F386204
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 284 | 134 | 282 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10015181|Ga0157378_100151812 |
| Length | 342 |
| Sequence | LLPAKCSDGPFSKRNLPPLLVFSPTIRILKILDPDTRPMPSTAPQKTCIVIAGPTAVGKTTVAISLAQHFKTSIISADSRQCFKELNIGVAKPTAEQLQQVKHYFINSHSIFEEINAGMFEQYALNAVNEIFVKHDIAVMVGGTGLYIRAFCDGMDAIPSADPNLRNEINARYSNDGLDWLQNEIKERDPAWYAVGEIQNPQRIMRALEVVMHTGKSILSFQQAVKAERNFNIVKIGLALPRNELYQHINQRVDEMMGAGLEDEVRLLQRYRHLNALQTVGYKEMFEYIDGQADMQQAIENIKRNTRHYAKRQLTWFTKDESIHWFSPIDYNQLINYLRNLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 132 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.7 |
| Nodule | 0 |
| Rhizoplane | 0.35 |
| Rhizosphere | 96.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10013110 | 3300003320 | Bacteria | 45132 |
| 2 | Ga0070658_10036180 | 3300005327 | Bacteria | 3978 |
| 3 | Ga0070658_10065901 | 3300005327 | Bacteria | 2957 |
| 4 | Ga0070658_10155592 | 3300005327 | Bacteria | 1916 |
| 5 | Ga0070676_10021643 | 3300005328 | Bacteria | 3601 |
| 6 | Ga0070683_100038857 | 3300005329 | Bacteria | 4365 |
| 7 | Ga0070683_100470359 | 3300005329 | Bacteria | 1200 |
| 8 | Ga0070670_100032305 | 3300005331 | Bacteria | 4508 |
| 9 | Ga0070670_100081130 | 3300005331 | Bacteria | 2787 |
| 10 | Ga0070670_100144405 | 3300005331 | Bacteria | 2058 |
| 11 | Ga0070670_100469347 | 3300005331 | Bacteria | 1117 |
| 12 | Ga0068869_100075820 | 3300005334 | Bacteria | 2499 |
| 13 | Ga0068869_100223883 | 3300005334 | Bacteria | 1492 |
| 14 | Ga0070666_10000411 | 3300005335 | Bacteria | 26651 |
| 15 | Ga0070666_10001617 | 3300005335 | Bacteria | 13695 |
| 16 | Ga0070680_100008310 | 3300005336 | Bacteria | 7943 |
| 17 | Ga0070680_100099721 | 3300005336 | Bacteria | 2410 |
| 18 | Ga0070682_100050914 | 3300005337 | Bacteria | 2587 |
| 19 | Ga0068868_100018242 | 3300005338 | Bacteria | 5243 |
| 20 | Ga0070660_100001807 | 3300005339 | Bacteria | 14682 |
| 21 | Ga0070660_100014375 | 3300005339 | Bacteria | 5699 |
| 22 | Ga0070660_100055030 | 3300005339 | Bacteria | 3074 |
| 23 | Ga0070668_100013739 | 3300005347 | Bacteria | 6048 |
| 24 | Ga0070668_100139170 | 3300005347 | Bacteria | 1955 |
| 25 | Ga0070668_100232795 | 3300005347 | Bacteria | 1524 |
| 26 | Ga0070675_100052633 | 3300005354 | Bacteria | 3348 |
| 27 | Ga0070673_100040758 | 3300005364 | Bacteria | 3565 |
| 28 | Ga0070673_100104377 | 3300005364 | Bacteria | 2340 |
| 29 | Ga0070659_100015370 | 3300005366 | Bacteria | 5733 |
| 30 | Ga0070659_100021015 | 3300005366 | Bacteria | 4964 |
| 31 | Ga0070659_100044601 | 3300005366 | Bacteria | 3472 |
| 32 | Ga0070667_100000492 | 3300005367 | Bacteria | 40164 |
| 33 | Ga0070667_100020208 | 3300005367 | Bacteria | 5529 |
| 34 | Ga0070663_100026443 | 3300005455 | Unclassified | 3931 |
| 35 | Ga0070681_10025480 | 3300005458 | Bacteria | 5949 |
| 36 | Ga0068867_100062935 | 3300005459 | Bacteria | 2758 |
| 37 | Ga0068867_100070176 | 3300005459 | Bacteria | 2619 |
| 38 | Ga0068867_100084485 | 3300005459 | Bacteria | 2398 |
| 39 | Ga0070679_100000706 | 3300005530 | Bacteria | 28666 |
| 40 | Ga0070679_100042591 | 3300005530 | Bacteria | 4522 |
| 41 | Ga0070679_100521261 | 3300005530 | Bacteria | 1132 |
| 42 | Ga0068853_100016523 | 3300005539 | Bacteria | 6076 |
| 43 | Ga0068853_100109571 | 3300005539 | Bacteria | 2451 |
| 44 | Ga0070672_100002526 | 3300005543 | Bacteria | 11648 |
| 45 | Ga0070672_100111740 | 3300005543 | Bacteria | 2228 |
| 46 | Ga0070672_100504071 | 3300005543 | Unclassified | 1047 |
| 47 | Ga0070665_100006195 | 3300005548 | Bacteria | 12241 |
| 48 | Ga0070665_100132708 | 3300005548 | Unclassified | 2492 |
| 49 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 50 | Ga0068855_100005142 | 3300005563 | Bacteria | 15957 |
| 51 | Ga0070664_100013842 | 3300005564 | Bacteria | 6576 |
| 52 | Ga0070664_100323862 | 3300005564 | Bacteria | 1397 |
| 53 | Ga0068857_100343367 | 3300005577 | Bacteria | 1381 |
| 54 | Ga0068857_100430503 | 3300005577 | Bacteria | 1231 |
| 55 | Ga0068854_100417530 | 3300005578 | Bacteria | 1114 |
| 56 | Ga0068856_100025818 | 3300005614 | Bacteria | 5729 |
| 57 | Ga0068856_100639827 | 3300005614 | Bacteria | 1084 |
| 58 | Ga0068852_100002092 | 3300005616 | Bacteria | 13644 |
| 59 | Ga0068852_100132510 | 3300005616 | Bacteria | 2297 |
| 60 | Ga0068852_100223008 | 3300005616 | Bacteria | 1794 |
| 61 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 62 | Ga0068859_100027856 | 3300005617 | Bacteria | 5666 |
| 63 | Ga0068859_100049111 | 3300005617 | Unclassified | 4238 |
| 64 | Ga0068864_100002625 | 3300005618 | Bacteria | 14840 |
| 65 | Ga0068864_100014449 | 3300005618 | Bacteria | 6559 |
| 66 | Ga0068864_100039256 | 3300005618 | Bacteria | 4046 |
| 67 | Ga0068861_100014552 | 3300005719 | Bacteria | 5523 |
| 68 | Ga0068861_100089067 | 3300005719 | Bacteria | 2432 |
| 69 | Ga0068861_100170231 | 3300005719 | Bacteria | 1805 |
| 70 | Ga0068851_10018455 | 3300005834 | Bacteria | 3360 |
| 71 | Ga0068863_100026690 | 3300005841 | Bacteria | 5507 |
| 72 | Ga0068863_100041642 | 3300005841 | Bacteria | 4367 |
| 73 | Ga0068863_100220165 | 3300005841 | Bacteria | 1829 |
| 74 | Ga0068858_100005957 | 3300005842 | Bacteria | 11905 |
| 75 | Ga0068858_100034522 | 3300005842 | Bacteria | 4692 |
| 76 | Ga0068860_100003371 | 3300005843 | Bacteria | 16433 |
| 77 | Ga0068860_100015281 | 3300005843 | Bacteria | 7497 |
| 78 | Ga0068860_100102965 | 3300005843 | Bacteria | 2725 |
| 79 | Ga0070716_100072959 | 3300006173 | Bacteria | 2023 |
| 80 | Ga0097621_100018082 | 3300006237 | Bacteria | 5375 |
| 81 | Ga0097621_100050613 | 3300006237 | Bacteria | 3379 |
| 82 | Ga0068871_100004953 | 3300006358 | Bacteria | 9305 |
| 83 | Ga0068865_100019896 | 3300006881 | Bacteria | 4349 |
| 84 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 85 | Ga0097620_100027855 | 3300006931 | Bacteria | 5666 |
| 86 | Ga0097620_100049111 | 3300006931 | Unclassified | 4238 |
| 87 | Ga0105240_10061437 | 3300009093 | Bacteria | 4682 |
| 88 | Ga0105240_10219871 | 3300009093 | Bacteria | 2213 |
| 89 | Ga0105240_10351408 | 3300009093 | Bacteria | 1672 |
| 90 | Ga0105247_10014543 | 3300009101 | Bacteria | 4720 |
| 91 | Ga0105247_10023765 | 3300009101 | Bacteria | 3694 |
| 92 | Ga0105243_10099604 | 3300009148 | Bacteria | 2409 |
| 93 | Ga0105241_10001055 | 3300009174 | Bacteria | 20990 |
| 94 | Ga0105241_10342074 | 3300009174 | Unclassified | 1296 |
| 95 | Ga0105241_10502299 | 3300009174 | Bacteria | 1081 |
| 96 | Ga0105242_10120076 | 3300009176 | Unclassified | 2254 |
| 97 | Ga0105248_10224207 | 3300009177 | Bacteria | 2116 |
| 98 | Ga0105237_10001973 | 3300009545 | Bacteria | 26110 |
| 99 | Ga0105249_10001713 | 3300009553 | Bacteria | 19174 |
| 100 | Ga0105239_10001797 | 3300010375 | Bacteria | 28154 |
| 101 | Ga0105239_10119293 | 3300010375 | Bacteria | 2928 |
| 102 | Ga0105246_10132416 | 3300011119 | Unclassified | 1864 |
| 103 | Ga0157373_10017119 | 3300013100 | Bacteria | 5278 |
| 104 | Ga0157373_10078199 | 3300013100 | Unclassified | 2333 |
| 105 | Ga0157371_10001159 | 3300013102 | Bacteria | 28365 |
| 106 | Ga0157371_10014577 | 3300013102 | Bacteria | 5926 |
| 107 | Ga0157371_10029223 | 3300013102 | Bacteria | 3989 |
| 108 | Ga0157371_10053429 | 3300013102 | Bacteria | 2869 |
| 109 | Ga0157371_10085787 | 3300013102 | Bacteria | 2230 |
| 110 | Ga0157370_10001240 | 3300013104 | Bacteria | 31893 |
| 111 | Ga0157370_10003395 | 3300013104 | Bacteria | 18708 |
| 112 | Ga0157370_10005976 | 3300013104 | Bacteria | 13544 |
| 113 | Ga0157370_10279061 | 3300013104 | Unclassified | 1544 |
| 114 | Ga0157370_10306931 | 3300013104 | Unclassified | 1464 |
| 115 | Ga0157369_10028941 | 3300013105 | Bacteria | 6128 |
| 116 | Ga0157369_10064791 | 3300013105 | Bacteria | 3935 |
| 117 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 118 | Ga0157374_10060398 | 3300013296 | Bacteria | 3547 |
| 119 | Ga0157374_10104683 | 3300013296 | Bacteria | 2717 |
| 120 | Ga0157374_10222350 | 3300013296 | Bacteria | 1853 |
| 121 | Ga0157378_10015181 | 3300013297 | Bacteria | 6743 |
| 122 | Ga0157378_10021845 | 3300013297 | Bacteria | 5627 |
| 123 | Ga0157378_10516803 | 3300013297 | Bacteria | 1195 |
| 124 | Ga0163162_10001596 | 3300013306 | Bacteria | 21205 |
| 125 | Ga0163162_10009349 | 3300013306 | Bacteria | 9532 |
| 126 | Ga0163162_10009773 | 3300013306 | Bacteria | 9339 |
| 127 | Ga0163162_10026265 | 3300013306 | Bacteria | 5755 |
| 128 | Ga0163162_10354909 | 3300013306 | Unclassified | 1599 |
| 129 | Ga0157372_10002466 | 3300013307 | Bacteria | 20053 |
| 130 | Ga0157372_10026619 | 3300013307 | Bacteria | 6294 |
| 131 | Ga0157372_10051150 | 3300013307 | Bacteria | 4597 |
| 132 | Ga0157372_10065369 | 3300013307 | Bacteria | 4084 |
| 133 | Ga0157372_10069353 | 3300013307 | Bacteria | 3965 |
| 134 | Ga0157372_10127401 | 3300013307 | Bacteria | 2927 |
| 135 | Ga0157372_10144970 | 3300013307 | Bacteria | 2738 |
| 136 | Ga0157372_10395250 | 3300013307 | Bacteria | 1611 |
| 137 | Ga0157375_10015790 | 3300013308 | Bacteria | 6766 |
| 138 | Ga0157375_10039446 | 3300013308 | Bacteria | 4546 |
| 139 | Ga0163163_10013034 | 3300014325 | Bacteria | 7590 |
| 140 | Ga0163163_10092376 | 3300014325 | Bacteria | 3041 |
| 141 | Ga0163163_10099050 | 3300014325 | Unclassified | 2936 |
| 142 | Ga0157377_10010516 | 3300014745 | Bacteria | 4579 |
| 143 | Ga0157379_10043267 | 3300014968 | Bacteria | 4021 |
| 144 | Ga0157376_10006718 | 3300014969 | Bacteria | 8144 |
| 145 | Ga0157376_10009201 | 3300014969 | Bacteria | 7166 |
| 146 | Ga0157376_10029531 | 3300014969 | Bacteria | 4367 |
| 147 | Ga0157376_10051924 | 3300014969 | Bacteria | 3407 |
| 148 | Ga0157376_10196564 | 3300014969 | Bacteria | 1853 |
| 149 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 150 | Ga0207656_10029921 | 3300025321 | Bacteria | 2246 |
| 151 | Ga0207710_10012180 | 3300025900 | Bacteria | 3616 |
| 152 | Ga0207680_10000619 | 3300025903 | Bacteria | 16749 |
| 153 | Ga0207680_10024200 | 3300025903 | Bacteria | 3328 |
| 154 | Ga0207645_10037528 | 3300025907 | Bacteria | 3109 |
| 155 | Ga0207645_10069851 | 3300025907 | Bacteria | 2247 |
| 156 | Ga0207705_10018057 | 3300025909 | Bacteria | 5044 |
| 157 | Ga0207705_10027120 | 3300025909 | Bacteria | 4083 |
| 158 | Ga0207705_10028345 | 3300025909 | Bacteria | 3991 |
| 159 | Ga0207705_10074698 | 3300025909 | Bacteria | 2461 |
| 160 | Ga0207654_10001155 | 3300025911 | Bacteria | 14200 |
| 161 | Ga0207707_10008847 | 3300025912 | Bacteria | 8745 |
| 162 | Ga0207695_10386526 | 3300025913 | Bacteria | 1284 |
| 163 | Ga0207671_10002513 | 3300025914 | Bacteria | 19573 |
| 164 | Ga0207660_10008407 | 3300025917 | Bacteria | 6678 |
| 165 | Ga0207657_10030180 | 3300025919 | Bacteria | 4924 |
| 166 | Ga0207657_10032558 | 3300025919 | Bacteria | 4708 |
| 167 | Ga0207657_10370051 | 3300025919 | Bacteria | 1129 |
| 168 | Ga0207652_10000329 | 3300025921 | Bacteria | 49068 |
| 169 | Ga0207652_10009475 | 3300025921 | Bacteria | 7828 |
| 170 | Ga0207650_10001164 | 3300025925 | Bacteria | 19325 |
| 171 | Ga0207650_10058928 | 3300025925 | Bacteria | 2860 |
| 172 | Ga0207650_10109201 | 3300025925 | Unclassified | 2139 |
| 173 | Ga0207687_10157042 | 3300025927 | Bacteria | 1741 |
| 174 | Ga0207690_10020112 | 3300025932 | Bacteria | 4120 |
| 175 | Ga0207690_10111080 | 3300025932 | Bacteria | 1974 |
| 176 | Ga0207704_10355672 | 3300025938 | Bacteria | 1142 |
| 177 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 178 | Ga0207691_10010249 | 3300025940 | Bacteria | 8991 |
| 179 | Ga0207691_10408311 | 3300025940 | Bacteria | 1158 |
| 180 | Ga0207689_10011904 | 3300025942 | Bacteria | 7454 |
| 181 | Ga0207689_10021440 | 3300025942 | Bacteria | 5431 |
| 182 | Ga0207689_10037316 | 3300025942 | Bacteria | 4030 |
| 183 | Ga0207689_10381969 | 3300025942 | Unclassified | 1173 |
| 184 | Ga0207661_10195874 | 3300025944 | Bacteria | 1774 |
| 185 | Ga0207667_10000508 | 3300025949 | Bacteria | 51422 |
| 186 | Ga0207667_10005263 | 3300025949 | Bacteria | 15781 |
| 187 | Ga0207667_10043550 | 3300025949 | Bacteria | 4763 |
| 188 | Ga0207667_10083884 | 3300025949 | Bacteria | 3299 |
| 189 | Ga0207651_10071275 | 3300025960 | Bacteria | 2462 |
| 190 | Ga0207712_10011771 | 3300025961 | Bacteria | 5578 |
| 191 | Ga0207668_10000540 | 3300025972 | Bacteria | 23750 |
| 192 | Ga0207668_10020729 | 3300025972 | Bacteria | 4184 |
| 193 | Ga0207640_10163388 | 3300025981 | Bacteria | 1650 |
| 194 | Ga0207658_10000946 | 3300025986 | Bacteria | 23945 |
| 195 | Ga0207658_10059247 | 3300025986 | Bacteria | 2852 |
| 196 | Ga0207677_10016914 | 3300026023 | Bacteria | 4332 |
| 197 | Ga0207703_10010311 | 3300026035 | Bacteria | 7316 |
| 198 | Ga0207703_10020309 | 3300026035 | Bacteria | 5194 |
| 199 | Ga0207639_10062337 | 3300026041 | Bacteria | 2883 |
| 200 | Ga0207639_10100977 | 3300026041 | Unclassified | 2331 |
| 201 | Ga0207678_10009788 | 3300026067 | Bacteria | 8431 |
| 202 | Ga0207678_10223134 | 3300026067 | Unclassified | 1613 |
| 203 | Ga0207678_10320314 | 3300026067 | Bacteria | 1334 |
| 204 | Ga0207641_10000226 | 3300026088 | Bacteria | 72539 |
| 205 | Ga0207641_10014758 | 3300026088 | Bacteria | 6405 |
| 206 | Ga0207641_10085072 | 3300026088 | Bacteria | 2755 |
| 207 | Ga0207648_10009139 | 3300026089 | Bacteria | 9526 |
| 208 | Ga0207648_10020419 | 3300026089 | Bacteria | 5964 |
| 209 | Ga0207676_10001871 | 3300026095 | Bacteria | 15411 |
| 210 | Ga0207674_10068927 | 3300026116 | Bacteria | 3558 |
| 211 | Ga0207674_10400942 | 3300026116 | Bacteria | 1326 |
| 212 | Ga0207674_10459234 | 3300026116 | Bacteria | 1231 |
| 213 | Ga0207675_100052126 | 3300026118 | Bacteria | 3818 |
| 214 | Ga0207683_10213341 | 3300026121 | Unclassified | 1757 |
| 215 | Ga0207698_10020543 | 3300026142 | Bacteria | 4548 |
| 216 | Ga0207698_10022360 | 3300026142 | Bacteria | 4392 |
| 217 | Ga0207698_10064831 | 3300026142 | Bacteria | 2865 |
| 218 | Ga0207698_10217489 | 3300026142 | Bacteria | 1724 |
| 219 | Ga0268266_10173466 | 3300028379 | Unclassified | 1958 |
| 220 | Ga0268264_10006865 | 3300028381 | Bacteria | 9557 |
| 221 | Ga0268264_10020176 | 3300028381 | Bacteria | 5447 |
| 222 | Ga0265322_10000052 | 3300028654 | Bacteria | 58413 |
| 223 | Ga0307515_10002910 | 3300028794 | Bacteria | 36374 |
| 224 | Ga0265338_10003582 | 3300028800 | Bacteria | 21685 |
| 225 | Ga0265338_10087857 | 3300028800 | Bacteria | 2582 |
| 226 | Ga0265324_10061997 | 3300029957 | Unclassified | 1277 |
| 227 | Ga0265327_10000084 | 3300031251 | Bacteria | 204433 |
| 228 | Ga0307509_10028479 | 3300031507 | Bacteria | 6209 |
| 229 | Ga0307509_10123587 | 3300031507 | Bacteria | 2560 |
| 230 | Ga0395899_0006390 | 3300037312 | Bacteria | 9129 |
| 231 | Ga0395899_0019032 | 3300037312 | Bacteria | 5218 |
| 232 | Ga0395899_0024270 | 3300037312 | Bacteria | 4585 |
| 233 | Ga0395899_0062044 | 3300037312 | Bacteria | 2752 |
| 234 | Ga0395900_0000203 | 3300037418 | Bacteria | 93536 |
| 235 | Ga0395900_0021588 | 3300037418 | Bacteria | 6582 |
| 236 | Ga0395900_0025169 | 3300037418 | Bacteria | 6093 |
| 237 | Ga0395900_0041092 | 3300037418 | Bacteria | 4769 |
| 238 | Ga0395900_0050912 | 3300037418 | Bacteria | 4265 |
| 239 | Ga0395900_0061713 | 3300037418 | Bacteria | 3853 |
| 240 | Ga0395900_0127726 | 3300037418 | Bacteria | 2606 |
| 241 | Ga0395898_0001285 | 3300037466 | Bacteria | 36916 |
| 242 | Ga0395898_0028083 | 3300037466 | Bacteria | 5642 |
| 243 | Ga0395898_0042489 | 3300037466 | Bacteria | 4484 |
| 244 | Ga0395898_0067023 | 3300037466 | Bacteria | 3476 |
| 245 | Ga0395898_0078449 | 3300037466 | Bacteria | 3186 |
| 246 | Ga0395905_0004912 | 3300037471 | Bacteria | 13770 |
| 247 | Ga0395905_0013771 | 3300037471 | Bacteria | 7742 |
| 248 | Ga0395905_0016054 | 3300037471 | Bacteria | 7118 |
| 249 | Ga0395905_0511012 | 3300037471 | Bacteria | 1102 |
| 250 | Ga0395901_0002230 | 3300038443 | Bacteria | 19784 |
| 251 | Ga0395901_0021720 | 3300038443 | Bacteria | 6576 |
| 252 | Ga0395901_0069433 | 3300038443 | Bacteria | 3669 |
| 253 | Ga0451807_2315102 | 3300041486 | Bacteria | 1037 |
| 254 | Ga0451577_0000564 | 3300042876 | Bacteria | 60330 |
| 255 | Ga0451577_0000614 | 3300042876 | Bacteria | 57427 |
| 256 | Ga0453683_0000718 | 3300044673 | Bacteria | 34148 |
| 257 | Ga0453684_0000160 | 3300044712 | Bacteria | 299297 |
| 258 | Ga0453684_0001797 | 3300044712 | Bacteria | 56922 |
| 259 | Ga0453684_0011639 | 3300044712 | Bacteria | 14689 |
| 260 | Ga0453684_0298905 | 3300044712 | Bacteria | 1830 |
| 261 | Ga0453684_0327192 | 3300044712 | Bacteria | 1734 |
| 262 | Ga0501032_0004185 | 3300049569 | Bacteria | 10930 |
| 263 | Ga0501034_0000373 | 3300049571 | Bacteria | 76337 |
| 264 | Ga0501034_0002222 | 3300049571 | Bacteria | 23945 |
| 265 | Ga0501034_0281540 | 3300049571 | Bacteria | 1602 |
| 266 | Ga0501036_0034598 | 3300049572 | Bacteria | 4274 |
| 267 | Ga0501036_0132545 | 3300049572 | Bacteria | 2103 |
| 268 | Ga0501037_0003388 | 3300049573 | Bacteria | 11590 |
| 269 | Ga0501038_0017914 | 3300049574 | Bacteria | 6399 |
| 270 | Ga0501038_0262017 | 3300049574 | Bacteria | 1366 |
| 271 | Ga0501039_0054580 | 3300049575 | Bacteria | 3093 |
| 272 | Ga0501043_0011232 | 3300049579 | Bacteria | 7015 |
| 273 | Ga0501043_0147771 | 3300049579 | Bacteria | 1840 |
| 274 | Ga0501047_0011539 | 3300049581 | Bacteria | 8364 |
| 275 | Ga0501048_0190879 | 3300049582 | Bacteria | 1452 |
| 276 | Ga0501070_0149535 | 3300049586 | Unclassified | 1927 |
| 277 | Ga0501259_000490 | 3300049688 | Bacteria | 6332 |
| 278 | Ga0501035_0012462 | 3300049822 | Bacteria | 7857 |
| 279 | Ga0501035_0057807 | 3300049822 | Bacteria | 3458 |
| 280 | Ga0501035_0169348 | 3300049822 | Bacteria | 1888 |
| 281 | Ga0501044_0007421 | 3300049823 | Bacteria | 12060 |
| 282 | Ga0500562_000040 | 3300053108 | Bacteria | 69393 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0327192 | Ga0453684_0327192_27_917 | 276 |
| 2 | 3300009174 | Ga0105241_10502299 | Ga0105241_105022992 | 278 |
| 3 | 3300041486 | Ga0451807_2315102 | Ga0451807_2315102_138_1004 | 278 |
| 4 | 3300005329 | Ga0070683_100470359 | Ga0070683_1004703591 | 279 |
| 5 | 3300005618 | Ga0068864_100039256 | Ga0068864_1000392562 | 279 |
| 6 | 3300005843 | Ga0068860_100003371 | Ga0068860_10000337110 | 279 |
| 7 | 3300013104 | Ga0157370_10005976 | Ga0157370_100059763 | 279 |
| 8 | 3300025942 | Ga0207689_10037316 | Ga0207689_100373163 | 279 |
| 9 | 3300005337 | Ga0070682_100050914 | Ga0070682_1000509143 | 280 |
| 10 | 3300005339 | Ga0070660_100014375 | Ga0070660_1000143753 | 280 |
| 11 | 3300005530 | Ga0070679_100000706 | Ga0070679_10000070616 | 280 |
| 12 | 3300005614 | Ga0068856_100639827 | Ga0068856_1006398271 | 280 |
| 13 | 3300005616 | Ga0068852_100002092 | Ga0068852_1000020927 | 280 |
| 14 | 3300005616 | Ga0068852_100223008 | Ga0068852_1002230082 | 280 |
| 15 | 3300013100 | Ga0157373_10017119 | Ga0157373_100171196 | 280 |
| 16 | 3300013102 | Ga0157371_10001159 | Ga0157371_100011593 | 280 |
| 17 | 3300013102 | Ga0157371_10014577 | Ga0157371_100145772 | 280 |
| 18 | 3300013307 | Ga0157372_10002466 | Ga0157372_1000246614 | 280 |
| 19 | 3300013307 | Ga0157372_10026619 | Ga0157372_100266193 | 280 |
| 20 | 3300025909 | Ga0207705_10028345 | Ga0207705_100283454 | 280 |
| 21 | 3300025919 | Ga0207657_10370051 | Ga0207657_103700511 | 280 |
| 22 | 3300025921 | Ga0207652_10009475 | Ga0207652_100094755 | 280 |
| 23 | 3300026142 | Ga0207698_10022360 | Ga0207698_100223603 | 280 |
| 24 | 3300037312 | Ga0395899_0024270 | Ga0395899_0024270_222_1064 | 280 |
| 25 | 3300037418 | Ga0395900_0050912 | Ga0395900_0050912_3353_4195 | 280 |
| 26 | 3300037418 | Ga0395900_0061713 | Ga0395900_0061713_1816_2658 | 280 |
| 27 | 3300037466 | Ga0395898_0067023 | Ga0395898_0067023_2413_3255 | 280 |
| 28 | 3300037471 | Ga0395905_0013771 | Ga0395905_0013771_4847_5689 | 280 |
| 29 | 3300005548 | Ga0070665_100132708 | Ga0070665_1001327083 | 281 |
| 30 | 3300049569 | Ga0501032_0004185 | Ga0501032_0004185_3744_4595 | 281 |
| 31 | 3300049571 | Ga0501034_0002222 | Ga0501034_0002222_5497_6348 | 281 |
| 32 | 3300049572 | Ga0501036_0132545 | Ga0501036_0132545_1023_1874 | 281 |
| 33 | 3300049573 | Ga0501037_0003388 | Ga0501037_0003388_1312_2163 | 281 |
| 34 | 3300049574 | Ga0501038_0017914 | Ga0501038_0017914_157_1008 | 281 |
| 35 | 3300049575 | Ga0501039_0054580 | Ga0501039_0054580_2185_3036 | 281 |
| 36 | 3300049579 | Ga0501043_0011232 | Ga0501043_0011232_4528_5379 | 281 |
| 37 | 3300049581 | Ga0501047_0011539 | Ga0501047_0011539_2939_3790 | 281 |
| 38 | 3300049582 | Ga0501048_0190879 | Ga0501048_0190879_280_1131 | 281 |
| 39 | 3300049822 | Ga0501035_0057807 | Ga0501035_0057807_148_999 | 281 |
| 40 | 3300049823 | Ga0501044_0007421 | Ga0501044_0007421_9326_10177 | 281 |
| 41 | 3300005327 | Ga0070658_10036180 | Ga0070658_100361802 | 282 |
| 42 | 3300005327 | Ga0070658_10155592 | Ga0070658_101555922 | 282 |
| 43 | 3300005336 | Ga0070680_100008310 | Ga0070680_1000083103 | 282 |
| 44 | 3300005339 | Ga0070660_100055030 | Ga0070660_1000550303 | 282 |
| 45 | 3300005455 | Ga0070663_100026443 | Ga0070663_1000264432 | 282 |
| 46 | 3300005458 | Ga0070681_10025480 | Ga0070681_100254804 | 282 |
| 47 | 3300005530 | Ga0070679_100042591 | Ga0070679_1000425912 | 282 |
| 48 | 3300005563 | Ga0068855_100000145 | Ga0068855_10000014517 | 282 |
| 49 | 3300005614 | Ga0068856_100025818 | Ga0068856_1000258187 | 282 |
| 50 | 3300009093 | Ga0105240_10351408 | Ga0105240_103514081 | 282 |
| 51 | 3300013102 | Ga0157371_10029223 | Ga0157371_100292233 | 282 |
| 52 | 3300013102 | Ga0157371_10085787 | Ga0157371_100857873 | 282 |
| 53 | 3300013104 | Ga0157370_10003395 | Ga0157370_100033956 | 282 |
| 54 | 3300013104 | Ga0157370_10306931 | Ga0157370_103069312 | 282 |
| 55 | 3300013105 | Ga0157369_10064791 | Ga0157369_100647913 | 282 |
| 56 | 3300013307 | Ga0157372_10065369 | Ga0157372_100653693 | 282 |
| 57 | 3300013307 | Ga0157372_10069353 | Ga0157372_100693533 | 282 |
| 58 | 3300013307 | Ga0157372_10395250 | Ga0157372_103952502 | 282 |
| 59 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002279 | 282 |
| 60 | 3300025909 | Ga0207705_10027120 | Ga0207705_100271203 | 282 |
| 61 | 3300025909 | Ga0207705_10074698 | Ga0207705_100746982 | 282 |
| 62 | 3300025912 | Ga0207707_10008847 | Ga0207707_100088477 | 282 |
| 63 | 3300025917 | Ga0207660_10008407 | Ga0207660_100084076 | 282 |
| 64 | 3300025921 | Ga0207652_10000329 | Ga0207652_1000032911 | 282 |
| 65 | 3300025944 | Ga0207661_10195874 | Ga0207661_101958742 | 282 |
| 66 | 3300025949 | Ga0207667_10000508 | Ga0207667_1000050844 | 282 |
| 67 | 3300026067 | Ga0207678_10009788 | Ga0207678_100097885 | 282 |
| 68 | 3300026067 | Ga0207678_10320314 | Ga0207678_103203142 | 282 |
| 69 | 3300037312 | Ga0395899_0006390 | Ga0395899_0006390_780_1628 | 282 |
| 70 | 3300037312 | Ga0395899_0019032 | Ga0395899_0019032_2358_3206 | 282 |
| 71 | 3300037418 | Ga0395900_0000203 | Ga0395900_0000203_36911_37759 | 282 |
| 72 | 3300037418 | Ga0395900_0025169 | Ga0395900_0025169_3257_4105 | 282 |
| 73 | 3300037418 | Ga0395900_0127726 | Ga0395900_0127726_1372_2220 | 282 |
| 74 | 3300037466 | Ga0395898_0001285 | Ga0395898_0001285_14046_14894 | 282 |
| 75 | 3300037466 | Ga0395898_0028083 | Ga0395898_0028083_2795_3643 | 282 |
| 76 | 3300037466 | Ga0395898_0042489 | Ga0395898_0042489_2376_3224 | 282 |
| 77 | 3300038443 | Ga0395901_0002230 | Ga0395901_0002230_11041_11889 | 282 |
| 78 | 3300038443 | Ga0395901_0069433 | Ga0395901_0069433_807_1655 | 282 |
| 79 | 3300049571 | Ga0501034_0000373 | Ga0501034_0000373_10061_10957 | 282 |
| 80 | 3300049574 | Ga0501038_0262017 | Ga0501038_0262017_134_985 | 283 |
| 81 | 3300005366 | Ga0070659_100015370 | Ga0070659_1000153702 | 284 |
| 82 | 3300005577 | Ga0068857_100343367 | Ga0068857_1003433672 | 284 |
| 83 | 3300025919 | Ga0207657_10030180 | Ga0207657_100301804 | 284 |
| 84 | 3300025932 | Ga0207690_10020112 | Ga0207690_100201122 | 284 |
| 85 | 3300026116 | Ga0207674_10400942 | Ga0207674_104009422 | 284 |
| 86 | 3300042876 | Ga0451577_0000564 | Ga0451577_0000564_37592_38542 | 284 |
| 87 | 3300044712 | Ga0453684_0000160 | Ga0453684_0000160_125271_126221 | 284 |
| 88 | 3300044712 | Ga0453684_0298905 | Ga0453684_0298905_654_1607 | 285 |
| 89 | 3300005336 | Ga0070680_100099721 | Ga0070680_1000997212 | 286 |
| 90 | 3300005366 | Ga0070659_100021015 | Ga0070659_1000210154 | 286 |
| 91 | 3300005530 | Ga0070679_100521261 | Ga0070679_1005212611 | 286 |
| 92 | 3300013102 | Ga0157371_10053429 | Ga0157371_100534292 | 286 |
| 93 | 3300013104 | Ga0157370_10279061 | Ga0157370_102790612 | 286 |
| 94 | 3300013105 | Ga0157369_10028941 | Ga0157369_100289415 | 286 |
| 95 | 3300025919 | Ga0207657_10032558 | Ga0207657_100325583 | 286 |
| 96 | 3300025932 | Ga0207690_10111080 | Ga0207690_101110802 | 286 |
| 97 | 3300025949 | Ga0207667_10043550 | Ga0207667_100435503 | 286 |
| 98 | 3300049571 | Ga0501034_0281540 | Ga0501034_0281540_451_1311 | 286 |
| 99 | 3300049586 | Ga0501070_0149535 | Ga0501070_0149535_890_1750 | 286 |
| 100 | 3300049822 | Ga0501035_0169348 | Ga0501035_0169348_307_1167 | 286 |
| 101 | 3300005331 | Ga0070670_100469347 | Ga0070670_1004693471 | 287 |
| 102 | 3300005339 | Ga0070660_100001807 | Ga0070660_1000018073 | 287 |
| 103 | 3300025925 | Ga0207650_10109201 | Ga0207650_101092012 | 287 |
| 104 | iso_pu_bacteria | 2929154850 | 2929157442 | 287 |
| 105 | 3300005327 | Ga0070658_10065901 | Ga0070658_100659012 | 288 |
| 106 | 3300005328 | Ga0070676_10021643 | Ga0070676_100216433 | 288 |
| 107 | 3300005331 | Ga0070670_100032305 | Ga0070670_1000323052 | 288 |
| 108 | 3300005335 | Ga0070666_10001617 | Ga0070666_100016173 | 288 |
| 109 | 3300005338 | Ga0068868_100018242 | Ga0068868_1000182423 | 288 |
| 110 | 3300005347 | Ga0070668_100013739 | Ga0070668_1000137394 | 288 |
| 111 | 3300005347 | Ga0070668_100139170 | Ga0070668_1001391702 | 288 |
| 112 | 3300005354 | Ga0070675_100052633 | Ga0070675_1000526332 | 288 |
| 113 | 3300005364 | Ga0070673_100104377 | Ga0070673_1001043772 | 288 |
| 114 | 3300005367 | Ga0070667_100000492 | Ga0070667_1000004924 | 288 |
| 115 | 3300005459 | Ga0068867_100070176 | Ga0068867_1000701762 | 288 |
| 116 | 3300005459 | Ga0068867_100084485 | Ga0068867_1000844852 | 288 |
| 117 | 3300005539 | Ga0068853_100016523 | Ga0068853_1000165235 | 288 |
| 118 | 3300005543 | Ga0070672_100002526 | Ga0070672_10000252611 | 288 |
| 119 | 3300005548 | Ga0070665_100006195 | Ga0070665_1000061953 | 288 |
| 120 | 3300005618 | Ga0068864_100002625 | Ga0068864_1000026253 | 288 |
| 121 | 3300005719 | Ga0068861_100014552 | Ga0068861_1000145525 | 288 |
| 122 | 3300005719 | Ga0068861_100170231 | Ga0068861_1001702312 | 288 |
| 123 | 3300005834 | Ga0068851_10018455 | Ga0068851_100184552 | 288 |
| 124 | 3300005841 | Ga0068863_100041642 | Ga0068863_1000416422 | 288 |
| 125 | 3300005842 | Ga0068858_100005957 | Ga0068858_10000595711 | 288 |
| 126 | 3300005843 | Ga0068860_100102965 | Ga0068860_1001029653 | 288 |
| 127 | 3300006237 | Ga0097621_100050613 | Ga0097621_1000506132 | 288 |
| 128 | 3300006881 | Ga0068865_100019896 | Ga0068865_1000198962 | 288 |
| 129 | 3300009093 | Ga0105240_10219871 | Ga0105240_102198713 | 288 |
| 130 | 3300009101 | Ga0105247_10014543 | Ga0105247_100145433 | 288 |
| 131 | 3300009148 | Ga0105243_10099604 | Ga0105243_100996043 | 288 |
| 132 | 3300009174 | Ga0105241_10342074 | Ga0105241_103420742 | 288 |
| 133 | 3300009176 | Ga0105242_10120076 | Ga0105242_101200762 | 288 |
| 134 | 3300009177 | Ga0105248_10224207 | Ga0105248_102242072 | 288 |
| 135 | 3300011119 | Ga0105246_10132416 | Ga0105246_101324162 | 288 |
| 136 | 3300013296 | Ga0157374_10060398 | Ga0157374_100603982 | 288 |
| 137 | 3300013297 | Ga0157378_10021845 | Ga0157378_100218453 | 288 |
| 138 | 3300013306 | Ga0163162_10001596 | Ga0163162_1000159617 | 288 |
| 139 | 3300013308 | Ga0157375_10039446 | Ga0157375_100394462 | 288 |
| 140 | 3300014325 | Ga0163163_10013034 | Ga0163163_100130347 | 288 |
| 141 | 3300014325 | Ga0163163_10092376 | Ga0163163_100923763 | 288 |
| 142 | 3300014968 | Ga0157379_10043267 | Ga0157379_100432673 | 288 |
| 143 | 3300014969 | Ga0157376_10006718 | Ga0157376_100067183 | 288 |
| 144 | 3300014969 | Ga0157376_10029531 | Ga0157376_100295313 | 288 |
| 145 | 3300025903 | Ga0207680_10024200 | Ga0207680_100242002 | 288 |
| 146 | 3300025907 | Ga0207645_10037528 | Ga0207645_100375283 | 288 |
| 147 | 3300025909 | Ga0207705_10018057 | Ga0207705_100180574 | 288 |
| 148 | 3300025925 | Ga0207650_10001164 | Ga0207650_100011646 | 288 |
| 149 | 3300025927 | Ga0207687_10157042 | Ga0207687_101570422 | 288 |
| 150 | 3300025940 | Ga0207691_10000001 | Ga0207691_1000000111 | 288 |
| 151 | 3300025942 | Ga0207689_10381969 | Ga0207689_103819691 | 288 |
| 152 | 3300025949 | Ga0207667_10083884 | Ga0207667_100838843 | 288 |
| 153 | 3300025960 | Ga0207651_10071275 | Ga0207651_100712753 | 288 |
| 154 | 3300025972 | Ga0207668_10000540 | Ga0207668_1000054021 | 288 |
| 155 | 3300025986 | Ga0207658_10000946 | Ga0207658_1000094619 | 288 |
| 156 | 3300026023 | Ga0207677_10016914 | Ga0207677_100169144 | 288 |
| 157 | 3300026035 | Ga0207703_10020309 | Ga0207703_100203094 | 288 |
| 158 | 3300026041 | Ga0207639_10100977 | Ga0207639_101009772 | 288 |
| 159 | 3300026067 | Ga0207678_10223134 | Ga0207678_102231342 | 288 |
| 160 | 3300026088 | Ga0207641_10014758 | Ga0207641_100147583 | 288 |
| 161 | 3300026089 | Ga0207648_10009139 | Ga0207648_100091398 | 288 |
| 162 | 3300026089 | Ga0207648_10020419 | Ga0207648_100204192 | 288 |
| 163 | 3300026095 | Ga0207676_10001871 | Ga0207676_100018717 | 288 |
| 164 | 3300026118 | Ga0207675_100052126 | Ga0207675_1000521263 | 288 |
| 165 | 3300026121 | Ga0207683_10213341 | Ga0207683_102133412 | 288 |
| 166 | 3300028379 | Ga0268266_10173466 | Ga0268266_101734662 | 288 |
| 167 | 3300028381 | Ga0268264_10006865 | Ga0268264_100068653 | 288 |
| 168 | 3300005331 | Ga0070670_100081130 | Ga0070670_1000811302 | 289 |
| 169 | 3300025940 | Ga0207691_10408311 | Ga0207691_104083112 | 289 |
| 170 | 3300028800 | Ga0265338_10003582 | Ga0265338_100035828 | 289 |
| 171 | iso_pu_bacteria | 2818991444 | 2819588756 | 289 |
| 172 | 3300005366 | Ga0070659_100044601 | Ga0070659_1000446012 | 290 |
| 173 | 3300005543 | Ga0070672_100504071 | Ga0070672_1005040711 | 290 |
| 174 | 3300005563 | Ga0068855_100005142 | Ga0068855_1000051427 | 290 |
| 175 | 3300005577 | Ga0068857_100430503 | Ga0068857_1004305031 | 290 |
| 176 | 3300006173 | Ga0070716_100072959 | Ga0070716_1000729592 | 290 |
| 177 | 3300013104 | Ga0157370_10001240 | Ga0157370_1000124013 | 290 |
| 178 | 3300013307 | Ga0157372_10051150 | Ga0157372_100511503 | 290 |
| 179 | 3300025949 | Ga0207667_10005263 | Ga0207667_100052634 | 290 |
| 180 | 3300026116 | Ga0207674_10459234 | Ga0207674_104592341 | 290 |
| 181 | 3300031251 | Ga0265327_10000084 | Ga0265327_10000084177 | 290 |
| 182 | 3300031507 | Ga0307509_10028479 | Ga0307509_100284794 | 290 |
| 183 | 3300037312 | Ga0395899_0062044 | Ga0395899_0062044_847_1734 | 290 |
| 184 | 3300037418 | Ga0395900_0021588 | Ga0395900_0021588_3543_4430 | 290 |
| 185 | 3300037466 | Ga0395898_0078449 | Ga0395898_0078449_1300_2187 | 290 |
| 186 | 3300038443 | Ga0395901_0021720 | Ga0395901_0021720_1709_2596 | 290 |
| 187 | 3300013307 | Ga0157372_10144970 | Ga0157372_101449703 | 292 |
| 188 | 3300044712 | Ga0453684_0011639 | Ga0453684_0011639_9285_10181 | 292 |
| 189 | 3300053108 | Ga0500562_000040 | Ga0500562_000040_16076_16993 | 292 |
| 190 | 3300005334 | Ga0068869_100223883 | Ga0068869_1002238831 | 293 |
| 191 | 3300005539 | Ga0068853_100109571 | Ga0068853_1001095713 | 293 |
| 192 | 3300005543 | Ga0070672_100111740 | Ga0070672_1001117402 | 293 |
| 193 | 3300005564 | Ga0070664_100013842 | Ga0070664_1000138422 | 293 |
| 194 | 3300013296 | Ga0157374_10000004 | Ga0157374_1000000429 | 293 |
| 195 | 3300013297 | Ga0157378_10516803 | Ga0157378_105168031 | 293 |
| 196 | 3300013306 | Ga0163162_10009773 | Ga0163162_100097738 | 293 |
| 197 | 3300014745 | Ga0157377_10010516 | Ga0157377_100105162 | 293 |
| 198 | 3300014969 | Ga0157376_10009201 | Ga0157376_100092017 | 293 |
| 199 | 3300025940 | Ga0207691_10010249 | Ga0207691_100102497 | 293 |
| 200 | 3300026142 | Ga0207698_10064831 | Ga0207698_100648312 | 293 |
| 201 | 3300028794 | Ga0307515_10002910 | Ga0307515_100029103 | 293 |
| 202 | 3300042876 | Ga0451577_0000614 | Ga0451577_0000614_48953_49903 | 293 |
| 203 | 3300044712 | Ga0453684_0001797 | Ga0453684_0001797_37487_38437 | 293 |
| 204 | 3300005364 | Ga0070673_100040758 | Ga0070673_1000407583 | 294 |
| 205 | 3300005459 | Ga0068867_100062935 | Ga0068867_1000629353 | 294 |
| 206 | 3300005578 | Ga0068854_100417530 | Ga0068854_1004175301 | 294 |
| 207 | 3300005616 | Ga0068852_100132510 | Ga0068852_1001325103 | 294 |
| 208 | 3300005617 | Ga0068859_100049111 | Ga0068859_1000491112 | 294 |
| 209 | 3300005719 | Ga0068861_100089067 | Ga0068861_1000890673 | 294 |
| 210 | 3300006931 | Ga0097620_100049111 | Ga0097620_1000491112 | 294 |
| 211 | 3300013100 | Ga0157373_10078199 | Ga0157373_100781992 | 294 |
| 212 | 3300013296 | Ga0157374_10104683 | Ga0157374_101046833 | 294 |
| 213 | 3300013306 | Ga0163162_10009349 | Ga0163162_100093497 | 294 |
| 214 | 3300025907 | Ga0207645_10069851 | Ga0207645_100698513 | 294 |
| 215 | 3300025942 | Ga0207689_10011904 | Ga0207689_100119044 | 294 |
| 216 | 3300025981 | Ga0207640_10163388 | Ga0207640_101633882 | 294 |
| 217 | 3300026041 | Ga0207639_10062337 | Ga0207639_100623371 | 294 |
| 218 | 3300037418 | Ga0395900_0041092 | Ga0395900_0041092_3699_4610 | 294 |
| 219 | 3300037471 | Ga0395905_0004912 | Ga0395905_0004912_11885_12796 | 294 |
| 220 | 3300037471 | Ga0395905_0016054 | Ga0395905_0016054_5099_6010 | 294 |
| 221 | 3300044673 | Ga0453683_0000718 | Ga0453683_0000718_30794_31774 | 294 |
| 222 | 3300049572 | Ga0501036_0034598 | Ga0501036_0034598_741_1667 | 294 |
| 223 | 3300049579 | Ga0501043_0147771 | Ga0501043_0147771_724_1650 | 294 |
| 224 | 3300049688 | Ga0501259_000490 | Ga0501259_000490_968_1864 | 294 |
| 225 | 3300049822 | Ga0501035_0012462 | Ga0501035_0012462_6353_7279 | 294 |
| 226 | 3300005329 | Ga0070683_100038857 | Ga0070683_1000388573 | 295 |
| 227 | 3300005331 | Ga0070670_100144405 | Ga0070670_1001444052 | 295 |
| 228 | 3300005334 | Ga0068869_100075820 | Ga0068869_1000758202 | 295 |
| 229 | 3300005335 | Ga0070666_10000411 | Ga0070666_100004118 | 295 |
| 230 | 3300005347 | Ga0070668_100232795 | Ga0070668_1002327952 | 295 |
| 231 | 3300005367 | Ga0070667_100020208 | Ga0070667_1000202082 | 295 |
| 232 | 3300005617 | Ga0068859_100000037 | Ga0068859_10000003737 | 295 |
| 233 | 3300005617 | Ga0068859_100027856 | Ga0068859_1000278565 | 295 |
| 234 | 3300005618 | Ga0068864_100014449 | Ga0068864_1000144495 | 295 |
| 235 | 3300005841 | Ga0068863_100026690 | Ga0068863_1000266902 | 295 |
| 236 | 3300005842 | Ga0068858_100034522 | Ga0068858_1000345223 | 295 |
| 237 | 3300005843 | Ga0068860_100015281 | Ga0068860_1000152813 | 295 |
| 238 | 3300006237 | Ga0097621_100018082 | Ga0097621_1000180823 | 295 |
| 239 | 3300006358 | Ga0068871_100004953 | Ga0068871_1000049535 | 295 |
| 240 | 3300006931 | Ga0097620_100000037 | Ga0097620_10000003737 | 295 |
| 241 | 3300006931 | Ga0097620_100027855 | Ga0097620_1000278552 | 295 |
| 242 | 3300009101 | Ga0105247_10023765 | Ga0105247_100237652 | 295 |
| 243 | 3300009174 | Ga0105241_10001055 | Ga0105241_1000105514 | 295 |
| 244 | 3300009545 | Ga0105237_10001973 | Ga0105237_100019735 | 295 |
| 245 | 3300009553 | Ga0105249_10001713 | Ga0105249_100017132 | 295 |
| 246 | 3300010375 | Ga0105239_10119293 | Ga0105239_101192932 | 295 |
| 247 | 3300013296 | Ga0157374_10222350 | Ga0157374_102223502 | 295 |
| 248 | 3300013297 | Ga0157378_10015181 | Ga0157378_100151812 | 295 |
| 249 | 3300013306 | Ga0163162_10026265 | Ga0163162_100262652 | 295 |
| 250 | 3300013306 | Ga0163162_10354909 | Ga0163162_103549092 | 295 |
| 251 | 3300013307 | Ga0157372_10127401 | Ga0157372_101274012 | 295 |
| 252 | 3300013308 | Ga0157375_10015790 | Ga0157375_100157902 | 295 |
| 253 | 3300014325 | Ga0163163_10099050 | Ga0163163_100990502 | 295 |
| 254 | 3300014969 | Ga0157376_10196564 | Ga0157376_101965641 | 295 |
| 255 | 3300025321 | Ga0207656_10029921 | Ga0207656_100299212 | 295 |
| 256 | 3300025900 | Ga0207710_10012180 | Ga0207710_100121802 | 295 |
| 257 | 3300025903 | Ga0207680_10000619 | Ga0207680_100006198 | 295 |
| 258 | 3300025911 | Ga0207654_10001155 | Ga0207654_1000115512 | 295 |
| 259 | 3300025914 | Ga0207671_10002513 | Ga0207671_100025132 | 295 |
| 260 | 3300025925 | Ga0207650_10058928 | Ga0207650_100589282 | 295 |
| 261 | 3300025938 | Ga0207704_10355672 | Ga0207704_103556721 | 295 |
| 262 | 3300025942 | Ga0207689_10021440 | Ga0207689_100214404 | 295 |
| 263 | 3300025961 | Ga0207712_10011771 | Ga0207712_100117712 | 295 |
| 264 | 3300025972 | Ga0207668_10020729 | Ga0207668_100207294 | 295 |
| 265 | 3300025986 | Ga0207658_10059247 | Ga0207658_100592472 | 295 |
| 266 | 3300026035 | Ga0207703_10010311 | Ga0207703_100103113 | 295 |
| 267 | 3300026088 | Ga0207641_10000226 | Ga0207641_1000022615 | 295 |
| 268 | 3300026116 | Ga0207674_10068927 | Ga0207674_100689272 | 295 |
| 269 | 3300026142 | Ga0207698_10020543 | Ga0207698_100205433 | 295 |
| 270 | 3300026142 | Ga0207698_10217489 | Ga0207698_102174892 | 295 |
| 271 | 3300028381 | Ga0268264_10020176 | Ga0268264_100201762 | 295 |
| 272 | 3300028654 | Ga0265322_10000052 | Ga0265322_1000005240 | 295 |
| 273 | 3300028800 | Ga0265338_10087857 | Ga0265338_100878573 | 295 |
| 274 | 3300029957 | Ga0265324_10061997 | Ga0265324_100619971 | 295 |
| 275 | 3300031507 | Ga0307509_10123587 | Ga0307509_101235871 | 295 |
| 276 | 3300003320 | rootH2_10013110 | rootH2_100131104 | 296 |
| 277 | 3300005564 | Ga0070664_100323862 | Ga0070664_1003238622 | 296 |
| 278 | 3300005841 | Ga0068863_100220165 | Ga0068863_1002201652 | 296 |
| 279 | 3300009093 | Ga0105240_10061437 | Ga0105240_100614375 | 296 |
| 280 | 3300010375 | Ga0105239_10001797 | Ga0105239_1000179710 | 296 |
| 281 | 3300014969 | Ga0157376_10051924 | Ga0157376_100519243 | 296 |
| 282 | 3300025913 | Ga0207695_10386526 | Ga0207695_103865262 | 296 |
| 283 | 3300026088 | Ga0207641_10085072 | Ga0207641_100850723 | 296 |
| 284 | 3300037471 | Ga0395905_0511012 | Ga0395905_0511012_121_1041 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zm5-assembly1.cif.gz_A | crystal structure of trna modification enzyme miaa in the complex with trna(phe) | 0.9381 | 6 | 295 |
| 2qgn-assembly1.cif.gz_A | crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. | 0.928 | 7 | 287 |
| 2zm5-assembly1.cif.gz_A | crystal structure of trna modification enzyme miaa in the complex with trna(phe) | 0.9169 | 6 | 295 |
| 3crr-assembly1.cif.gz_A | structure of trna dimethylallyltransferase: rna modification through a channel | 0.9028 | 4 | 295 |
| 3crr-assembly1.cif.gz_A | structure of trna dimethylallyltransferase: rna modification through a channel | 0.8623 | 4 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3exaA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain | 0.941 | 201 | 278 | 1.10.287.890 |
| 3crrA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9404 | 4 | 115 | 3.40.50.300 |
| 2qgnA02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain | 0.9316 | 203 | 280 | 1.10.287.890 |
| 3a8tA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9297 | 5 | 112 | 3.40.50.300 |
| 3d3qB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9293 | 6 | 111 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M6JY77-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) | 0.9774 | 7 | 295 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-A0A352MBT5-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) | 0.9742 | 4 | 254 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-A0A3M0YGK8-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) | 0.9739 | 3 | 274 |
GO:0005524
GO:0006400 GO:0052381 |
| AF-F2KZH0-F1-model_v4 | deleted | 0.9735 | 7 | 295 |
|
| AF-A0A3P1XWX5-F1-model_v4 | tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) | 0.9717 | 7 | 295 |
GO:0005524
GO:0006400 GO:0052381 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar