F386204

General Info

Members Datasets Scaffolds Average Seq Length
284 134 282 297

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10015181|Ga0157378_100151812
Length 342
Sequence LLPAKCSDGPFSKRNLPPLLVFSPTIRILKILDPDTRPMPSTAPQKTCIVIAGPTAVGKTTVAISLAQHFKTSIISADSRQCFKELNIGVAKPTAEQLQQVKHYFINSHSIFEEINAGMFEQYALNAVNEIFVKHDIAVMVGGTGLYIRAFCDGMDAIPSADPNLRNEINARYSNDGLDWLQNEIKERDPAWYAVGEIQNPQRIMRALEVVMHTGKSILSFQQAVKAERNFNIVKIGLALPRNELYQHINQRVDEMMGAGLEDEVRLLQRYRHLNALQTVGYKEMFEYIDGQADMQQAIENIKRNTRHYAKRQLTWFTKDESIHWFSPIDYNQLINYLRNLV

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 0.35
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10013110 3300003320 Bacteria 45132
2 Ga0070658_10036180 3300005327 Bacteria 3978
3 Ga0070658_10065901 3300005327 Bacteria 2957
4 Ga0070658_10155592 3300005327 Bacteria 1916
5 Ga0070676_10021643 3300005328 Bacteria 3601
6 Ga0070683_100038857 3300005329 Bacteria 4365
7 Ga0070683_100470359 3300005329 Bacteria 1200
8 Ga0070670_100032305 3300005331 Bacteria 4508
9 Ga0070670_100081130 3300005331 Bacteria 2787
10 Ga0070670_100144405 3300005331 Bacteria 2058
11 Ga0070670_100469347 3300005331 Bacteria 1117
12 Ga0068869_100075820 3300005334 Bacteria 2499
13 Ga0068869_100223883 3300005334 Bacteria 1492
14 Ga0070666_10000411 3300005335 Bacteria 26651
15 Ga0070666_10001617 3300005335 Bacteria 13695
16 Ga0070680_100008310 3300005336 Bacteria 7943
17 Ga0070680_100099721 3300005336 Bacteria 2410
18 Ga0070682_100050914 3300005337 Bacteria 2587
19 Ga0068868_100018242 3300005338 Bacteria 5243
20 Ga0070660_100001807 3300005339 Bacteria 14682
21 Ga0070660_100014375 3300005339 Bacteria 5699
22 Ga0070660_100055030 3300005339 Bacteria 3074
23 Ga0070668_100013739 3300005347 Bacteria 6048
24 Ga0070668_100139170 3300005347 Bacteria 1955
25 Ga0070668_100232795 3300005347 Bacteria 1524
26 Ga0070675_100052633 3300005354 Bacteria 3348
27 Ga0070673_100040758 3300005364 Bacteria 3565
28 Ga0070673_100104377 3300005364 Bacteria 2340
29 Ga0070659_100015370 3300005366 Bacteria 5733
30 Ga0070659_100021015 3300005366 Bacteria 4964
31 Ga0070659_100044601 3300005366 Bacteria 3472
32 Ga0070667_100000492 3300005367 Bacteria 40164
33 Ga0070667_100020208 3300005367 Bacteria 5529
34 Ga0070663_100026443 3300005455 Unclassified 3931
35 Ga0070681_10025480 3300005458 Bacteria 5949
36 Ga0068867_100062935 3300005459 Bacteria 2758
37 Ga0068867_100070176 3300005459 Bacteria 2619
38 Ga0068867_100084485 3300005459 Bacteria 2398
39 Ga0070679_100000706 3300005530 Bacteria 28666
40 Ga0070679_100042591 3300005530 Bacteria 4522
41 Ga0070679_100521261 3300005530 Bacteria 1132
42 Ga0068853_100016523 3300005539 Bacteria 6076
43 Ga0068853_100109571 3300005539 Bacteria 2451
44 Ga0070672_100002526 3300005543 Bacteria 11648
45 Ga0070672_100111740 3300005543 Bacteria 2228
46 Ga0070672_100504071 3300005543 Unclassified 1047
47 Ga0070665_100006195 3300005548 Bacteria 12241
48 Ga0070665_100132708 3300005548 Unclassified 2492
49 Ga0068855_100000145 3300005563 Bacteria 91452
50 Ga0068855_100005142 3300005563 Bacteria 15957
51 Ga0070664_100013842 3300005564 Bacteria 6576
52 Ga0070664_100323862 3300005564 Bacteria 1397
53 Ga0068857_100343367 3300005577 Bacteria 1381
54 Ga0068857_100430503 3300005577 Bacteria 1231
55 Ga0068854_100417530 3300005578 Bacteria 1114
56 Ga0068856_100025818 3300005614 Bacteria 5729
57 Ga0068856_100639827 3300005614 Bacteria 1084
58 Ga0068852_100002092 3300005616 Bacteria 13644
59 Ga0068852_100132510 3300005616 Bacteria 2297
60 Ga0068852_100223008 3300005616 Bacteria 1794
61 Ga0068859_100000037 3300005617 Bacteria 165480
62 Ga0068859_100027856 3300005617 Bacteria 5666
63 Ga0068859_100049111 3300005617 Unclassified 4238
64 Ga0068864_100002625 3300005618 Bacteria 14840
65 Ga0068864_100014449 3300005618 Bacteria 6559
66 Ga0068864_100039256 3300005618 Bacteria 4046
67 Ga0068861_100014552 3300005719 Bacteria 5523
68 Ga0068861_100089067 3300005719 Bacteria 2432
69 Ga0068861_100170231 3300005719 Bacteria 1805
70 Ga0068851_10018455 3300005834 Bacteria 3360
71 Ga0068863_100026690 3300005841 Bacteria 5507
72 Ga0068863_100041642 3300005841 Bacteria 4367
73 Ga0068863_100220165 3300005841 Bacteria 1829
74 Ga0068858_100005957 3300005842 Bacteria 11905
75 Ga0068858_100034522 3300005842 Bacteria 4692
76 Ga0068860_100003371 3300005843 Bacteria 16433
77 Ga0068860_100015281 3300005843 Bacteria 7497
78 Ga0068860_100102965 3300005843 Bacteria 2725
79 Ga0070716_100072959 3300006173 Bacteria 2023
80 Ga0097621_100018082 3300006237 Bacteria 5375
81 Ga0097621_100050613 3300006237 Bacteria 3379
82 Ga0068871_100004953 3300006358 Bacteria 9305
83 Ga0068865_100019896 3300006881 Bacteria 4349
84 Ga0097620_100000037 3300006931 Bacteria 165480
85 Ga0097620_100027855 3300006931 Bacteria 5666
86 Ga0097620_100049111 3300006931 Unclassified 4238
87 Ga0105240_10061437 3300009093 Bacteria 4682
88 Ga0105240_10219871 3300009093 Bacteria 2213
89 Ga0105240_10351408 3300009093 Bacteria 1672
90 Ga0105247_10014543 3300009101 Bacteria 4720
91 Ga0105247_10023765 3300009101 Bacteria 3694
92 Ga0105243_10099604 3300009148 Bacteria 2409
93 Ga0105241_10001055 3300009174 Bacteria 20990
94 Ga0105241_10342074 3300009174 Unclassified 1296
95 Ga0105241_10502299 3300009174 Bacteria 1081
96 Ga0105242_10120076 3300009176 Unclassified 2254
97 Ga0105248_10224207 3300009177 Bacteria 2116
98 Ga0105237_10001973 3300009545 Bacteria 26110
99 Ga0105249_10001713 3300009553 Bacteria 19174
100 Ga0105239_10001797 3300010375 Bacteria 28154
101 Ga0105239_10119293 3300010375 Bacteria 2928
102 Ga0105246_10132416 3300011119 Unclassified 1864
103 Ga0157373_10017119 3300013100 Bacteria 5278
104 Ga0157373_10078199 3300013100 Unclassified 2333
105 Ga0157371_10001159 3300013102 Bacteria 28365
106 Ga0157371_10014577 3300013102 Bacteria 5926
107 Ga0157371_10029223 3300013102 Bacteria 3989
108 Ga0157371_10053429 3300013102 Bacteria 2869
109 Ga0157371_10085787 3300013102 Bacteria 2230
110 Ga0157370_10001240 3300013104 Bacteria 31893
111 Ga0157370_10003395 3300013104 Bacteria 18708
112 Ga0157370_10005976 3300013104 Bacteria 13544
113 Ga0157370_10279061 3300013104 Unclassified 1544
114 Ga0157370_10306931 3300013104 Unclassified 1464
115 Ga0157369_10028941 3300013105 Bacteria 6128
116 Ga0157369_10064791 3300013105 Bacteria 3935
117 Ga0157374_10000004 3300013296 Bacteria 759774
118 Ga0157374_10060398 3300013296 Bacteria 3547
119 Ga0157374_10104683 3300013296 Bacteria 2717
120 Ga0157374_10222350 3300013296 Bacteria 1853
121 Ga0157378_10015181 3300013297 Bacteria 6743
122 Ga0157378_10021845 3300013297 Bacteria 5627
123 Ga0157378_10516803 3300013297 Bacteria 1195
124 Ga0163162_10001596 3300013306 Bacteria 21205
125 Ga0163162_10009349 3300013306 Bacteria 9532
126 Ga0163162_10009773 3300013306 Bacteria 9339
127 Ga0163162_10026265 3300013306 Bacteria 5755
128 Ga0163162_10354909 3300013306 Unclassified 1599
129 Ga0157372_10002466 3300013307 Bacteria 20053
130 Ga0157372_10026619 3300013307 Bacteria 6294
131 Ga0157372_10051150 3300013307 Bacteria 4597
132 Ga0157372_10065369 3300013307 Bacteria 4084
133 Ga0157372_10069353 3300013307 Bacteria 3965
134 Ga0157372_10127401 3300013307 Bacteria 2927
135 Ga0157372_10144970 3300013307 Bacteria 2738
136 Ga0157372_10395250 3300013307 Bacteria 1611
137 Ga0157375_10015790 3300013308 Bacteria 6766
138 Ga0157375_10039446 3300013308 Bacteria 4546
139 Ga0163163_10013034 3300014325 Bacteria 7590
140 Ga0163163_10092376 3300014325 Bacteria 3041
141 Ga0163163_10099050 3300014325 Unclassified 2936
142 Ga0157377_10010516 3300014745 Bacteria 4579
143 Ga0157379_10043267 3300014968 Bacteria 4021
144 Ga0157376_10006718 3300014969 Bacteria 8144
145 Ga0157376_10009201 3300014969 Bacteria 7166
146 Ga0157376_10029531 3300014969 Bacteria 4367
147 Ga0157376_10051924 3300014969 Bacteria 3407
148 Ga0157376_10196564 3300014969 Bacteria 1853
149 Ga0207426_1000002 3300025302 Bacteria 1249660
150 Ga0207656_10029921 3300025321 Bacteria 2246
151 Ga0207710_10012180 3300025900 Bacteria 3616
152 Ga0207680_10000619 3300025903 Bacteria 16749
153 Ga0207680_10024200 3300025903 Bacteria 3328
154 Ga0207645_10037528 3300025907 Bacteria 3109
155 Ga0207645_10069851 3300025907 Bacteria 2247
156 Ga0207705_10018057 3300025909 Bacteria 5044
157 Ga0207705_10027120 3300025909 Bacteria 4083
158 Ga0207705_10028345 3300025909 Bacteria 3991
159 Ga0207705_10074698 3300025909 Bacteria 2461
160 Ga0207654_10001155 3300025911 Bacteria 14200
161 Ga0207707_10008847 3300025912 Bacteria 8745
162 Ga0207695_10386526 3300025913 Bacteria 1284
163 Ga0207671_10002513 3300025914 Bacteria 19573
164 Ga0207660_10008407 3300025917 Bacteria 6678
165 Ga0207657_10030180 3300025919 Bacteria 4924
166 Ga0207657_10032558 3300025919 Bacteria 4708
167 Ga0207657_10370051 3300025919 Bacteria 1129
168 Ga0207652_10000329 3300025921 Bacteria 49068
169 Ga0207652_10009475 3300025921 Bacteria 7828
170 Ga0207650_10001164 3300025925 Bacteria 19325
171 Ga0207650_10058928 3300025925 Bacteria 2860
172 Ga0207650_10109201 3300025925 Unclassified 2139
173 Ga0207687_10157042 3300025927 Bacteria 1741
174 Ga0207690_10020112 3300025932 Bacteria 4120
175 Ga0207690_10111080 3300025932 Bacteria 1974
176 Ga0207704_10355672 3300025938 Bacteria 1142
177 Ga0207691_10000001 3300025940 Bacteria 220829
178 Ga0207691_10010249 3300025940 Bacteria 8991
179 Ga0207691_10408311 3300025940 Bacteria 1158
180 Ga0207689_10011904 3300025942 Bacteria 7454
181 Ga0207689_10021440 3300025942 Bacteria 5431
182 Ga0207689_10037316 3300025942 Bacteria 4030
183 Ga0207689_10381969 3300025942 Unclassified 1173
184 Ga0207661_10195874 3300025944 Bacteria 1774
185 Ga0207667_10000508 3300025949 Bacteria 51422
186 Ga0207667_10005263 3300025949 Bacteria 15781
187 Ga0207667_10043550 3300025949 Bacteria 4763
188 Ga0207667_10083884 3300025949 Bacteria 3299
189 Ga0207651_10071275 3300025960 Bacteria 2462
190 Ga0207712_10011771 3300025961 Bacteria 5578
191 Ga0207668_10000540 3300025972 Bacteria 23750
192 Ga0207668_10020729 3300025972 Bacteria 4184
193 Ga0207640_10163388 3300025981 Bacteria 1650
194 Ga0207658_10000946 3300025986 Bacteria 23945
195 Ga0207658_10059247 3300025986 Bacteria 2852
196 Ga0207677_10016914 3300026023 Bacteria 4332
197 Ga0207703_10010311 3300026035 Bacteria 7316
198 Ga0207703_10020309 3300026035 Bacteria 5194
199 Ga0207639_10062337 3300026041 Bacteria 2883
200 Ga0207639_10100977 3300026041 Unclassified 2331
201 Ga0207678_10009788 3300026067 Bacteria 8431
202 Ga0207678_10223134 3300026067 Unclassified 1613
203 Ga0207678_10320314 3300026067 Bacteria 1334
204 Ga0207641_10000226 3300026088 Bacteria 72539
205 Ga0207641_10014758 3300026088 Bacteria 6405
206 Ga0207641_10085072 3300026088 Bacteria 2755
207 Ga0207648_10009139 3300026089 Bacteria 9526
208 Ga0207648_10020419 3300026089 Bacteria 5964
209 Ga0207676_10001871 3300026095 Bacteria 15411
210 Ga0207674_10068927 3300026116 Bacteria 3558
211 Ga0207674_10400942 3300026116 Bacteria 1326
212 Ga0207674_10459234 3300026116 Bacteria 1231
213 Ga0207675_100052126 3300026118 Bacteria 3818
214 Ga0207683_10213341 3300026121 Unclassified 1757
215 Ga0207698_10020543 3300026142 Bacteria 4548
216 Ga0207698_10022360 3300026142 Bacteria 4392
217 Ga0207698_10064831 3300026142 Bacteria 2865
218 Ga0207698_10217489 3300026142 Bacteria 1724
219 Ga0268266_10173466 3300028379 Unclassified 1958
220 Ga0268264_10006865 3300028381 Bacteria 9557
221 Ga0268264_10020176 3300028381 Bacteria 5447
222 Ga0265322_10000052 3300028654 Bacteria 58413
223 Ga0307515_10002910 3300028794 Bacteria 36374
224 Ga0265338_10003582 3300028800 Bacteria 21685
225 Ga0265338_10087857 3300028800 Bacteria 2582
226 Ga0265324_10061997 3300029957 Unclassified 1277
227 Ga0265327_10000084 3300031251 Bacteria 204433
228 Ga0307509_10028479 3300031507 Bacteria 6209
229 Ga0307509_10123587 3300031507 Bacteria 2560
230 Ga0395899_0006390 3300037312 Bacteria 9129
231 Ga0395899_0019032 3300037312 Bacteria 5218
232 Ga0395899_0024270 3300037312 Bacteria 4585
233 Ga0395899_0062044 3300037312 Bacteria 2752
234 Ga0395900_0000203 3300037418 Bacteria 93536
235 Ga0395900_0021588 3300037418 Bacteria 6582
236 Ga0395900_0025169 3300037418 Bacteria 6093
237 Ga0395900_0041092 3300037418 Bacteria 4769
238 Ga0395900_0050912 3300037418 Bacteria 4265
239 Ga0395900_0061713 3300037418 Bacteria 3853
240 Ga0395900_0127726 3300037418 Bacteria 2606
241 Ga0395898_0001285 3300037466 Bacteria 36916
242 Ga0395898_0028083 3300037466 Bacteria 5642
243 Ga0395898_0042489 3300037466 Bacteria 4484
244 Ga0395898_0067023 3300037466 Bacteria 3476
245 Ga0395898_0078449 3300037466 Bacteria 3186
246 Ga0395905_0004912 3300037471 Bacteria 13770
247 Ga0395905_0013771 3300037471 Bacteria 7742
248 Ga0395905_0016054 3300037471 Bacteria 7118
249 Ga0395905_0511012 3300037471 Bacteria 1102
250 Ga0395901_0002230 3300038443 Bacteria 19784
251 Ga0395901_0021720 3300038443 Bacteria 6576
252 Ga0395901_0069433 3300038443 Bacteria 3669
253 Ga0451807_2315102 3300041486 Bacteria 1037
254 Ga0451577_0000564 3300042876 Bacteria 60330
255 Ga0451577_0000614 3300042876 Bacteria 57427
256 Ga0453683_0000718 3300044673 Bacteria 34148
257 Ga0453684_0000160 3300044712 Bacteria 299297
258 Ga0453684_0001797 3300044712 Bacteria 56922
259 Ga0453684_0011639 3300044712 Bacteria 14689
260 Ga0453684_0298905 3300044712 Bacteria 1830
261 Ga0453684_0327192 3300044712 Bacteria 1734
262 Ga0501032_0004185 3300049569 Bacteria 10930
263 Ga0501034_0000373 3300049571 Bacteria 76337
264 Ga0501034_0002222 3300049571 Bacteria 23945
265 Ga0501034_0281540 3300049571 Bacteria 1602
266 Ga0501036_0034598 3300049572 Bacteria 4274
267 Ga0501036_0132545 3300049572 Bacteria 2103
268 Ga0501037_0003388 3300049573 Bacteria 11590
269 Ga0501038_0017914 3300049574 Bacteria 6399
270 Ga0501038_0262017 3300049574 Bacteria 1366
271 Ga0501039_0054580 3300049575 Bacteria 3093
272 Ga0501043_0011232 3300049579 Bacteria 7015
273 Ga0501043_0147771 3300049579 Bacteria 1840
274 Ga0501047_0011539 3300049581 Bacteria 8364
275 Ga0501048_0190879 3300049582 Bacteria 1452
276 Ga0501070_0149535 3300049586 Unclassified 1927
277 Ga0501259_000490 3300049688 Bacteria 6332
278 Ga0501035_0012462 3300049822 Bacteria 7857
279 Ga0501035_0057807 3300049822 Bacteria 3458
280 Ga0501035_0169348 3300049822 Bacteria 1888
281 Ga0501044_0007421 3300049823 Bacteria 12060
282 Ga0500562_000040 3300053108 Bacteria 69393

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0327192 Ga0453684_0327192_27_917 276
2 3300009174 Ga0105241_10502299 Ga0105241_105022992 278
3 3300041486 Ga0451807_2315102 Ga0451807_2315102_138_1004 278
4 3300005329 Ga0070683_100470359 Ga0070683_1004703591 279
5 3300005618 Ga0068864_100039256 Ga0068864_1000392562 279
6 3300005843 Ga0068860_100003371 Ga0068860_10000337110 279
7 3300013104 Ga0157370_10005976 Ga0157370_100059763 279
8 3300025942 Ga0207689_10037316 Ga0207689_100373163 279
9 3300005337 Ga0070682_100050914 Ga0070682_1000509143 280
10 3300005339 Ga0070660_100014375 Ga0070660_1000143753 280
11 3300005530 Ga0070679_100000706 Ga0070679_10000070616 280
12 3300005614 Ga0068856_100639827 Ga0068856_1006398271 280
13 3300005616 Ga0068852_100002092 Ga0068852_1000020927 280
14 3300005616 Ga0068852_100223008 Ga0068852_1002230082 280
15 3300013100 Ga0157373_10017119 Ga0157373_100171196 280
16 3300013102 Ga0157371_10001159 Ga0157371_100011593 280
17 3300013102 Ga0157371_10014577 Ga0157371_100145772 280
18 3300013307 Ga0157372_10002466 Ga0157372_1000246614 280
19 3300013307 Ga0157372_10026619 Ga0157372_100266193 280
20 3300025909 Ga0207705_10028345 Ga0207705_100283454 280
21 3300025919 Ga0207657_10370051 Ga0207657_103700511 280
22 3300025921 Ga0207652_10009475 Ga0207652_100094755 280
23 3300026142 Ga0207698_10022360 Ga0207698_100223603 280
24 3300037312 Ga0395899_0024270 Ga0395899_0024270_222_1064 280
25 3300037418 Ga0395900_0050912 Ga0395900_0050912_3353_4195 280
26 3300037418 Ga0395900_0061713 Ga0395900_0061713_1816_2658 280
27 3300037466 Ga0395898_0067023 Ga0395898_0067023_2413_3255 280
28 3300037471 Ga0395905_0013771 Ga0395905_0013771_4847_5689 280
29 3300005548 Ga0070665_100132708 Ga0070665_1001327083 281
30 3300049569 Ga0501032_0004185 Ga0501032_0004185_3744_4595 281
31 3300049571 Ga0501034_0002222 Ga0501034_0002222_5497_6348 281
32 3300049572 Ga0501036_0132545 Ga0501036_0132545_1023_1874 281
33 3300049573 Ga0501037_0003388 Ga0501037_0003388_1312_2163 281
34 3300049574 Ga0501038_0017914 Ga0501038_0017914_157_1008 281
35 3300049575 Ga0501039_0054580 Ga0501039_0054580_2185_3036 281
36 3300049579 Ga0501043_0011232 Ga0501043_0011232_4528_5379 281
37 3300049581 Ga0501047_0011539 Ga0501047_0011539_2939_3790 281
38 3300049582 Ga0501048_0190879 Ga0501048_0190879_280_1131 281
39 3300049822 Ga0501035_0057807 Ga0501035_0057807_148_999 281
40 3300049823 Ga0501044_0007421 Ga0501044_0007421_9326_10177 281
41 3300005327 Ga0070658_10036180 Ga0070658_100361802 282
42 3300005327 Ga0070658_10155592 Ga0070658_101555922 282
43 3300005336 Ga0070680_100008310 Ga0070680_1000083103 282
44 3300005339 Ga0070660_100055030 Ga0070660_1000550303 282
45 3300005455 Ga0070663_100026443 Ga0070663_1000264432 282
46 3300005458 Ga0070681_10025480 Ga0070681_100254804 282
47 3300005530 Ga0070679_100042591 Ga0070679_1000425912 282
48 3300005563 Ga0068855_100000145 Ga0068855_10000014517 282
49 3300005614 Ga0068856_100025818 Ga0068856_1000258187 282
50 3300009093 Ga0105240_10351408 Ga0105240_103514081 282
51 3300013102 Ga0157371_10029223 Ga0157371_100292233 282
52 3300013102 Ga0157371_10085787 Ga0157371_100857873 282
53 3300013104 Ga0157370_10003395 Ga0157370_100033956 282
54 3300013104 Ga0157370_10306931 Ga0157370_103069312 282
55 3300013105 Ga0157369_10064791 Ga0157369_100647913 282
56 3300013307 Ga0157372_10065369 Ga0157372_100653693 282
57 3300013307 Ga0157372_10069353 Ga0157372_100693533 282
58 3300013307 Ga0157372_10395250 Ga0157372_103952502 282
59 3300025302 Ga0207426_1000002 Ga0207426_1000002279 282
60 3300025909 Ga0207705_10027120 Ga0207705_100271203 282
61 3300025909 Ga0207705_10074698 Ga0207705_100746982 282
62 3300025912 Ga0207707_10008847 Ga0207707_100088477 282
63 3300025917 Ga0207660_10008407 Ga0207660_100084076 282
64 3300025921 Ga0207652_10000329 Ga0207652_1000032911 282
65 3300025944 Ga0207661_10195874 Ga0207661_101958742 282
66 3300025949 Ga0207667_10000508 Ga0207667_1000050844 282
67 3300026067 Ga0207678_10009788 Ga0207678_100097885 282
68 3300026067 Ga0207678_10320314 Ga0207678_103203142 282
69 3300037312 Ga0395899_0006390 Ga0395899_0006390_780_1628 282
70 3300037312 Ga0395899_0019032 Ga0395899_0019032_2358_3206 282
71 3300037418 Ga0395900_0000203 Ga0395900_0000203_36911_37759 282
72 3300037418 Ga0395900_0025169 Ga0395900_0025169_3257_4105 282
73 3300037418 Ga0395900_0127726 Ga0395900_0127726_1372_2220 282
74 3300037466 Ga0395898_0001285 Ga0395898_0001285_14046_14894 282
75 3300037466 Ga0395898_0028083 Ga0395898_0028083_2795_3643 282
76 3300037466 Ga0395898_0042489 Ga0395898_0042489_2376_3224 282
77 3300038443 Ga0395901_0002230 Ga0395901_0002230_11041_11889 282
78 3300038443 Ga0395901_0069433 Ga0395901_0069433_807_1655 282
79 3300049571 Ga0501034_0000373 Ga0501034_0000373_10061_10957 282
80 3300049574 Ga0501038_0262017 Ga0501038_0262017_134_985 283
81 3300005366 Ga0070659_100015370 Ga0070659_1000153702 284
82 3300005577 Ga0068857_100343367 Ga0068857_1003433672 284
83 3300025919 Ga0207657_10030180 Ga0207657_100301804 284
84 3300025932 Ga0207690_10020112 Ga0207690_100201122 284
85 3300026116 Ga0207674_10400942 Ga0207674_104009422 284
86 3300042876 Ga0451577_0000564 Ga0451577_0000564_37592_38542 284
87 3300044712 Ga0453684_0000160 Ga0453684_0000160_125271_126221 284
88 3300044712 Ga0453684_0298905 Ga0453684_0298905_654_1607 285
89 3300005336 Ga0070680_100099721 Ga0070680_1000997212 286
90 3300005366 Ga0070659_100021015 Ga0070659_1000210154 286
91 3300005530 Ga0070679_100521261 Ga0070679_1005212611 286
92 3300013102 Ga0157371_10053429 Ga0157371_100534292 286
93 3300013104 Ga0157370_10279061 Ga0157370_102790612 286
94 3300013105 Ga0157369_10028941 Ga0157369_100289415 286
95 3300025919 Ga0207657_10032558 Ga0207657_100325583 286
96 3300025932 Ga0207690_10111080 Ga0207690_101110802 286
97 3300025949 Ga0207667_10043550 Ga0207667_100435503 286
98 3300049571 Ga0501034_0281540 Ga0501034_0281540_451_1311 286
99 3300049586 Ga0501070_0149535 Ga0501070_0149535_890_1750 286
100 3300049822 Ga0501035_0169348 Ga0501035_0169348_307_1167 286
101 3300005331 Ga0070670_100469347 Ga0070670_1004693471 287
102 3300005339 Ga0070660_100001807 Ga0070660_1000018073 287
103 3300025925 Ga0207650_10109201 Ga0207650_101092012 287
104 iso_pu_bacteria 2929154850 2929157442 287
105 3300005327 Ga0070658_10065901 Ga0070658_100659012 288
106 3300005328 Ga0070676_10021643 Ga0070676_100216433 288
107 3300005331 Ga0070670_100032305 Ga0070670_1000323052 288
108 3300005335 Ga0070666_10001617 Ga0070666_100016173 288
109 3300005338 Ga0068868_100018242 Ga0068868_1000182423 288
110 3300005347 Ga0070668_100013739 Ga0070668_1000137394 288
111 3300005347 Ga0070668_100139170 Ga0070668_1001391702 288
112 3300005354 Ga0070675_100052633 Ga0070675_1000526332 288
113 3300005364 Ga0070673_100104377 Ga0070673_1001043772 288
114 3300005367 Ga0070667_100000492 Ga0070667_1000004924 288
115 3300005459 Ga0068867_100070176 Ga0068867_1000701762 288
116 3300005459 Ga0068867_100084485 Ga0068867_1000844852 288
117 3300005539 Ga0068853_100016523 Ga0068853_1000165235 288
118 3300005543 Ga0070672_100002526 Ga0070672_10000252611 288
119 3300005548 Ga0070665_100006195 Ga0070665_1000061953 288
120 3300005618 Ga0068864_100002625 Ga0068864_1000026253 288
121 3300005719 Ga0068861_100014552 Ga0068861_1000145525 288
122 3300005719 Ga0068861_100170231 Ga0068861_1001702312 288
123 3300005834 Ga0068851_10018455 Ga0068851_100184552 288
124 3300005841 Ga0068863_100041642 Ga0068863_1000416422 288
125 3300005842 Ga0068858_100005957 Ga0068858_10000595711 288
126 3300005843 Ga0068860_100102965 Ga0068860_1001029653 288
127 3300006237 Ga0097621_100050613 Ga0097621_1000506132 288
128 3300006881 Ga0068865_100019896 Ga0068865_1000198962 288
129 3300009093 Ga0105240_10219871 Ga0105240_102198713 288
130 3300009101 Ga0105247_10014543 Ga0105247_100145433 288
131 3300009148 Ga0105243_10099604 Ga0105243_100996043 288
132 3300009174 Ga0105241_10342074 Ga0105241_103420742 288
133 3300009176 Ga0105242_10120076 Ga0105242_101200762 288
134 3300009177 Ga0105248_10224207 Ga0105248_102242072 288
135 3300011119 Ga0105246_10132416 Ga0105246_101324162 288
136 3300013296 Ga0157374_10060398 Ga0157374_100603982 288
137 3300013297 Ga0157378_10021845 Ga0157378_100218453 288
138 3300013306 Ga0163162_10001596 Ga0163162_1000159617 288
139 3300013308 Ga0157375_10039446 Ga0157375_100394462 288
140 3300014325 Ga0163163_10013034 Ga0163163_100130347 288
141 3300014325 Ga0163163_10092376 Ga0163163_100923763 288
142 3300014968 Ga0157379_10043267 Ga0157379_100432673 288
143 3300014969 Ga0157376_10006718 Ga0157376_100067183 288
144 3300014969 Ga0157376_10029531 Ga0157376_100295313 288
145 3300025903 Ga0207680_10024200 Ga0207680_100242002 288
146 3300025907 Ga0207645_10037528 Ga0207645_100375283 288
147 3300025909 Ga0207705_10018057 Ga0207705_100180574 288
148 3300025925 Ga0207650_10001164 Ga0207650_100011646 288
149 3300025927 Ga0207687_10157042 Ga0207687_101570422 288
150 3300025940 Ga0207691_10000001 Ga0207691_1000000111 288
151 3300025942 Ga0207689_10381969 Ga0207689_103819691 288
152 3300025949 Ga0207667_10083884 Ga0207667_100838843 288
153 3300025960 Ga0207651_10071275 Ga0207651_100712753 288
154 3300025972 Ga0207668_10000540 Ga0207668_1000054021 288
155 3300025986 Ga0207658_10000946 Ga0207658_1000094619 288
156 3300026023 Ga0207677_10016914 Ga0207677_100169144 288
157 3300026035 Ga0207703_10020309 Ga0207703_100203094 288
158 3300026041 Ga0207639_10100977 Ga0207639_101009772 288
159 3300026067 Ga0207678_10223134 Ga0207678_102231342 288
160 3300026088 Ga0207641_10014758 Ga0207641_100147583 288
161 3300026089 Ga0207648_10009139 Ga0207648_100091398 288
162 3300026089 Ga0207648_10020419 Ga0207648_100204192 288
163 3300026095 Ga0207676_10001871 Ga0207676_100018717 288
164 3300026118 Ga0207675_100052126 Ga0207675_1000521263 288
165 3300026121 Ga0207683_10213341 Ga0207683_102133412 288
166 3300028379 Ga0268266_10173466 Ga0268266_101734662 288
167 3300028381 Ga0268264_10006865 Ga0268264_100068653 288
168 3300005331 Ga0070670_100081130 Ga0070670_1000811302 289
169 3300025940 Ga0207691_10408311 Ga0207691_104083112 289
170 3300028800 Ga0265338_10003582 Ga0265338_100035828 289
171 iso_pu_bacteria 2818991444 2819588756 289
172 3300005366 Ga0070659_100044601 Ga0070659_1000446012 290
173 3300005543 Ga0070672_100504071 Ga0070672_1005040711 290
174 3300005563 Ga0068855_100005142 Ga0068855_1000051427 290
175 3300005577 Ga0068857_100430503 Ga0068857_1004305031 290
176 3300006173 Ga0070716_100072959 Ga0070716_1000729592 290
177 3300013104 Ga0157370_10001240 Ga0157370_1000124013 290
178 3300013307 Ga0157372_10051150 Ga0157372_100511503 290
179 3300025949 Ga0207667_10005263 Ga0207667_100052634 290
180 3300026116 Ga0207674_10459234 Ga0207674_104592341 290
181 3300031251 Ga0265327_10000084 Ga0265327_10000084177 290
182 3300031507 Ga0307509_10028479 Ga0307509_100284794 290
183 3300037312 Ga0395899_0062044 Ga0395899_0062044_847_1734 290
184 3300037418 Ga0395900_0021588 Ga0395900_0021588_3543_4430 290
185 3300037466 Ga0395898_0078449 Ga0395898_0078449_1300_2187 290
186 3300038443 Ga0395901_0021720 Ga0395901_0021720_1709_2596 290
187 3300013307 Ga0157372_10144970 Ga0157372_101449703 292
188 3300044712 Ga0453684_0011639 Ga0453684_0011639_9285_10181 292
189 3300053108 Ga0500562_000040 Ga0500562_000040_16076_16993 292
190 3300005334 Ga0068869_100223883 Ga0068869_1002238831 293
191 3300005539 Ga0068853_100109571 Ga0068853_1001095713 293
192 3300005543 Ga0070672_100111740 Ga0070672_1001117402 293
193 3300005564 Ga0070664_100013842 Ga0070664_1000138422 293
194 3300013296 Ga0157374_10000004 Ga0157374_1000000429 293
195 3300013297 Ga0157378_10516803 Ga0157378_105168031 293
196 3300013306 Ga0163162_10009773 Ga0163162_100097738 293
197 3300014745 Ga0157377_10010516 Ga0157377_100105162 293
198 3300014969 Ga0157376_10009201 Ga0157376_100092017 293
199 3300025940 Ga0207691_10010249 Ga0207691_100102497 293
200 3300026142 Ga0207698_10064831 Ga0207698_100648312 293
201 3300028794 Ga0307515_10002910 Ga0307515_100029103 293
202 3300042876 Ga0451577_0000614 Ga0451577_0000614_48953_49903 293
203 3300044712 Ga0453684_0001797 Ga0453684_0001797_37487_38437 293
204 3300005364 Ga0070673_100040758 Ga0070673_1000407583 294
205 3300005459 Ga0068867_100062935 Ga0068867_1000629353 294
206 3300005578 Ga0068854_100417530 Ga0068854_1004175301 294
207 3300005616 Ga0068852_100132510 Ga0068852_1001325103 294
208 3300005617 Ga0068859_100049111 Ga0068859_1000491112 294
209 3300005719 Ga0068861_100089067 Ga0068861_1000890673 294
210 3300006931 Ga0097620_100049111 Ga0097620_1000491112 294
211 3300013100 Ga0157373_10078199 Ga0157373_100781992 294
212 3300013296 Ga0157374_10104683 Ga0157374_101046833 294
213 3300013306 Ga0163162_10009349 Ga0163162_100093497 294
214 3300025907 Ga0207645_10069851 Ga0207645_100698513 294
215 3300025942 Ga0207689_10011904 Ga0207689_100119044 294
216 3300025981 Ga0207640_10163388 Ga0207640_101633882 294
217 3300026041 Ga0207639_10062337 Ga0207639_100623371 294
218 3300037418 Ga0395900_0041092 Ga0395900_0041092_3699_4610 294
219 3300037471 Ga0395905_0004912 Ga0395905_0004912_11885_12796 294
220 3300037471 Ga0395905_0016054 Ga0395905_0016054_5099_6010 294
221 3300044673 Ga0453683_0000718 Ga0453683_0000718_30794_31774 294
222 3300049572 Ga0501036_0034598 Ga0501036_0034598_741_1667 294
223 3300049579 Ga0501043_0147771 Ga0501043_0147771_724_1650 294
224 3300049688 Ga0501259_000490 Ga0501259_000490_968_1864 294
225 3300049822 Ga0501035_0012462 Ga0501035_0012462_6353_7279 294
226 3300005329 Ga0070683_100038857 Ga0070683_1000388573 295
227 3300005331 Ga0070670_100144405 Ga0070670_1001444052 295
228 3300005334 Ga0068869_100075820 Ga0068869_1000758202 295
229 3300005335 Ga0070666_10000411 Ga0070666_100004118 295
230 3300005347 Ga0070668_100232795 Ga0070668_1002327952 295
231 3300005367 Ga0070667_100020208 Ga0070667_1000202082 295
232 3300005617 Ga0068859_100000037 Ga0068859_10000003737 295
233 3300005617 Ga0068859_100027856 Ga0068859_1000278565 295
234 3300005618 Ga0068864_100014449 Ga0068864_1000144495 295
235 3300005841 Ga0068863_100026690 Ga0068863_1000266902 295
236 3300005842 Ga0068858_100034522 Ga0068858_1000345223 295
237 3300005843 Ga0068860_100015281 Ga0068860_1000152813 295
238 3300006237 Ga0097621_100018082 Ga0097621_1000180823 295
239 3300006358 Ga0068871_100004953 Ga0068871_1000049535 295
240 3300006931 Ga0097620_100000037 Ga0097620_10000003737 295
241 3300006931 Ga0097620_100027855 Ga0097620_1000278552 295
242 3300009101 Ga0105247_10023765 Ga0105247_100237652 295
243 3300009174 Ga0105241_10001055 Ga0105241_1000105514 295
244 3300009545 Ga0105237_10001973 Ga0105237_100019735 295
245 3300009553 Ga0105249_10001713 Ga0105249_100017132 295
246 3300010375 Ga0105239_10119293 Ga0105239_101192932 295
247 3300013296 Ga0157374_10222350 Ga0157374_102223502 295
248 3300013297 Ga0157378_10015181 Ga0157378_100151812 295
249 3300013306 Ga0163162_10026265 Ga0163162_100262652 295
250 3300013306 Ga0163162_10354909 Ga0163162_103549092 295
251 3300013307 Ga0157372_10127401 Ga0157372_101274012 295
252 3300013308 Ga0157375_10015790 Ga0157375_100157902 295
253 3300014325 Ga0163163_10099050 Ga0163163_100990502 295
254 3300014969 Ga0157376_10196564 Ga0157376_101965641 295
255 3300025321 Ga0207656_10029921 Ga0207656_100299212 295
256 3300025900 Ga0207710_10012180 Ga0207710_100121802 295
257 3300025903 Ga0207680_10000619 Ga0207680_100006198 295
258 3300025911 Ga0207654_10001155 Ga0207654_1000115512 295
259 3300025914 Ga0207671_10002513 Ga0207671_100025132 295
260 3300025925 Ga0207650_10058928 Ga0207650_100589282 295
261 3300025938 Ga0207704_10355672 Ga0207704_103556721 295
262 3300025942 Ga0207689_10021440 Ga0207689_100214404 295
263 3300025961 Ga0207712_10011771 Ga0207712_100117712 295
264 3300025972 Ga0207668_10020729 Ga0207668_100207294 295
265 3300025986 Ga0207658_10059247 Ga0207658_100592472 295
266 3300026035 Ga0207703_10010311 Ga0207703_100103113 295
267 3300026088 Ga0207641_10000226 Ga0207641_1000022615 295
268 3300026116 Ga0207674_10068927 Ga0207674_100689272 295
269 3300026142 Ga0207698_10020543 Ga0207698_100205433 295
270 3300026142 Ga0207698_10217489 Ga0207698_102174892 295
271 3300028381 Ga0268264_10020176 Ga0268264_100201762 295
272 3300028654 Ga0265322_10000052 Ga0265322_1000005240 295
273 3300028800 Ga0265338_10087857 Ga0265338_100878573 295
274 3300029957 Ga0265324_10061997 Ga0265324_100619971 295
275 3300031507 Ga0307509_10123587 Ga0307509_101235871 295
276 3300003320 rootH2_10013110 rootH2_100131104 296
277 3300005564 Ga0070664_100323862 Ga0070664_1003238622 296
278 3300005841 Ga0068863_100220165 Ga0068863_1002201652 296
279 3300009093 Ga0105240_10061437 Ga0105240_100614375 296
280 3300010375 Ga0105239_10001797 Ga0105239_1000179710 296
281 3300014969 Ga0157376_10051924 Ga0157376_100519243 296
282 3300025913 Ga0207695_10386526 Ga0207695_103865262 296
283 3300026088 Ga0207641_10085072 Ga0207641_100850723 296
284 3300037471 Ga0395905_0511012 Ga0395905_0511012_121_1041 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

81

320

0.97

PF01745

IPT

Isopentenyl transferase

46

154

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9381 6 295
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.928 7 287
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.9169 6 295
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9028 4 295
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.8623 4 295
ID Description Score Start End Superfamily
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.941 201 278 1.10.287.890
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9404 4 115 3.40.50.300
2qgnA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9316 203 280 1.10.287.890
3a8tA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9297 5 112 3.40.50.300
3d3qB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9293 6 111 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1M6JY77-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9774 7 295 GO:0005524
GO:0006400
GO:0052381
AF-A0A352MBT5-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) 0.9742 4 254 GO:0005524
GO:0006400
GO:0052381
AF-A0A3M0YGK8-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9739 3 274 GO:0005524
GO:0006400
GO:0052381
AF-F2KZH0-F1-model_v4 deleted 0.9735 7 295
AF-A0A3P1XWX5-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) (Dimethylallyl diphosphate:tRNA dimethylallyltransferase) (DMAPP:tRNA dimethylallyltransferase) (DMATase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPPT) (IPTase) 0.9717 7 295 GO:0005524
GO:0006400
GO:0052381

Feature Viewer

pLDDT pTM Quality
92.75 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map