga0265316_10076118
381 Ga0265316_10110712
382 Ga0307509_10327671
383 Ga0265313_10014423
384 Ga0265313_10047419
385 Ga0307508_10115113
386 Ga0265314_10000213
387 Ga0265314_10000650
388 Ga0265314_10003770
389 Ga0265314_10016501
390 Ga0265342_10000634
391 Ga0265342_10001561
392 Ga0265342_10004290
393 Ga0265342_10007436
394 Ga0265342_10020979
395 Ga0316576_10000433
396 Ga0316576_10108730
397 Ga0316578_10016160
398 Ga0316577_10002808
399 Ga0307407_10024362
400 Ga0307407_10030243
401 Ga0307507_10012902
402 Ga0307507_10014669
403 Ga0307510_10173575
404 Ga0373954_0048778
405 Ga0373955_0006232
406 Ga0316574_0232488
407 Ga0373933_0132735
408 Ga0373937_0028063
409 Ga0373937_0034392
410 Ga0316582_0088590
411 Ga0316584_0045445
412 Ga0373925_0025170
413 Ga0395898_0042534
414 Ga0395898_0090245
415 Ga0395898_0253709
416 Ga0395905_0175680
417 Ga0395901_0002042
418 Ga0395901_0010697
419 Ga0395901_0051745
420 Ga0395901_0121084
421 Ga0466965_0019123
422 Ga0466965_0072197
423 Ga0466966_0149372
424 Ga0466966_0200769
425 Ga0466963_0095566
426 Ga0466964_0017444
427 Ga0466971_0007680
428 Ga0466970_0134955
429 Ga0466957_0005891
430 Ga0466957_0319864
431 Ga0466960_0045569
432 Ga0466960_0057803
433 Ga0466960_0081876
434 Ga0466958_0049415
435 Ga0466958_0053314
436 Ga0466967_0031679
437 Ga0466967_0115759
438 Ga0466967_0386735
439 Ga0495592_0010649
440 Ga0495592_0015554
441 Ga0495603_0009390
442 Ga0495629_0314201
443 Ga0495651_0001084
444 Ga0495651_0015471
445 Ga0495651_0028253
446 Ga0495653_0067599
447 Ga0495650_0000188
448 Ga0495582_0028498
449 Ga0495662_0001092
450 Ga0495664_0007932
451 Ga0495594_0242867
452 Ga0495608_0000389
453 Ga0495608_0002731
454 Ga0495628_0057447
455 Ga0495630_0014912
456 Ga0495586_0055753
457 Ga0495587_0007459
458 Ga0495587_0044787
459 Ga0495645_0016133
460 Ga0495645_0042700
461 Ga0495622_0118264
462 Ga0495667_0006100
463 Ga0495667_0036029
464 Ga0495667_0038164
465 Ga0495634_0006610
466 Ga0495635_0011488
467 Ga0495635_0029901
468 Ga0495635_0030402
469 Ga0495657_0007384
470 Ga0495657_0009671
471 Ga0495657_0020747
472 Ga0495657_0270980
473 Ga0495646_0001046
474 Ga0495646_0055118
475 Ga0495658_0036474
476 Ga0495613_0003712
477 Ga0495600_0030819
478 Ga0495581_0006810
479 Ga0495604_0000410
480 Ga0495674_0003012
481 Ga0495674_0045307
482 Ga0495676_0003902
483 Ga0495680_0027449
484 Ga0495680_0029664
485 Ga0495675_0072715
486 Ga0495684_0134493
487 Ga0495686_0007172
488 Ga0495593_0000306
489 Ga0495602_0003747
490 Ga0495602_0039704
491 Ga0495614_0001434
492 Ga0496105_0038820
493 Ga0496109_0153725
494 Ga0496109_0201876
495 Ga0496109_0375258
496 Ga0496111_0060069
497 Ga0496112_0002688
498 Ga0496112_0393584
499 Ga0496121_0022114
500 Ga0496126_0229250
501 Ga0501032_0004041
502 Ga0501034_0010038
503 Ga0501036_0035759
504 Ga0501037_0071358
505 Ga0501037_0241398
506 Ga0501038_0001868
507 Ga0501038_0061869
508 Ga0501038_0094135
509 Ga0501039_0008107
510 Ga0501040_0009950
511 Ga0501046_0005122
512 Ga0501047_0000088
513 Ga0501047_0236925
514 Ga0501048_0008967
515 Ga0501067_0042732
516 Ga0501068_0003079
517 Ga0501068_0197379
518 Ga0501070_0016312
519 Ga0501070_0023306
520 Ga0501071_0006726
521 Ga0501072_0047973
522 Ga0501074_0026861
523 Ga0501075_0043029
524 Ga0501076_0000352
525 Ga0501077_0079291
526 Ga0501079_0149833
527 Ga0501080_0399976
528 Ga0501081_0112080
529 Ga0501035_0000177
530 Ga0501035_0034753
531 Ga0501035_0114396
532 Ga0501044_0003260
533 Ga0501044_0241596
534 Ga0501045_0031767
535 nmdc:mga0qj67_9599_c1
536 nmdc:mga06r32_249_c6
537 nmdc:mga0n895_16454_c1
538 nmdc:mga0n895_667708_c1
539 nmdc:mga0rr50_20861_c1
540 nmdc:mga0a205_193121_c1
541 Ga0495612_0068274
542 Ga0495595_0022994
543 Ga0495619_0034847
544 Ga0495619_0051988
545 Ga0495619_0056626
546 Ga0495619_0181398
547 Ga0500640_009671
548 Ga0500616_0008068
549 Ga0501084_0025493
550 Ga0501082_0011286
551 Ga0466962_0041935
552 Ga0530510_0321206
553 2547411623
554 2686536995
555 2729908065
556 2784589389
557 2809233051
558 2856748528
559 2857483005
560 2866616110
561 2868089030
562 2891569515
563 2895883454
564 2899376409
565 2947227277
566 3006500332
567 8003319163
568 8023629567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

33

177

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

108

210

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9616 4 225
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9563 2 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9541 2 218
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9532 2 225
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9507 4 225
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.985 3 227 3.40.50.300
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9719 4 225 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9717 5 225 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9678 2 223 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 1 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9904 2 222 GO:0005524
GO:0016887
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9797 1 184 GO:0005524
GO:0016887
AF-A0A2V6WXH7-F1-model_v4 AAA+ ATPase domain-containing protein 0.9786 2 166 GO:0005524
GO:0016887
AF-X1DWV4-F1-model_v4 ABC transporter domain-containing protein 0.9769 3 169 GO:0005524
GO:0016887
AF-A0A536FTK2-F1-model_v4 ABC transporter ATP-binding protein 0.9764 2 222 GO:0005524
GO:0016887

Map