F386055

General Info

Members Datasets Scaffolds Average Seq Length
284 214 568 519

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100004570|Ga0070707_1000045709
Length 586
Sequence VRIDDWFLTAAERGNPATRLDSRHPDWPTGQAWSTGNEVSPLIHGATYFSELLARVSEMRAGDLLVFTDWRGDPDEQLSSDGTTVAELLRDAAARGVIVRGLIWRSHWDKFQFSGQENRHLGADIDAAGGQCLLDMRVRAGGSHHMKMVVLRHPGRPSLDVAFVGGIDLCHSRRDEASHRGDPQRQPMAAVYGERPPWHDIQAMIRGPAVGDVEAVFRERWYDSVPITLNPVARLRDLVDRQDDTANRLPDQEPDPQPRGTHAVQLLRTYPFRRPGYSFAPKGERSIARGYLKVLARAQSLIYLEDQYLWSTVVVEALARALAGRPELRLIAVVPRFPDTGGRVAGSANLIGRIDAMRMLRQAGGERVAVYSPENEAGTPIYVHAKVCVVDDTWSIIGSDNFNRRSWTHDSELSCAVLHLSGEERGAGSRAGRDTIELPAADSPVVRAGAAATVEAEVNGWTAGLSVGAATLSAVPAAADPGAAALTPGPSDFARGLRLTLSNEHLGTELDPAATAAQTYATFWRSASDLDAWHANGRRGPRPPGRLRHYHAPDLPRWQRAIARPLYRFVYDPDGRPHAMRRRSEF

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
209 2643221670 Streptomyces sp. Root431 Isolate Unclassified
210 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
211 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
212 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
213 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
214 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 3.17
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100004570 3300005468 Bacteria 12957
2 Ga0070658_10028228 3300005327 Bacteria 4504
3 Ga0070658_10074690 3300005327 Bacteria 2780
4 Ga0070676_10024324 3300005328 Bacteria 3411
5 Ga0070676_10031806 3300005328 Bacteria 3019
6 Ga0070683_100031932 3300005329 Bacteria 4792
7 Ga0070670_100036862 3300005331 Bacteria 4207
8 Ga0068869_100009681 3300005334 Bacteria 6257
9 Ga0070680_100026749 3300005336 Bacteria 4614
10 Ga0070682_100007256 3300005337 Bacteria 6247
11 Ga0068868_100010777 3300005338 Bacteria 6629
12 Ga0070660_100006735 3300005339 Bacteria 7973
13 Ga0070660_100049887 3300005339 Bacteria 3219
14 Ga0070689_100052216 3300005340 Bacteria 3162
15 Ga0070691_10002104 3300005341 Bacteria 8806
16 Ga0070661_100022887 3300005344 Bacteria 4475
17 Ga0070692_10011555 3300005345 Bacteria 4056
18 Ga0070675_100032388 3300005354 Bacteria 4231
19 Ga0070675_100047967 3300005354 Bacteria 3501
20 Ga0070671_100007579 3300005355 Bacteria 8678
21 Ga0070659_100034058 3300005366 Bacteria 3960
22 Ga0070659_100074969 3300005366 Bacteria 2696
23 Ga0070709_10005572 3300005434 Bacteria 6817
24 Ga0070710_10003294 3300005437 Bacteria 7659
25 Ga0070708_100033300 3300005445 Bacteria 4477
26 Ga0070663_100005600 3300005455 Bacteria 7476
27 Ga0070663_100014023 3300005455 Bacteria 5133
28 Ga0070663_100026874 3300005455 Bacteria 3902
29 Ga0070678_100020952 3300005456 Bacteria 4300
30 Ga0070678_100110636 3300005456 Bacteria 2149
31 Ga0070678_100155019 3300005456 Bacteria 1849
32 Ga0070681_10036085 3300005458 Bacteria 4966
33 Ga0070706_100036602 3300005467 Bacteria 4533
34 Ga0070707_100007855 3300005468 Bacteria 9904
35 Ga0070698_100000804 3300005471 Bacteria 34239
36 Ga0070699_100016022 3300005518 Bacteria 6436
37 Ga0070679_100014065 3300005530 Bacteria 7675
38 Ga0070679_100018240 3300005530 Bacteria 6806
39 Ga0070684_100002067 3300005535 Bacteria 14797
40 Ga0070697_100006414 3300005536 Bacteria 9107
41 Ga0070693_100008277 3300005547 Bacteria 5116
42 Ga0070665_100076757 3300005548 Bacteria 3348
43 Ga0070664_100022339 3300005564 Bacteria 5216
44 Ga0068857_100147920 3300005577 Bacteria 2126
45 Ga0068854_100012579 3300005578 Bacteria 5545
46 Ga0068856_100064401 3300005614 Bacteria 3622
47 Ga0070702_100003679 3300005615 Bacteria 6902
48 Ga0070702_100023273 3300005615 Bacteria 3289
49 Ga0068852_100150426 3300005616 Bacteria 2164
50 Ga0068859_100082348 3300005617 Bacteria 3261
51 Ga0068864_100033167 3300005618 Bacteria 4389
52 Ga0068870_10001962 3300005840 Bacteria 8504
53 Ga0068863_100081002 3300005841 Bacteria 3075
54 Ga0068858_100020301 3300005842 Bacteria 6213
55 Ga0068862_100021128 3300005844 Bacteria 5441
56 Ga0081538_10000336 3300005981 Bacteria 53233
57 Ga0070717_10087936 3300006028 Bacteria 2618
58 Ga0075363_100006095 3300006048 Bacteria 5441
59 Ga0070715_10014771 3300006163 Bacteria 2899
60 Ga0070716_100003765 3300006173 Bacteria 7181
61 Ga0070712_100018325 3300006175 Bacteria 4546
62 Ga0075433_10011974 3300006852 Bacteria 6993
63 Ga0075434_100008016 3300006871 Bacteria 9788
64 Ga0075436_100010195 3300006914 Bacteria 6435
65 Ga0097620_100082347 3300006931 Bacteria 3261
66 Ga0075435_100012598 3300007076 Bacteria 6264
67 Ga0099794_10020709 3300007265 Bacteria 2979
68 Ga0111539_10012616 3300009094 Bacteria 10587
69 Ga0111539_10065711 3300009094 Bacteria 4285
70 Ga0105245_10026816 3300009098 Bacteria 5073
71 Ga0105243_10076557 3300009148 Bacteria 2719
72 Ga0105241_10101277 3300009174 Bacteria 2290
73 Ga0105238_10025110 3300009551 Bacteria 6073
74 Ga0105239_10187988 3300010375 Bacteria 2312
75 Ga0105246_10007529 3300011119 Bacteria 6678
76 Ga0157371_10043015 3300013102 Bacteria 3219
77 Ga0157370_10035204 3300013104 Bacteria 4869
78 Ga0157370_10104471 3300013104 Bacteria 2652
79 Ga0157369_10007193 3300013105 Bacteria 12828
80 Ga0157369_10089247 3300013105 Bacteria 3291
81 Ga0157374_10016721 3300013296 Bacteria 6454
82 Ga0157372_10071016 3300013307 Bacteria 3920
83 Ga0157375_10135867 3300013308 Bacteria 2583
84 Ga0157377_10002896 3300014745 Bacteria 7672
85 Ga0157377_10047991 3300014745 Bacteria 2394
86 Ga0206353_12063869 3300020082 Bacteria 6679
87 Ga0207692_10006587 3300025898 Bacteria 4719
88 Ga0207688_10017942 3300025901 Bacteria 3851
89 Ga0207699_10003657 3300025906 Bacteria 7343
90 Ga0207643_10000594 3300025908 Bacteria 22954
91 Ga0207705_10024085 3300025909 Bacteria 4344
92 Ga0207705_10053266 3300025909 Bacteria 2914
93 Ga0207684_10049057 3300025910 Bacteria 3582
94 Ga0207654_10010373 3300025911 Bacteria 4744
95 Ga0207707_10033415 3300025912 Bacteria 4501
96 Ga0207693_10026319 3300025915 Bacteria 4604
97 Ga0207660_10007800 3300025917 Bacteria 6928
98 Ga0207660_10020462 3300025917 Bacteria 4441
99 Ga0207657_10013667 3300025919 Bacteria 7952
100 Ga0207657_10061242 3300025919 Bacteria 3228
101 Ga0207649_10002784 3300025920 Bacteria 9659
102 Ga0207652_10044875 3300025921 Bacteria 3767
103 Ga0207646_10017562 3300025922 Bacteria 6689
104 Ga0207646_10044143 3300025922 Bacteria 4001
105 Ga0207694_10133704 3300025924 Bacteria 1990
106 Ga0207650_10001016 3300025925 Bacteria 21075
107 Ga0207659_10023875 3300025926 Bacteria 4089
108 Ga0207687_10031529 3300025927 Bacteria 3583
109 Ga0207700_10010556 3300025928 Bacteria 5836
110 Ga0207664_10006840 3300025929 Bacteria 7881
111 Ga0207644_10020814 3300025931 Bacteria 4462
112 Ga0207690_10020795 3300025932 Bacteria 4060
113 Ga0207706_10010250 3300025933 Bacteria 8570
114 Ga0207706_10015081 3300025933 Bacteria 6995
115 Ga0207665_10005312 3300025939 Bacteria 8607
116 Ga0207689_10001431 3300025942 Bacteria 22792
117 Ga0207661_10003516 3300025944 Bacteria 10885
118 Ga0207661_10019456 3300025944 Bacteria 5062
119 Ga0207661_10022096 3300025944 Bacteria 4783
120 Ga0207679_10020151 3300025945 Bacteria 4496
121 Ga0207679_10042975 3300025945 Bacteria 3251
122 Ga0207640_10037501 3300025981 Bacteria 3050
123 Ga0207703_10173857 3300026035 Bacteria 1896
124 Ga0207678_10010012 3300026067 Bacteria 8320
125 Ga0207678_10162786 3300026067 Bacteria 1905
126 Ga0207708_10039451 3300026075 Bacteria 3598
127 Ga0207702_10001992 3300026078 Bacteria 19810
128 Ga0207641_10047214 3300026088 Bacteria 3630
129 Ga0207676_10000896 3300026095 Bacteria 23105
130 Ga0207674_10011533 3300026116 Bacteria 9927
131 Ga0207674_10026177 3300026116 Bacteria 6204
132 Ga0207674_10167777 3300026116 Bacteria 2149
133 Ga0207683_10001721 3300026121 Bacteria 19553
134 Ga0207698_10002118 3300026142 Bacteria 11709
135 Ga0207428_10015402 3300027907 Bacteria 6615
136 Ga0268265_10024862 3300028380 Bacteria 4244
137 Ga0268264_10018610 3300028381 Bacteria 5679
138 Ga0307515_10001173 3300028794 Bacteria 59934
139 Ga0307408_100001356 3300031548 Bacteria 18313
140 Ga0307408_100034907 3300031548 Bacteria 3526
141 Ga0307408_100060381 3300031548 Bacteria 2763
142 Ga0307408_100153193 3300031548 Bacteria 1822
143 Ga0307516_10000740 3300031730 Bacteria 44432
144 Ga0307405_10032788 3300031731 Bacteria 3074
145 Ga0307405_10052399 3300031731 Bacteria 2537
146 Ga0307405_10072275 3300031731 Bacteria 2223
147 Ga0307405_10084104 3300031731 Bacteria 2088
148 Ga0307410_10059147 3300031852 Bacteria 2615
149 Ga0307410_10126384 3300031852 Bacteria 1872
150 Ga0307407_10007369 3300031903 Bacteria 4977
151 Ga0307412_10062176 3300031911 Bacteria 2513
152 Ga0307409_100006004 3300031995 Bacteria 7080
153 Ga0307409_100105103 3300031995 Bacteria 2353
154 Ga0307416_100073480 3300032002 Bacteria 2851
155 Ga0307416_100126194 3300032002 Bacteria 2292
156 Ga0307414_10058389 3300032004 Bacteria 2718
157 Ga0307411_10118369 3300032005 Bacteria 1911
158 Ga0307415_100048705 3300032126 Bacteria 2861
159 Ga0307415_100055315 3300032126 Bacteria 2714
160 Ga0307415_100160859 3300032126 Bacteria 1740
161 Ga0373926_0026214 3300035083 Bacteria 2038
162 Ga0373934_0000003 3300035086 Bacteria 87823
163 Ga0373934_0006658 3300035086 Bacteria 4291
164 Ga0373923_0005431 3300035111 Bacteria 4328
165 Ga0373936_0024499 3300035113 Bacteria 2356
166 Ga0373953_0000306 3300035117 Bacteria 13200
167 Ga0373956_0000645 3300035119 Bacteria 14362
168 Ga0373957_0000094 3300035120 Bacteria 21365
169 Ga0373943_0052711 3300035170 Bacteria 2006
170 Ga0373955_0000057 3300035172 Bacteria 43330
171 Ga0373955_0006427 3300035172 Bacteria 5353
172 Ga0373924_0000795 3300035410 Bacteria 9845
173 Ga0373935_0026735 3300035692 Bacteria 3565
174 Ga0373933_0000003 3300035724 Bacteria 150420
175 Ga0373933_0001264 3300035724 Bacteria 14916
176 Ga0373937_0000016 3300036401 Bacteria 145523
177 Ga0373937_0013900 3300036401 Bacteria 7097
178 Ga0395899_0001373 3300037312 Bacteria 20884
179 Ga0395899_0022600 3300037312 Bacteria 4764
180 Ga0395901_0002216 3300038443 Bacteria 19823
181 Ga0395901_0132028 3300038443 Bacteria 2624
182 Ga0436365_0625395 3300039437 Bacteria 2515
183 Ga0439466_0010557 3300041411 Bacteria 3432
184 Ga0439433_0000379 3300041999 Bacteria 7950
185 Ga0439442_000259 3300042002 Bacteria 12917
186 Ga0439448_0001941 3300042005 Bacteria 5511
187 Ga0439449_0001310 3300042007 Bacteria 9744
188 Ga0439457_000783 3300042014 Bacteria 9470
189 Ga0439462_0002888 3300042015 Bacteria 4062
190 Ga0450920_001366 3300042122 Bacteria 4022
191 Ga0450920_001791 3300042122 Bacteria 3601
192 Ga0450907_000381 3300042146 Bacteria 13615
193 Ga0439434_0000145 3300042435 Bacteria 18983
194 Ga0439460_0009229 3300042461 Bacteria 2503
195 Ga0450918_000599 3300042531 Bacteria 7726
196 Ga0466961_0042268 3300044693 Bacteria 2922
197 Ga0466961_0045133 3300044693 Bacteria 2820
198 Ga0466961_0074943 3300044693 Bacteria 2146
199 Ga0466963_0058063 3300044694 Bacteria 2579
200 Ga0466960_0022582 3300044901 Bacteria 2815
201 Ga0466967_0028733 3300045976 Bacteria 4646
202 Ga0495592_0000116 3300046454 Bacteria 70091
203 Ga0495592_0005197 3300046454 Bacteria 9597
204 Ga0495629_0016718 3300046459 Bacteria 5264
205 Ga0495651_0000009 3300046462 Bacteria 150455
206 Ga0495653_0060945 3300046463 Bacteria 2856
207 Ga0495582_0003235 3300046473 Bacteria 9150
208 Ga0495662_0018804 3300046476 Bacteria 3344
209 Ga0495664_0028401 3300046477 Bacteria 3266
210 Ga0495608_0000019 3300046511 Bacteria 180119
211 Ga0495608_0002265 3300046511 Bacteria 13892
212 Ga0495618_0079116 3300046514 Bacteria 2096
213 Ga0495628_0003493 3300046516 Bacteria 14063
214 Ga0495628_0006675 3300046516 Bacteria 10064
215 Ga0495630_0049629 3300046517 Bacteria 3140
216 Ga0495630_0143745 3300046517 Bacteria 1814
217 Ga0495652_0000430 3300046529 Bacteria 49080
218 Ga0495640_0023785 3300046533 Bacteria 4457
219 Ga0495587_0000041 3300046536 Bacteria 110168
220 Ga0495587_0010292 3300046536 Bacteria 5961
221 Ga0495587_0022496 3300046536 Bacteria 3881
222 Ga0495645_0020200 3300046543 Bacteria 4803
223 Ga0495645_0066143 3300046543 Bacteria 2613
224 Ga0495645_0085808 3300046543 Bacteria 2253
225 Ga0495667_0000037 3300046559 Bacteria 133780
226 Ga0495667_0006087 3300046559 Bacteria 8166
227 Ga0495667_0021092 3300046559 Bacteria 4394
228 Ga0495656_0001018 3300046615 Bacteria 9073
229 Ga0495634_0091112 3300046642 Bacteria 1979
230 Ga0495657_0000675 3300046675 Bacteria 30781
231 Ga0495657_0016012 3300046675 Bacteria 5471
232 Ga0495657_0047307 3300046675 Bacteria 2908
233 Ga0495599_0068320 3300046678 Bacteria 2218
234 Ga0495623_0001271 3300046679 Bacteria 17149
235 Ga0495646_0001974 3300046680 Bacteria 12372
236 Ga0495646_0006800 3300046680 Bacteria 7256
237 Ga0495613_0037844 3300046689 Bacteria 3576
238 Ga0495670_0004113 3300046691 Bacteria 7139
239 Ga0495600_0001682 3300046809 Bacteria 12351
240 Ga0495600_0002121 3300046809 Bacteria 11227
241 Ga0495600_0054755 3300046809 Bacteria 2605
242 Ga0495600_0062507 3300046809 Bacteria 2432
243 Ga0495581_0027945 3300047315 Bacteria 3271
244 Ga0495581_0064183 3300047315 Bacteria 2121
245 Ga0495604_0000040 3300047317 Bacteria 120837
246 Ga0495604_0008536 3300047317 Bacteria 8090
247 Ga0495636_0006059 3300047318 Bacteria 4747
248 Ga0495674_0092792 3300047319 Bacteria 2577
249 Ga0495680_0000010 3300047322 Bacteria 142931
250 Ga0495680_0006017 3300047322 Bacteria 11347
251 Ga0495675_0000341 3300047444 Bacteria 32884
252 Ga0495675_0023791 3300047444 Bacteria 3903
253 Ga0495675_0093273 3300047444 Bacteria 1889
254 Ga0495684_0135454 3300047471 Bacteria 1848
255 Ga0495593_0052561 3300047673 Bacteria 2153
256 Ga0495602_0000130 3300048088 Bacteria 71178
257 Ga0495602_0014955 3300048088 Bacteria 7850
258 Ga0496101_0046298 3300048904 Bacteria 3119
259 Ga0496102_0035972 3300048905 Bacteria 4459
260 Ga0496104_0014412 3300048907 Bacteria 7142
261 Ga0496105_0006061 3300048908 Bacteria 9250
262 Ga0496107_0128314 3300048910 Bacteria 1871
263 Ga0496109_0038499 3300048912 Bacteria 4323
264 Ga0496110_0017616 3300048913 Bacteria 5972
265 Ga0496111_0001084 3300048914 Bacteria 15034
266 Ga0496113_0004957 3300048916 Bacteria 8246
267 nmdc:mga03n38_3634_c1 3300050490 Bacteria 4982
268 nmdc:mga05p37_66249_c1 3300050507 Bacteria 4442
269 nmdc:mga0n895_19450_c1 3300050512 Bacteria 6313
270 nmdc:mga0rr50_6191_c1 3300050513 Bacteria 7250
271 nmdc:mga08x19_8746_c1 3300050514 Bacteria 6039
272 nmdc:mga0a205_3808_c1 3300050515 Bacteria 13520
273 Ga0495601_0008186 3300053077 Bacteria 6167
274 Ga0495601_0064309 3300053077 Bacteria 2332
275 Ga0495612_0024875 3300053078 Bacteria 2404
276 Ga0495595_0053456 3300053084 Bacteria 1876
277 Ga0495619_0013245 3300053085 Bacteria 5198
278 2623499385 2622736605 Bacteria 4992138
279 2644385944 2643221670 Bacteria 6497041
280 2799186681 2799112218 Bacteria 4315149
281 2811842612 2808606982 Bacteria 7791042
282 2984577778 2984576629 Bacteria 4248407
283 2990260522 2990256926 Bacteria 4252839
284 3006488828 3006486233 Bacteria 8157040
285 Ga0070707_100004570
286 Ga0070658_10028228
287 Ga0070658_10074690
288 Ga0070676_10024324
289 Ga0070676_10031806
290 Ga0070683_100031932
291 Ga0070670_100036862
292 Ga0068869_100009681
293 Ga0070680_100026749
294 Ga0070682_100007256
295 Ga0068868_100010777
296 Ga0070660_100006735
297 Ga0070660_100049887
298 Ga0070689_100052216
299 Ga0070691_10002104
300 Ga0070661_100022887
301 Ga0070692_10011555
302 Ga0070675_100032388
303 Ga0070675_100047967
304 Ga0070671_100007579
305 Ga0070659_100034058
306 Ga0070659_100074969
307 Ga0070709_10005572
308 Ga0070710_10003294
309 Ga0070708_100033300
310 Ga0070663_100005600
311 Ga0070663_100014023
312 Ga0070663_100026874
313 Ga0070678_100020952
314 Ga0070678_100110636
315 Ga0070678_100155019
316 Ga0070681_10036085
317 Ga0070706_100036602
318 Ga0070707_100007855
319 Ga0070698_100000804
320 Ga0070699_100016022
321 Ga0070679_100014065
322 Ga0070679_100018240
323 Ga0070684_100002067
324 Ga0070697_100006414
325 Ga0070693_100008277
326 Ga0070665_100076757
327 Ga0070664_100022339
328 Ga0068857_100147920
329 Ga0068854_100012579
330 Ga0068856_100064401
331 Ga0070702_100003679
332 Ga0070702_100023273
333 Ga0068852_100150426
334 Ga0068859_100082348
335 Ga0068864_100033167
336 Ga0068870_10001962
337 Ga0068863_100081002
338 Ga0068858_100020301
339 Ga0068862_100021128
340 Ga0081538_10000336
341 Ga0070717_10087936
342 Ga0075363_100006095
343 Ga0070715_10014771
344 Ga0070716_100003765
345 Ga0070712_100018325
346 Ga0075433_10011974
347 Ga0075434_100008016
348 Ga0075436_100010195
349 Ga0097620_100082347
350 Ga0075435_100012598
351 Ga0099794_10020709
352 Ga0111539_10012616
353 Ga0111539_10065711
354 Ga0105245_10026816
355 Ga0105243_10076557
356 Ga0105241_10101277
357 Ga0105238_10025110
358 Ga0105239_10187988
359 Ga0105246_10007529
360 Ga0157371_10043015
361 Ga0157370_10035204
362 Ga0157370_10104471
363 Ga0157369_10007193
364 Ga0157369_10089247
365 Ga0157374_10016721
366 Ga0157372_10071016
367 Ga0157375_10135867
368 Ga0157377_10002896
369 Ga0157377_10047991
370 Ga0206353_12063869
371 Ga0207692_10006587
372 Ga0207688_10017942
373 Ga0207699_10003657
374 Ga0207643_10000594
375 Ga0207705_10024085
376 Ga0207705_10053266
377 Ga0207684_10049057
378 Ga0207654_10010373
379 Ga0207707_10033415
380 Ga0207693_10026319
381 Ga0207660_10007800
382 Ga0207660_10020462
383 Ga0207657_10013667
384 Ga0207657_10061242
385 Ga0207649_10002784
386 Ga0207652_10044875
387 Ga0207646_10017562
388 Ga0207646_10044143
389 Ga0207694_10133704
390 Ga0207650_10001016
391 Ga0207659_10023875
392 Ga0207687_10031529
393 Ga0207700_10010556
394 Ga0207664_10006840
395 Ga0207644_10020814
396 Ga0207690_10020795
397 Ga0207706_10010250
398 Ga0207706_10015081
399 Ga0207665_10005312
400 Ga0207689_10001431
401 Ga0207661_10003516
402 Ga0207661_10019456
403 Ga0207661_10022096
404 Ga0207679_10020151
405 Ga0207679_10042975
406 Ga0207640_10037501
407 Ga0207703_10173857
408 Ga0207678_10010012
409 Ga0207678_10162786
410 Ga0207708_10039451
411 Ga0207702_10001992
412 Ga0207641_10047214
413 Ga0207676_10000896
414 Ga0207674_10011533
415 Ga0207674_10026177
416 Ga0207674_10167777
417 Ga0207683_10001721
418 Ga0207698_10002118
419 Ga0207428_10015402
420 Ga0268265_10024862
421 Ga0268264_10018610
422 Ga0307515_10001173
423 Ga0307408_100001356
424 Ga0307408_100034907
425 Ga0307408_100060381
426 Ga0307408_100153193
427 Ga0307516_10000740
428 Ga0307405_10032788
429 Ga0307405_10052399
430 Ga0307405_10072275
431 Ga0307405_10084104
432 Ga0307410_10059147
433 Ga0307410_10126384
434 Ga0307407_10007369
435 Ga0307412_10062176
436 Ga0307409_100006004
437 Ga0307409_100105103
438 Ga0307416_100073480
439 Ga0307416_100126194
440 Ga0307414_10058389
441 Ga0307411_10118369
442 Ga0307415_100048705
443 Ga0307415_100055315
444 Ga0307415_100160859
445 Ga0373926_0026214
446 Ga0373934_0000003
447 Ga0373934_0006658
448 Ga0373923_0005431
449 Ga0373936_0024499
450 Ga0373953_0000306
451 Ga0373956_0000645
452 Ga0373957_0000094
453 Ga0373943_0052711
454 Ga0373955_0000057
455 Ga0373955_0006427
456 Ga0373924_0000795
457 Ga0373935_0026735
458 Ga0373933_0000003
459 Ga0373933_0001264
460 Ga0373937_0000016
461 Ga0373937_0013900
462 Ga0395899_0001373
463 Ga0395899_0022600
464 Ga0395901_0002216
465 Ga0395901_0132028
466 Ga0436365_0625395
467 Ga0439466_0010557
468 Ga0439433_0000379
469 Ga0439442_000259
470 Ga0439448_0001941
471 Ga0439449_0001310
472 Ga0439457_000783
473 Ga0439462_0002888
474 Ga0450920_001366
475 Ga0450920_001791
476 Ga0450907_000381
477 Ga0439434_0000145
478 Ga0439460_0009229
479 Ga0450918_000599
480 Ga0466961_0042268
481 Ga0466961_0045133
482 Ga0466961_0074943
483 Ga0466963_0058063
484 Ga0466960_0022582
485 Ga0466967_0028733
486 Ga0495592_0000116
487 Ga0495592_0005197
488 Ga0495629_0016718
489 Ga0495651_0000009
490 Ga0495653_0060945
491 Ga0495582_0003235
492 Ga0495662_0018804
493 Ga0495664_0028401
494 Ga0495608_0000019
495 Ga0495608_0002265
496 Ga0495618_0079116
497 Ga0495628_0003493
498 Ga0495628_0006675
499 Ga0495630_0049629
500 Ga0495630_0143745
501 Ga0495652_0000430
502 Ga0495640_0023785
503 Ga0495587_0000041
504 Ga0495587_0010292
505 Ga0495587_0022496
506 Ga0495645_0020200
507 Ga0495645_0066143
508 Ga0495645_0085808
509 Ga0495667_0000037
510 Ga0495667_0006087
511 Ga0495667_0021092
512 Ga0495656_0001018
513 Ga0495634_0091112
514 Ga0495657_0000675
515 Ga0495657_0016012
516 Ga0495657_0047307
517 Ga0495599_0068320
518 Ga0495623_0001271
519 Ga0495646_0001974
520 Ga0495646_0006800
521 Ga0495613_0037844
522 Ga0495670_0004113
523 Ga0495600_0001682
524 Ga0495600_0002121
525 Ga0495600_0054755
526 Ga0495600_0062507
527 Ga0495581_0027945
528 Ga0495581_0064183
529 Ga0495604_0000040
530 Ga0495604_0008536
531 Ga0495636_0006059
532 Ga0495674_0092792
533 Ga0495680_0000010
534 Ga0495680_0006017
535 Ga0495675_0000341
536 Ga0495675_0023791
537 Ga0495675_0093273
538 Ga0495684_0135454
539 Ga0495593_0052561
540 Ga0495602_0000130
541 Ga0495602_0014955
542 Ga0496101_0046298
543 Ga0496102_0035972
544 Ga0496104_0014412
545 Ga0496105_0006061
546 Ga0496107_0128314
547 Ga0496109_0038499
548 Ga0496110_0017616
549 Ga0496111_0001084
550 Ga0496113_0004957
551 nmdc:mga03n38_3634_c1
552 nmdc:mga05p37_66249_c1
553 nmdc:mga0n895_19450_c1
554 nmdc:mga0rr50_6191_c1
555 nmdc:mga08x19_8746_c1
556 nmdc:mga0a205_3808_c1
557 Ga0495601_0008186
558 Ga0495601_0064309
559 Ga0495612_0024875
560 Ga0495595_0053456
561 Ga0495619_0013245
562 2623499385
563 2644385944
564 2799186681
565 2811842612
566 2984577778
567 2990260522
568 3006488828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13091

PLDc_2

PLD-like domain

291

420

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.78 245 403
6ohp-assembly4.cif.gz_D structure of compound 1 (halopemide) bound human phospholipase d2 catalytic domain 0.7765 30 481
6ohp-assembly2.cif.gz_B structure of compound 1 (halopemide) bound human phospholipase d2 catalytic domain 0.7757 30 481
6ohp-assembly1.cif.gz_A structure of compound 1 (halopemide) bound human phospholipase d2 catalytic domain 0.7719 30 481
6ohr-assembly3.cif.gz_C structure of compound 5 bound human phospholipase d1 catalytic domain 0.7712 30 481
ID Description Score Start End Superfamily
af_Q9C888_420_669_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.855 245 418 3.30.870.10
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.8524 270 402 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.8489 268 421 3.30.870.10
af_Q65XR9_493_717_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.8209 268 409 3.30.870.10
1bysA00 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.7998 245 403 3.30.870.10
ID Description Score Start End GO Terms
AF-A0A1Q7WD47-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9695 248 506 GO:0006629
GO:0006793
GO:0016787
AF-A0A1Q7WD47-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9622 248 506 GO:0006629
GO:0006793
GO:0016787
AF-A0A853D2V2-F1-model_v4 Phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase-like enzyme 0.9578 248 506 GO:0004630
GO:0009395
AF-A0A853D2V2-F1-model_v4 Phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase-like enzyme 0.9505 248 506 GO:0004630
GO:0009395
AF-Q0RPY2-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9443 3 506 GO:0004630
GO:0009395

Map