F386190

General Info

Members Datasets Scaffolds Average Seq Length
284 173 568 169

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10504833|Ga0157373_105048331
Length 188
Sequence MRVGVTFAGRTSASLSGVPTMTISMYQACVPVCTRALRNLRAVLQKGEAFATEKGVTADVVLQARLILDMLPLVRQVQIATDMAKNGACRLAGIEPPKFEDDETDFQQLYSRIDRAISVIEGLAPAQIDGSEARAITLQMRTGEMKFQGQDYLLGFVLPNLFFHCTTTYAILRAAGAELGKSDFMGKM

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
54 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
55 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
56 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
161 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
162 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
163 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
164 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
169 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
170 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
171 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
172 2643221695 Lysobacter sp. Root494 Isolate Unclassified
173 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 2.11
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 2.11
Rhizosphere 89.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10504833 3300013100 Bacteria 874
2 SwRhRL2b_contig_3311027 2162886007 Bacteria 3413
3 JGI24739J22299_10007734 3300001989 Bacteria 4020
4 JGI24737J22298_10010825 3300001990 Bacteria 3000
5 JGI24735J21928_10080956 3300002067 Bacteria 930
6 JGI25156J39149_1008129 3300002705 Bacteria 2674
7 JGI25154J39366_1010986 3300002738 Bacteria 1055
8 JGI25157J39369_1004212 3300002741 Bacteria 2674
9 JGI25153J46596_10047374 3300003215 Bacteria 1265
10 rootH1_10099920 3300003316 Bacteria 1921
11 rootH2_10115421 3300003320 Bacteria 4863
12 Ga0006562J51391_1008254 3300003578 Bacteria 4650
13 Ga0055529_1009301 3300003763 Bacteria 1292
14 Ga0065704_10070903 3300005289 Bacteria 14826
15 Ga0065704_10233517 3300005289 Bacteria 1036
16 Ga0070658_10068098 3300005327 Bacteria 2909
17 Ga0070658_10283901 3300005327 Bacteria 1409
18 Ga0070683_100433901 3300005329 Bacteria 1253
19 Ga0070683_101536154 3300005329 Bacteria 640
20 Ga0070670_100017342 3300005331 Bacteria 6176
21 Ga0070670_100588401 3300005331 Bacteria 995
22 Ga0070680_100008855 3300005336 Bacteria 7714
23 Ga0070680_100351502 3300005336 Bacteria 1253
24 Ga0070682_100046945 3300005337 Bacteria 2683
25 Ga0070661_100198923 3300005344 Bacteria 1530
26 Ga0070661_100266510 3300005344 Bacteria 1325
27 Ga0070661_100489556 3300005344 Bacteria 983
28 Ga0070668_100473710 3300005347 Bacteria 1080
29 Ga0070675_100799963 3300005354 Bacteria 862
30 Ga0070671_100455732 3300005355 Bacteria 1097
31 Ga0070671_101340253 3300005355 Bacteria 632
32 Ga0070659_100235863 3300005366 Bacteria 1512
33 Ga0070711_100546222 3300005439 Bacteria 961
34 Ga0070663_100001177 3300005455 Bacteria 14396
35 Ga0070663_100065470 3300005455 Bacteria 2630
36 Ga0070663_100069717 3300005455 Bacteria 2555
37 Ga0070663_100501687 3300005455 Bacteria 1008
38 Ga0070678_100463655 3300005456 Bacteria 1112
39 Ga0070662_100592553 3300005457 Bacteria 932
40 Ga0070681_10000008 3300005458 Bacteria 151355
41 Ga0070681_10000367 3300005458 Bacteria 36431
42 Ga0068867_100000047 3300005459 Bacteria 74014
43 Ga0068867_100078204 3300005459 Bacteria 2488
44 Ga0070679_100000042 3300005530 Bacteria 95394
45 Ga0070679_100529098 3300005530 Bacteria 1123
46 Ga0068853_100158378 3300005539 Bacteria 2041
47 Ga0070672_100791930 3300005543 Bacteria 834
48 Ga0068855_100016239 3300005563 Bacteria 8953
49 Ga0068855_100026700 3300005563 Bacteria 6909
50 Ga0068855_100084091 3300005563 Bacteria 3685
51 Ga0068855_100251464 3300005563 Bacteria 1971
52 Ga0068855_100318239 3300005563 Bacteria 1720
53 Ga0068855_100407520 3300005563 Bacteria 1489
54 Ga0070664_100071006 3300005564 Bacteria 2983
55 Ga0070664_100457708 3300005564 Bacteria 1172
56 Ga0070664_100550149 3300005564 Bacteria 1067
57 Ga0068857_100003595 3300005577 Bacteria 12975
58 Ga0068857_100065680 3300005577 Bacteria 3227
59 Ga0068854_100011613 3300005578 Bacteria 5743
60 Ga0068854_100031515 3300005578 Bacteria 3685
61 Ga0068856_100000167 3300005614 Bacteria 68389
62 Ga0068856_100414990 3300005614 Bacteria 1366
63 Ga0068852_100022465 3300005616 Bacteria 5059
64 Ga0068864_100047880 3300005618 Bacteria 3674
65 Ga0068864_100869247 3300005618 Bacteria 889
66 Ga0068851_10005821 3300005834 Bacteria 5617
67 Ga0068863_100477346 3300005841 Bacteria 1226
68 Ga0068858_100029749 3300005842 Bacteria 5074
69 Ga0075428_100687370 3300006844 Bacteria 1090
70 Ga0105240_10015699 3300009093 Bacteria 10280
71 Ga0105240_10095670 3300009093 Bacteria 3621
72 Ga0105240_10115921 3300009093 Bacteria 3233
73 Ga0105240_10125497 3300009093 Bacteria 3085
74 Ga0105240_10182426 3300009093 Bacteria 2476
75 Ga0105240_10277735 3300009093 Bacteria 1926
76 Ga0105243_10003519 3300009148 Bacteria 12652
77 Ga0105243_10384574 3300009148 Bacteria 1299
78 Ga0105241_10148050 3300009174 Bacteria 1918
79 Ga0105242_10289046 3300009176 Bacteria 1492
80 Ga0105248_10241299 3300009177 Bacteria 2034
81 Ga0105248_11500174 3300009177 Bacteria 763
82 Ga0105237_10000058 3300009545 Bacteria 146943
83 Ga0105237_10000147 3300009545 Bacteria 99597
84 Ga0105238_10128870 3300009551 Bacteria 2509
85 Ga0105239_10048197 3300010375 Bacteria 4671
86 Ga0157318_1000213 3300012482 Bacteria 2235
87 Ga0157314_1000006 3300012500 Bacteria 27364
88 Ga0157315_1000453 3300012508 Bacteria 1887
89 Ga0157316_1000674 3300012510 Bacteria 1877
90 Ga0157373_10019934 3300013100 Bacteria 4878
91 Ga0157373_10148043 3300013100 Bacteria 1652
92 Ga0157371_10033636 3300013102 Bacteria 3682
93 Ga0157371_10094841 3300013102 Bacteria 2114
94 Ga0157371_10100612 3300013102 Bacteria 2050
95 Ga0157371_10182944 3300013102 Bacteria 1499
96 Ga0157370_10006036 3300013104 Bacteria 13469
97 Ga0157370_10164132 3300013104 Bacteria 2066
98 Ga0157370_10263104 3300013104 Bacteria 1594
99 Ga0157370_10554745 3300013104 Bacteria 1053
100 Ga0157370_10731304 3300013104 Bacteria 902
101 Ga0157369_10011504 3300013105 Bacteria 10051
102 Ga0157369_10017132 3300013105 Bacteria 8140
103 Ga0157369_10087371 3300013105 Bacteria 3329
104 Ga0157369_10208239 3300013105 Bacteria 2050
105 Ga0157372_10003440 3300013307 Bacteria 17075
106 Ga0157372_10007026 3300013307 Bacteria 11990
107 Ga0157372_10126782 3300013307 Bacteria 2935
108 Ga0157372_10281974 3300013307 Bacteria 1932
109 Ga0157372_10308436 3300013307 Bacteria 1842
110 Ga0157375_10109056 3300013308 Bacteria 2864
111 Ga0157375_10454119 3300013308 Bacteria 1447
112 Ga0157377_10000083 3300014745 Bacteria 73632
113 Ga0197907_10782449 3300020069 Bacteria 709
114 Ga0206356_11356430 3300020070 Bacteria 2043
115 Ga0206354_11563798 3300020081 Bacteria 1508
116 Ga0224712_10197889 3300022467 Bacteria 912
117 Ga0209646_1001944 3300025246 Bacteria 4991
118 Ga0209026_1000123 3300025250 Bacteria 125961
119 Ga0209759_1009436 3300025256 Bacteria 2950
120 Ga0209759_1036259 3300025256 Bacteria 900
121 Ga0209455_1002011 3300025272 Bacteria 8329
122 Ga0209758_1001218 3300025297 Bacteria 32278
123 Ga0207656_10011789 3300025321 Bacteria 3308
124 Ga0207647_10010457 3300025904 Bacteria 6555
125 Ga0207647_10044386 3300025904 Bacteria 2778
126 Ga0207647_10215312 3300025904 Bacteria 1108
127 Ga0207705_10093273 3300025909 Bacteria 2207
128 Ga0207705_10198090 3300025909 Bacteria 1521
129 Ga0207654_10149887 3300025911 Bacteria 1496
130 Ga0207707_10000306 3300025912 Bacteria 51447
131 Ga0207707_10000442 3300025912 Bacteria 43048
132 Ga0207707_10000708 3300025912 Bacteria 33137
133 Ga0207695_10000639 3300025913 Bacteria 69783
134 Ga0207695_10008438 3300025913 Bacteria 12900
135 Ga0207695_10065028 3300025913 Bacteria 3752
136 Ga0207695_10067994 3300025913 Bacteria 3651
137 Ga0207671_10000026 3300025914 Bacteria 268845
138 Ga0207671_10000192 3300025914 Bacteria 94837
139 Ga0207663_10758997 3300025916 Bacteria 771
140 Ga0207660_10001548 3300025917 Bacteria 15402
141 Ga0207660_10006274 3300025917 Bacteria 7714
142 Ga0207657_10008610 3300025919 Bacteria 10327
143 Ga0207657_10026195 3300025919 Bacteria 5363
144 Ga0207657_10140614 3300025919 Bacteria 1972
145 Ga0207657_10601280 3300025919 Bacteria 858
146 Ga0207649_10029060 3300025920 Bacteria 3262
147 Ga0207649_10371364 3300025920 Bacteria 1064
148 Ga0207652_10000048 3300025921 Bacteria 124452
149 Ga0207652_10001807 3300025921 Bacteria 18543
150 Ga0207652_10832725 3300025921 Bacteria 818
151 Ga0207652_10989134 3300025921 Bacteria 740
152 Ga0207681_10019834 3300025923 Bacteria 4256
153 Ga0207650_10028670 3300025925 Bacteria 3995
154 Ga0207650_10151983 3300025925 Bacteria 1827
155 Ga0207659_10193902 3300025926 Bacteria 1618
156 Ga0207644_10104211 3300025931 Bacteria 2135
157 Ga0207690_10013920 3300025932 Bacteria 4847
158 Ga0207690_10501015 3300025932 Bacteria 982
159 Ga0207690_10617441 3300025932 Bacteria 886
160 Ga0207706_10057423 3300025933 Bacteria 3429
161 Ga0207709_10005609 3300025935 Bacteria 7098
162 Ga0207709_10457421 3300025935 Bacteria 988
163 Ga0207691_10003980 3300025940 Bacteria 14348
164 Ga0207661_10018103 3300025944 Bacteria 5231
165 Ga0207661_11322507 3300025944 Bacteria 662
166 Ga0207679_10037864 3300025945 Bacteria 3432
167 Ga0207679_10396120 3300025945 Bacteria 1214
168 Ga0207679_11113160 3300025945 Bacteria 724
169 Ga0207667_10000424 3300025949 Bacteria 56996
170 Ga0207667_10000534 3300025949 Bacteria 50148
171 Ga0207667_10003235 3300025949 Bacteria 20091
172 Ga0207667_10006878 3300025949 Bacteria 13742
173 Ga0207667_10218177 3300025949 Bacteria 1954
174 Ga0207651_10337613 3300025960 Bacteria 1265
175 Ga0207651_10489224 3300025960 Bacteria 1062
176 Ga0207640_10000642 3300025981 Bacteria 20438
177 Ga0207640_10001615 3300025981 Bacteria 12093
178 Ga0207640_10002195 3300025981 Bacteria 10493
179 Ga0207703_10042770 3300026035 Bacteria 3635
180 Ga0207678_10007623 3300026067 Bacteria 9561
181 Ga0207678_10019280 3300026067 Bacteria 5991
182 Ga0207678_10081685 3300026067 Bacteria 2766
183 Ga0207678_10152667 3300026067 Bacteria 1972
184 Ga0207678_10328961 3300026067 Bacteria 1315
185 Ga0207702_10000130 3300026078 Bacteria 89196
186 Ga0207702_10137491 3300026078 Bacteria 2206
187 Ga0207702_10669796 3300026078 Bacteria 1021
188 Ga0207641_10562789 3300026088 Bacteria 1113
189 Ga0207648_10000091 3300026089 Bacteria 85128
190 Ga0207676_10727760 3300026095 Bacteria 963
191 Ga0207674_10001848 3300026116 Bacteria 26995
192 Ga0207674_10335859 3300026116 Bacteria 1461
193 Ga0207674_10847968 3300026116 Bacteria 881
194 Ga0207683_10277477 3300026121 Bacteria 1531
195 Ga0207698_10008193 3300026142 Bacteria 6591
196 Ga0207698_10132577 3300026142 Bacteria 2132
197 Ga0207698_10157632 3300026142 Bacteria 1980
198 Ga0207698_10319499 3300026142 Bacteria 1453
199 Ga0268265_10073768 3300028380 Bacteria 2667
200 Ga0307509_10227708 3300031507 Bacteria 1670
201 Ga0307408_100667218 3300031548 Bacteria 931
202 Ga0307408_100675888 3300031548 Bacteria 926
203 Ga0307410_10313632 3300031852 Bacteria 1242
204 Ga0307406_10217896 3300031901 Bacteria 1417
205 Ga0307407_10970025 3300031903 Bacteria 655
206 Ga0307409_100342362 3300031995 Bacteria 1408
207 Ga0307409_101591956 3300031995 Bacteria 681
208 Ga0307416_102390418 3300032002 Bacteria 628
209 Ga0307414_10329310 3300032004 Bacteria 1303
210 Ga0307411_10257456 3300032005 Bacteria 1376
211 Ga0307411_10789465 3300032005 Bacteria 835
212 Ga0307411_11517798 3300032005 Bacteria 616
213 Ga0307415_100413030 3300032126 Bacteria 1156
214 Ga0373952_0128290 3300035092 Bacteria 694
215 Ga0373932_0008501 3300035112 Bacteria 2455
216 Ga0395899_0652091 3300037312 Bacteria 665
217 Ga0395900_0807486 3300037418 Bacteria 866
218 Ga0395905_0142412 3300037471 Bacteria 2255
219 Ga0395905_0507958 3300037471 Bacteria 1106
220 Ga0451793_0740421 3300041452 Bacteria 1891
221 Ga0439432_003464 3300042006 Bacteria 5850
222 Ga0439432_115887 3300042006 Bacteria 795
223 Ga0439449_0005698 3300042007 Bacteria 4762
224 Ga0439449_0167066 3300042007 Bacteria 822
225 Ga0439457_055226 3300042014 Bacteria 895
226 Ga0451577_0216809 3300042876 Bacteria 1729
227 Ga0451576_0046197 3300045051 Bacteria 4586
228 Ga0495592_0496392 3300046454 Bacteria 758
229 Ga0495638_0000060 3300046460 Bacteria 190580
230 Ga0495582_0485834 3300046473 Bacteria 714
231 Ga0495606_0003142 3300046507 Bacteria 17900
232 Ga0495665_0003495 3300046531 Bacteria 8529
233 Ga0495598_0000332 3300046537 Bacteria 8428
234 Ga0495621_0000126 3300046539 Bacteria 16315
235 Ga0495621_0076515 3300046539 Bacteria 1241
236 Ga0495656_0080164 3300046615 Bacteria 1471
237 Ga0495668_0109926 3300046616 Bacteria 1508
238 Ga0495659_0007865 3300046664 Bacteria 3382
239 Ga0495659_0028358 3300046664 Bacteria 1937
240 Ga0495659_0095990 3300046664 Bacteria 1143
241 Ga0495636_0002340 3300047318 Bacteria 7283
242 Ga0495636_0004798 3300047318 Bacteria 5294
243 Ga0495636_0034093 3300047318 Bacteria 2094
244 Ga0495636_0191392 3300047318 Bacteria 931
245 Ga0495615_0085538 3300048090 Bacteria 871
246 Ga0496106_0067369 3300048909 Bacteria 2729
247 Ga0496107_0094380 3300048910 Bacteria 2189
248 Ga0496109_0163081 3300048912 Bacteria 2088
249 Ga0496110_0284634 3300048913 Bacteria 1505
250 Ga0496113_0814720 3300048916 Bacteria 741
251 Ga0496121_0164562 3300048924 Bacteria 1618
252 Ga0496124_0472329 3300048927 Bacteria 849
253 Ga0496125_0003619 3300048928 Bacteria 18554
254 Ga0501307_079608 3300049162 Bacteria 533
255 Ga0501031_0187057 3300049568 Bacteria 1352
256 Ga0501032_0423305 3300049569 Bacteria 854
257 Ga0501033_0566841 3300049570 Bacteria 781
258 Ga0501034_0128979 3300049571 Bacteria 2513
259 Ga0501043_0704140 3300049579 Bacteria 737
260 Ga0501046_0020701 3300049580 Bacteria 5437
261 Ga0501046_0162684 3300049580 Bacteria 1678
262 Ga0501047_0446144 3300049581 Bacteria 1123
263 Ga0501069_0092415 3300049585 Bacteria 1711
264 Ga0501070_0000426 3300049586 Bacteria 38386
265 Ga0501070_0184173 3300049586 Bacteria 1718
266 Ga0501074_0198303 3300049590 Bacteria 1431
267 Ga0501202_014581 3300049652 Bacteria 1505
268 Ga0501209_216349 3300049656 Bacteria 593
269 Ga0501242_011095 3300049674 Bacteria 1084
270 Ga0501250_003295 3300049680 Bacteria 1536
271 Ga0501266_033940 3300049763 Bacteria 738
272 Ga0501274_011133 3300049771 Bacteria 837
273 Ga0501035_0042736 3300049822 Bacteria 4087
274 Ga0501035_0797809 3300049822 Bacteria 754
275 Ga0501044_0018392 3300049823 Bacteria 7487
276 Ga0501044_0034464 3300049823 Bacteria 5308
277 Ga0501044_0415549 3300049823 Bacteria 1256
278 Ga0500590_110416 3300053148 Bacteria 1305
279 2572255977 2571042365 Bacteria 3289345
280 2643895792 2643221577 Bacteria 3710843
281 2643914820 2643221581 Bacteria 3893603
282 2644477984 2643221685 Bacteria 3673288
283 2644530241 2643221695 Bacteria 3441323
284 8055226757 8055225921 Bacteria 3341787
285 Ga0157373_10504833
286 SwRhRL2b_contig_3311027
287 JGI24739J22299_10007734
288 JGI24737J22298_10010825
289 JGI24735J21928_10080956
290 JGI25156J39149_1008129
291 JGI25154J39366_1010986
292 JGI25157J39369_1004212
293 JGI25153J46596_10047374
294 rootH1_10099920
295 rootH2_10115421
296 Ga0006562J51391_1008254
297 Ga0055529_1009301
298 Ga0065704_10070903
299 Ga0065704_10233517
300 Ga0070658_10068098
301 Ga0070658_10283901
302 Ga0070683_100433901
303 Ga0070683_101536154
304 Ga0070670_100017342
305 Ga0070670_100588401
306 Ga0070680_100008855
307 Ga0070680_100351502
308 Ga0070682_100046945
309 Ga0070661_100198923
310 Ga0070661_100266510
311 Ga0070661_100489556
312 Ga0070668_100473710
313 Ga0070675_100799963
314 Ga0070671_100455732
315 Ga0070671_101340253
316 Ga0070659_100235863
317 Ga0070711_100546222
318 Ga0070663_100001177
319 Ga0070663_100065470
320 Ga0070663_100069717
321 Ga0070663_100501687
322 Ga0070678_100463655
323 Ga0070662_100592553
324 Ga0070681_10000008
325 Ga0070681_10000367
326 Ga0068867_100000047
327 Ga0068867_100078204
328 Ga0070679_100000042
329 Ga0070679_100529098
330 Ga0068853_100158378
331 Ga0070672_100791930
332 Ga0068855_100016239
333 Ga0068855_100026700
334 Ga0068855_100084091
335 Ga0068855_100251464
336 Ga0068855_100318239
337 Ga0068855_100407520
338 Ga0070664_100071006
339 Ga0070664_100457708
340 Ga0070664_100550149
341 Ga0068857_100003595
342 Ga0068857_100065680
343 Ga0068854_100011613
344 Ga0068854_100031515
345 Ga0068856_100000167
346 Ga0068856_100414990
347 Ga0068852_100022465
348 Ga0068864_100047880
349 Ga0068864_100869247
350 Ga0068851_10005821
351 Ga0068863_100477346
352 Ga0068858_100029749
353 Ga0075428_100687370
354 Ga0105240_10015699
355 Ga0105240_10095670
356 Ga0105240_10115921
357 Ga0105240_10125497
358 Ga0105240_10182426
359 Ga0105240_10277735
360 Ga0105243_10003519
361 Ga0105243_10384574
362 Ga0105241_10148050
363 Ga0105242_10289046
364 Ga0105248_10241299
365 Ga0105248_11500174
366 Ga0105237_10000058
367 Ga0105237_10000147
368 Ga0105238_10128870
369 Ga0105239_10048197
370 Ga0157318_1000213
371 Ga0157314_1000006
372 Ga0157315_1000453
373 Ga0157316_1000674
374 Ga0157373_10019934
375 Ga0157373_10148043
376 Ga0157371_10033636
377 Ga0157371_10094841
378 Ga0157371_10100612
379 Ga0157371_10182944
380 Ga0157370_10006036
381 Ga0157370_10164132
382 Ga0157370_10263104
383 Ga0157370_10554745
384 Ga0157370_10731304
385 Ga0157369_10011504
386 Ga0157369_10017132
387 Ga0157369_10087371
388 Ga0157369_10208239
389 Ga0157372_10003440
390 Ga0157372_10007026
391 Ga0157372_10126782
392 Ga0157372_10281974
393 Ga0157372_10308436
394 Ga0157375_10109056
395 Ga0157375_10454119
396 Ga0157377_10000083
397 Ga0197907_10782449
398 Ga0206356_11356430
399 Ga0206354_11563798
400 Ga0224712_10197889
401 Ga0209646_1001944
402 Ga0209026_1000123
403 Ga0209759_1009436
404 Ga0209759_1036259
405 Ga0209455_1002011
406 Ga0209758_1001218
407 Ga0207656_10011789
408 Ga0207647_10010457
409 Ga0207647_10044386
410 Ga0207647_10215312
411 Ga0207705_10093273
412 Ga0207705_10198090
413 Ga0207654_10149887
414 Ga0207707_10000306
415 Ga0207707_10000442
416 Ga0207707_10000708
417 Ga0207695_10000639
418 Ga0207695_10008438
419 Ga0207695_10065028
420 Ga0207695_10067994
421 Ga0207671_10000026
422 Ga0207671_10000192
423 Ga0207663_10758997
424 Ga0207660_10001548
425 Ga0207660_10006274
426 Ga0207657_10008610
427 Ga0207657_10026195
428 Ga0207657_10140614
429 Ga0207657_10601280
430 Ga0207649_10029060
431 Ga0207649_10371364
432 Ga0207652_10000048
433 Ga0207652_10001807
434 Ga0207652_10832725
435 Ga0207652_10989134
436 Ga0207681_10019834
437 Ga0207650_10028670
438 Ga0207650_10151983
439 Ga0207659_10193902
440 Ga0207644_10104211
441 Ga0207690_10013920
442 Ga0207690_10501015
443 Ga0207690_10617441
444 Ga0207706_10057423
445 Ga0207709_10005609
446 Ga0207709_10457421
447 Ga0207691_10003980
448 Ga0207661_10018103
449 Ga0207661_11322507
450 Ga0207679_10037864
451 Ga0207679_10396120
452 Ga0207679_11113160
453 Ga0207667_10000424
454 Ga0207667_10000534
455 Ga0207667_10003235
456 Ga0207667_10006878
457 Ga0207667_10218177
458 Ga0207651_10337613
459 Ga0207651_10489224
460 Ga0207640_10000642
461 Ga0207640_10001615
462 Ga0207640_10002195
463 Ga0207703_10042770
464 Ga0207678_10007623
465 Ga0207678_10019280
466 Ga0207678_10081685
467 Ga0207678_10152667
468 Ga0207678_10328961
469 Ga0207702_10000130
470 Ga0207702_10137491
471 Ga0207702_10669796
472 Ga0207641_10562789
473 Ga0207648_10000091
474 Ga0207676_10727760
475 Ga0207674_10001848
476 Ga0207674_10335859
477 Ga0207674_10847968
478 Ga0207683_10277477
479 Ga0207698_10008193
480 Ga0207698_10132577
481 Ga0207698_10157632
482 Ga0207698_10319499
483 Ga0268265_10073768
484 Ga0307509_10227708
485 Ga0307408_100667218
486 Ga0307408_100675888
487 Ga0307410_10313632
488 Ga0307406_10217896
489 Ga0307407_10970025
490 Ga0307409_100342362
491 Ga0307409_101591956
492 Ga0307416_102390418
493 Ga0307414_10329310
494 Ga0307411_10257456
495 Ga0307411_10789465
496 Ga0307411_11517798
497 Ga0307415_100413030
498 Ga0373952_0128290
499 Ga0373932_0008501
500 Ga0395899_0652091
501 Ga0395900_0807486
502 Ga0395905_0142412
503 Ga0395905_0507958
504 Ga0451793_0740421
505 Ga0439432_003464
506 Ga0439432_115887
507 Ga0439449_0005698
508 Ga0439449_0167066
509 Ga0439457_055226
510 Ga0451577_0216809
511 Ga0451576_0046197
512 Ga0495592_0496392
513 Ga0495638_0000060
514 Ga0495582_0485834
515 Ga0495606_0003142
516 Ga0495665_0003495
517 Ga0495598_0000332
518 Ga0495621_0000126
519 Ga0495621_0076515
520 Ga0495656_0080164
521 Ga0495668_0109926
522 Ga0495659_0007865
523 Ga0495659_0028358
524 Ga0495659_0095990
525 Ga0495636_0002340
526 Ga0495636_0004798
527 Ga0495636_0034093
528 Ga0495636_0191392
529 Ga0495615_0085538
530 Ga0496106_0067369
531 Ga0496107_0094380
532 Ga0496109_0163081
533 Ga0496110_0284634
534 Ga0496113_0814720
535 Ga0496121_0164562
536 Ga0496124_0472329
537 Ga0496125_0003619
538 Ga0501307_079608
539 Ga0501031_0187057
540 Ga0501032_0423305
541 Ga0501033_0566841
542 Ga0501034_0128979
543 Ga0501043_0704140
544 Ga0501046_0020701
545 Ga0501046_0162684
546 Ga0501047_0446144
547 Ga0501069_0092415
548 Ga0501070_0000426
549 Ga0501070_0184173
550 Ga0501074_0198303
551 Ga0501202_014581
552 Ga0501209_216349
553 Ga0501242_011095
554 Ga0501250_003295
555 Ga0501266_033940
556 Ga0501274_011133
557 Ga0501035_0042736
558 Ga0501035_0797809
559 Ga0501044_0018392
560 Ga0501044_0034464
561 Ga0501044_0415549
562 Ga0500590_110416
563 2572255977
564 2643895792
565 2643914820
566 2644477984
567 2644530241
568 8055226757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

25

185

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9139 7 171
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8881 12 172
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.8727 7 171
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8684 12 172
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.7916 12 172
ID Description Score Start End Superfamily
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9345 5 169 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9074 5 169 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.883 12 172 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7895 12 172 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6691 14 170 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A3N8EL02-F1-model_v4 DUF1993 domain-containing protein 0.9945 4 150
AF-H1S876-F1-model_v4 DUF1993 domain-containing protein 0.9925 4 169
AF-A0A7W5J842-F1-model_v4 DUF1993 domain-containing protein 0.992 1 171 GO:0016020
AF-A0A0A2WDW0-F1-model_v4 DUF2007 domain containing protein 0.9917 11 172
AF-A0A259CW41-F1-model_v4 DUF1993 domain-containing protein 0.991 5 172

Map