F386044

General Info

Members Datasets Scaffolds Average Seq Length
284 154 568 156

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_101079791|Ga0070694_1010797911
Length 183
Sequence MFPERGQVQVVESTLTRGSQRDSLASTMPDDQRPFVVGPGEGRLIDLGEFGMTVKADSDETAGVVSVLEAEEPPGFGPPIHVHHDSAEAFYVLEGEYIMYLENRVFACPAGSFIFIPLGVRHGFRVGNAPSRKLNFYFPAAMIGYFDHLAAALGRDEVDDERLEEVARKHAMEIVGPPSDRYV

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
152 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.15
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 24.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_101079791 3300005444 Unclassified 669
2 rootH1_10061914 3300003323 Bacteria 2958
3 Ga0070658_10137142 3300005327 Bacteria 2042
4 Ga0070658_10194123 3300005327 Bacteria 1712
5 Ga0070658_10202200 3300005327 Bacteria 1676
6 Ga0070690_100626789 3300005330 Unclassified 819
7 Ga0068869_100040116 3300005334 Bacteria 3346
8 Ga0068868_100060801 3300005338 Bacteria 2992
9 Ga0070660_100020455 3300005339 Bacteria 4863
10 Ga0070660_100051680 3300005339 Bacteria 3166
11 Ga0070689_100853897 3300005340 Unclassified 803
12 Ga0070691_10164894 3300005341 Bacteria 1145
13 Ga0070687_100213159 3300005343 Bacteria 1178
14 Ga0070671_100674556 3300005355 Unclassified 896
15 Ga0070674_100181231 3300005356 Bacteria 1614
16 Ga0070674_100363185 3300005356 Bacteria 1173
17 Ga0070714_100625068 3300005435 Unclassified 1035
18 Ga0070713_101615291 3300005436 Bacteria 629
19 Ga0070705_100841648 3300005440 Unclassified 733
20 Ga0070700_100053288 3300005441 Bacteria 2524
21 Ga0070694_100186849 3300005444 Bacteria 1536
22 Ga0070694_100342487 3300005444 Bacteria 1156
23 Ga0070694_100592397 3300005444 Bacteria 892
24 Ga0070708_100009746 3300005445 Bacteria 7755
25 Ga0070708_100013020 3300005445 Bacteria 6798
26 Ga0070708_100044149 3300005445 Bacteria 3918
27 Ga0070708_100053429 3300005445 Bacteria 3584
28 Ga0070708_100278088 3300005445 Unclassified 1575
29 Ga0070708_100281388 3300005445 Bacteria 1566
30 Ga0070708_101079094 3300005445 Bacteria 752
31 Ga0070678_100107032 3300005456 Bacteria 2180
32 Ga0070681_10624637 3300005458 Unclassified 992
33 Ga0070681_11067617 3300005458 Unclassified 728
34 Ga0068867_100020849 3300005459 Bacteria 4674
35 Ga0070706_100005101 3300005467 Bacteria 12534
36 Ga0070706_100007285 3300005467 Bacteria 10386
37 Ga0070706_100007797 3300005467 Bacteria 10002
38 Ga0070706_100027610 3300005467 Bacteria 5223
39 Ga0070706_100035579 3300005467 Bacteria 4597
40 Ga0070706_101285825 3300005467 Bacteria 671
41 Ga0070707_100007149 3300005468 Bacteria 10350
42 Ga0070707_100015022 3300005468 Bacteria 7266
43 Ga0070707_100034079 3300005468 Bacteria 4856
44 Ga0070707_100055153 3300005468 Bacteria 3810
45 Ga0070707_100162686 3300005468 Bacteria 2174
46 Ga0070707_100189851 3300005468 Bacteria 2003
47 Ga0070707_100269471 3300005468 Bacteria 1656
48 Ga0070707_100294771 3300005468 Unclassified 1576
49 Ga0070707_100521105 3300005468 Unclassified 1151
50 Ga0070707_100854608 3300005468 Unclassified 874
51 Ga0070707_101734591 3300005468 Bacteria 592
52 Ga0070698_100000067 3300005471 Bacteria 77303
53 Ga0070698_100009473 3300005471 Bacteria 10431
54 Ga0070698_100061427 3300005471 Bacteria 3792
55 Ga0070698_100092213 3300005471 Bacteria 3010
56 Ga0070698_100214619 3300005471 Bacteria 1858
57 Ga0070698_100259983 3300005471 Bacteria 1668
58 Ga0070698_100269639 3300005471 Bacteria 1634
59 Ga0070698_100628896 3300005471 Bacteria 1014
60 Ga0070698_100934475 3300005471 Bacteria 813
61 Ga0070698_101186770 3300005471 Bacteria 712
62 Ga0070699_100015129 3300005518 Bacteria 6628
63 Ga0070699_100110334 3300005518 Bacteria 2415
64 Ga0070699_101566453 3300005518 Bacteria 604
65 Ga0070697_100000806 3300005536 Bacteria 23524
66 Ga0070697_100019312 3300005536 Bacteria 5382
67 Ga0070697_100056907 3300005536 Bacteria 3182
68 Ga0070697_100274533 3300005536 Bacteria 1445
69 Ga0070697_101451536 3300005536 Bacteria 613
70 Ga0070695_100126422 3300005545 Bacteria 1756
71 Ga0070695_100167446 3300005545 Unclassified 1548
72 Ga0070696_100004911 3300005546 Bacteria 8926
73 Ga0070696_100005086 3300005546 Bacteria 8784
74 Ga0070696_100086068 3300005546 Bacteria 2231
75 Ga0070693_100316867 3300005547 Bacteria 1057
76 Ga0070704_100155023 3300005549 Unclassified 1805
77 Ga0070704_100291592 3300005549 Bacteria 1356
78 Ga0070704_101107027 3300005549 Unclassified 720
79 Ga0070664_101411401 3300005564 Bacteria 658
80 Ga0068854_100813344 3300005578 Unclassified 815
81 Ga0068856_100209799 3300005614 Bacteria 1963
82 Ga0068856_101243724 3300005614 Unclassified 760
83 Ga0070702_100112459 3300005615 Bacteria 1691
84 Ga0068859_101319538 3300005617 Unclassified 795
85 Ga0068864_100313216 3300005618 Bacteria 1472
86 Ga0068866_10029057 3300005718 Bacteria 2640
87 Ga0068861_101521320 3300005719 Unclassified 657
88 Ga0068870_10172926 3300005840 Bacteria 1290
89 Ga0068863_100201004 3300005841 Unclassified 1917
90 Ga0081539_10079107 3300005985 Unclassified 1733
91 Ga0070717_10009650 3300006028 Bacteria 7265
92 Ga0070717_10149318 3300006028 Bacteria 2021
93 Ga0070717_10623066 3300006028 Unclassified 979
94 Ga0075432_10135442 3300006058 Bacteria 936
95 Ga0075428_100012706 3300006844 Bacteria 9364
96 Ga0075430_100846505 3300006846 Unclassified 754
97 Ga0075431_100033032 3300006847 Bacteria 5333
98 Ga0075433_10003025 3300006852 Bacteria 12918
99 Ga0075433_10148466 3300006852 Unclassified 2085
100 Ga0075433_11814423 3300006852 Unclassified 524
101 Ga0075434_100008128 3300006871 Bacteria 9729
102 Ga0075434_100152328 3300006871 Bacteria 2332
103 Ga0075434_100305991 3300006871 Bacteria 1610
104 Ga0075434_100337861 3300006871 Bacteria 1527
105 Ga0075436_100048338 3300006914 Unclassified 2935
106 Ga0075436_100079860 3300006914 Bacteria 2266
107 Ga0097620_101319281 3300006931 Unclassified 795
108 Ga0075435_100138643 3300007076 Bacteria 2039
109 Ga0075435_100161437 3300007076 Bacteria 1888
110 Ga0075435_100238884 3300007076 Bacteria 1545
111 Ga0075435_100312611 3300007076 Bacteria 1344
112 Ga0075435_101526414 3300007076 Unclassified 586
113 Ga0105245_10408502 3300009098 Unclassified 1358
114 Ga0105245_10834171 3300009098 Unclassified 961
115 Ga0105245_10889250 3300009098 Bacteria 932
116 Ga0114129_10001747 3300009147 Bacteria 29573
117 Ga0114129_10006241 3300009147 Bacteria 16896
118 Ga0105243_10002884 3300009148 Bacteria 14246
119 Ga0105243_10501814 3300009148 Bacteria 1150
120 Ga0105243_11744654 3300009148 Unclassified 652
121 Ga0105242_10007022 3300009176 Bacteria 8694
122 Ga0105242_11427287 3300009176 Bacteria 720
123 Ga0105242_11718687 3300009176 Bacteria 664
124 Ga0105242_13078284 3300009176 Bacteria 517
125 Ga0105248_10187159 3300009177 Unclassified 2333
126 Ga0105239_10181776 3300010375 Unclassified 2353
127 Ga0105246_10023248 3300011119 Bacteria 4009
128 Ga0157374_11106623 3300013296 Unclassified 813
129 Ga0157378_10003827 3300013297 Bacteria 13309
130 Ga0163162_11669152 3300013306 Bacteria 727
131 Ga0157375_10487244 3300013308 Bacteria 1398
132 Ga0163163_10075986 3300014325 Bacteria 3353
133 Ga0157380_10094917 3300014326 Bacteria 2469
134 Ga0157376_10907651 3300014969 Unclassified 899
135 Ga0163161_10790886 3300017792 Unclassified 796
136 Ga0207653_10000002 3300025885 Bacteria 270513
137 Ga0207653_10026814 3300025885 Bacteria 1849
138 Ga0207642_10082813 3300025899 Bacteria 1563
139 Ga0207705_10104645 3300025909 Bacteria 2085
140 Ga0207705_10556585 3300025909 Bacteria 891
141 Ga0207684_10000693 3300025910 Bacteria 39814
142 Ga0207684_10003998 3300025910 Bacteria 14105
143 Ga0207684_10063412 3300025910 Bacteria 3137
144 Ga0207684_10064560 3300025910 Bacteria 3108
145 Ga0207684_10073533 3300025910 Bacteria 2903
146 Ga0207684_10075400 3300025910 Bacteria 2866
147 Ga0207684_10227245 3300025910 Unclassified 1610
148 Ga0207684_10411571 3300025910 Bacteria 1162
149 Ga0207684_10510380 3300025910 Bacteria 1030
150 Ga0207662_10010661 3300025918 Bacteria 5081
151 Ga0207657_10018623 3300025919 Bacteria 6619
152 Ga0207657_10044184 3300025919 Bacteria 3918
153 Ga0207657_10556948 3300025919 Unclassified 896
154 Ga0207646_10001696 3300025922 Bacteria 26787
155 Ga0207646_10003981 3300025922 Bacteria 16377
156 Ga0207646_10005947 3300025922 Bacteria 12724
157 Ga0207646_10034178 3300025922 Bacteria 4595
158 Ga0207646_10057968 3300025922 Bacteria 3460
159 Ga0207646_10165725 3300025922 Bacteria 1995
160 Ga0207646_10570940 3300025922 Bacteria 1016
161 Ga0207646_10588129 3300025922 Bacteria 1000
162 Ga0207687_10622571 3300025927 Unclassified 911
163 Ga0207644_10090328 3300025931 Bacteria 2282
164 Ga0207686_10012173 3300025934 Bacteria 4727
165 Ga0207709_10049703 3300025935 Bacteria 2561
166 Ga0207669_10636850 3300025937 Unclassified 870
167 Ga0207689_10052807 3300025942 Bacteria 3348
168 Ga0207661_10518833 3300025944 Unclassified 1090
169 Ga0207661_11064180 3300025944 Unclassified 745
170 Ga0207677_10173255 3300026023 Bacteria 1690
171 Ga0207708_10221559 3300026075 Bacteria 1516
172 Ga0207702_12231280 3300026078 Unclassified 536
173 Ga0207641_10111909 3300026088 Unclassified 2422
174 Ga0207648_10003170 3300026089 Bacteria 17342
175 Ga0207683_10135541 3300026121 Bacteria 2216
176 Ga0207683_10342793 3300026121 Unclassified 1371
177 Ga0207428_10046217 3300027907 Bacteria 3501
178 Ga0268266_10268955 3300028379 Bacteria 1582
179 Ga0307407_10832867 3300031903 Bacteria 704
180 Ga0307409_100192023 3300031995 Bacteria 1819
181 Ga0307409_100411563 3300031995 Unclassified 1295
182 Ga0307409_100475077 3300031995 Bacteria 1212
183 Ga0307409_100719130 3300031995 Bacteria 1000
184 Ga0307409_100936658 3300031995 Unclassified 881
185 Ga0307416_101400385 3300032002 Unclassified 805
186 Ga0307416_101630915 3300032002 Bacteria 750
187 Ga0307415_100765985 3300032126 Unclassified 878
188 Ga0307415_101226742 3300032126 Bacteria 708
189 Ga0373962_0080135 3300035242 Unclassified 990
190 Ga0395899_0360691 3300037312 Bacteria 970
191 Ga0395900_0029480 3300037418 Bacteria 5629
192 Ga0395898_0114179 3300037466 Bacteria 2588
193 Ga0395898_0189950 3300037466 Bacteria 1963
194 Ga0395905_0039911 3300037471 Bacteria 4404
195 Ga0395901_0043418 3300038443 Bacteria 4663
196 Ga0439466_0059267 3300041411 Unclassified 1237
197 Ga0451807_1435592 3300041486 Bacteria 683
198 Ga0451853_1751067 3300041512 Unclassified 850
199 Ga0439442_029372 3300042002 Unclassified 1147
200 Ga0439445_0008050 3300042004 Bacteria 2460
201 Ga0450920_062714 3300042122 Unclassified 752
202 Ga0439446_0010532 3300042156 Bacteria 2492
203 Ga0439458_0042409 3300042157 Bacteria 1108
204 Ga0439434_0017793 3300042435 Unclassified 2127
205 Ga0453683_0111195 3300044673 Bacteria 1723
206 Ga0466967_0087919 3300045976 Bacteria 2818
207 Ga0495605_0215163 3300046474 Bacteria 832
208 Ga0495596_0038071 3300046500 Bacteria 1902
209 Ga0495596_0074829 3300046500 Bacteria 1315
210 Ga0495642_0136940 3300046528 Bacteria 1056
211 Ga0495609_0047179 3300046538 Bacteria 1928
212 Ga0495647_0106483 3300046681 Bacteria 1166
213 Ga0495589_0018096 3300046794 Bacteria 3615
214 Ga0495581_0569680 3300047315 Bacteria 657
215 Ga0495636_0112223 3300047318 Bacteria 1200
216 Ga0495677_0122977 3300047445 Bacteria 990
217 Ga0496100_0969669 3300048903 Unclassified 669
218 Ga0496102_0018015 3300048905 Bacteria 6198
219 Ga0496102_0040011 3300048905 Bacteria 4239
220 Ga0496102_0065414 3300048905 Bacteria 3332
221 Ga0496103_0013710 3300048906 Bacteria 4810
222 Ga0496103_0116635 3300048906 Bacteria 1699
223 Ga0496104_0001222 3300048907 Bacteria 22106
224 Ga0496104_0414173 3300048907 Unclassified 1260
225 Ga0496105_0021428 3300048908 Bacteria 5229
226 Ga0496105_1087206 3300048908 Unclassified 594
227 Ga0496106_0008835 3300048909 Bacteria 7446
228 Ga0496107_0148870 3300048910 Unclassified 1731
229 Ga0496108_0002511 3300048911 Bacteria 14669
230 Ga0496108_0169166 3300048911 Unclassified 1891
231 Ga0496109_0065449 3300048912 Bacteria 3327
232 Ga0496109_0361695 3300048912 Unclassified 1371
233 Ga0496110_0000238 3300048913 Bacteria 35641
234 Ga0496110_0036456 3300048913 Unclassified 4271
235 Ga0496110_0670648 3300048913 Bacteria 937
236 Ga0496111_0002246 3300048914 Bacteria 11605
237 Ga0496112_0000359 3300048915 Bacteria 29710
238 Ga0496112_0048331 3300048915 Bacteria 4171
239 Ga0496113_0000940 3300048916 Bacteria 15473
240 Ga0496114_0190429 3300048917 Bacteria 1795
241 Ga0496115_0032782 3300048918 Plasmid 4100
242 Ga0501036_0009686 3300049572 Bacteria 7929
243 Ga0501046_0069072 3300049580 Bacteria 2750
244 Ga0501048_0005423 3300049582 Bacteria 9698
245 Ga0501067_0015349 3300049583 Bacteria 4240
246 Ga0501067_0286578 3300049583 Unclassified 917
247 Ga0501068_0037877 3300049584 Bacteria 2887
248 Ga0501068_0275990 3300049584 Bacteria 1074
249 Ga0501068_0508509 3300049584 Unclassified 782
250 Ga0501071_0134138 3300049587 Bacteria 1841
251 Ga0501071_0375804 3300049587 Bacteria 1083
252 Ga0501072_0003723 3300049588 Bacteria 11501
253 Ga0501074_0036484 3300049590 Bacteria 3561
254 Ga0501079_0017181 3300049741 Bacteria 5524
255 Ga0501081_0014004 3300049743 Bacteria 5281
256 Ga0501081_0037273 3300049743 Bacteria 3317
257 Ga0501045_0073518 3300049824 Bacteria 2517
258 Ga0501045_0572213 3300049824 Bacteria 837
259 nmdc:mga05p37_1201998_c1 3300050507 Bacteria 783
260 nmdc:mga05p37_1389870_c1 3300050507 Unclassified 708
261 nmdc:mga05p37_142_c1 3300050507 Bacteria 67494
262 nmdc:mga05p37_40073_c1 3300050507 Bacteria 5753
263 nmdc:mga09592_325644_c1 3300050508 Unclassified 1331
264 nmdc:mga09592_61023_c1 3300050508 Bacteria 3188
265 nmdc:mga06r32_20272_c1 3300050510 Bacteria 6117
266 nmdc:mga0n895_357765_c1 3300050512 Bacteria 1038
267 nmdc:mga0n895_58993_c1 3300050512 Bacteria 3786
268 nmdc:mga0n895_598096_c1 3300050512 Bacteria 1105
269 nmdc:mga0n895_908365_c1 3300050512 Bacteria 866
270 nmdc:mga0rr50_1228972_c1 3300050513 Bacteria 636
271 nmdc:mga0rr50_165750_c1 3300050513 Bacteria 1796
272 nmdc:mga0rr50_32466_c1 3300050513 Bacteria 3720
273 nmdc:mga0rr50_501957_c1 3300050513 Bacteria 1032
274 nmdc:mga08x19_366498_c1 3300050514 Unclassified 1007
275 nmdc:mga08x19_402072_c1 3300050514 Bacteria 961
276 nmdc:mga0a205_1373879_c1 3300050515 Unclassified 554
277 nmdc:mga0a205_155328_c1 3300050515 Bacteria 2187
278 nmdc:mga0a205_37124_c1 3300050515 Bacteria 4684
279 nmdc:mga0a205_755913_c1 3300050515 Bacteria 820
280 Ga0495655_0142344 3300053083 Unclassified 748
281 Ga0590075_179931 3300059424 Unclassified 559
282 Ga0501082_0038055 3300060353 Bacteria 4149
283 Ga0530510_0004466 3300061734 Bacteria 9680
284 Ga0530510_0269898 3300061734 Bacteria 1270
285 Ga0070694_101079791
286 rootH1_10061914
287 Ga0070658_10137142
288 Ga0070658_10194123
289 Ga0070658_10202200
290 Ga0070690_100626789
291 Ga0068869_100040116
292 Ga0068868_100060801
293 Ga0070660_100020455
294 Ga0070660_100051680
295 Ga0070689_100853897
296 Ga0070691_10164894
297 Ga0070687_100213159
298 Ga0070671_100674556
299 Ga0070674_100181231
300 Ga0070674_100363185
301 Ga0070714_100625068
302 Ga0070713_101615291
303 Ga0070705_100841648
304 Ga0070700_100053288
305 Ga0070694_100186849
306 Ga0070694_100342487
307 Ga0070694_100592397
308 Ga0070708_100009746
309 Ga0070708_100013020
310 Ga0070708_100044149
311 Ga0070708_100053429
312 Ga0070708_100278088
313 Ga0070708_100281388
314 Ga0070708_101079094
315 Ga0070678_100107032
316 Ga0070681_10624637
317 Ga0070681_11067617
318 Ga0068867_100020849
319 Ga0070706_100005101
320 Ga0070706_100007285
321 Ga0070706_100007797
322 Ga0070706_100027610
323 Ga0070706_100035579
324 Ga0070706_101285825
325 Ga0070707_100007149
326 Ga0070707_100015022
327 Ga0070707_100034079
328 Ga0070707_100055153
329 Ga0070707_100162686
330 Ga0070707_100189851
331 Ga0070707_100269471
332 Ga0070707_100294771
333 Ga0070707_100521105
334 Ga0070707_100854608
335 Ga0070707_101734591
336 Ga0070698_100000067
337 Ga0070698_100009473
338 Ga0070698_100061427
339 Ga0070698_100092213
340 Ga0070698_100214619
341 Ga0070698_100259983
342 Ga0070698_100269639
343 Ga0070698_100628896
344 Ga0070698_100934475
345 Ga0070698_101186770
346 Ga0070699_100015129
347 Ga0070699_100110334
348 Ga0070699_101566453
349 Ga0070697_100000806
350 Ga0070697_100019312
351 Ga0070697_100056907
352 Ga0070697_100274533
353 Ga0070697_101451536
354 Ga0070695_100126422
355 Ga0070695_100167446
356 Ga0070696_100004911
357 Ga0070696_100005086
358 Ga0070696_100086068
359 Ga0070693_100316867
360 Ga0070704_100155023
361 Ga0070704_100291592
362 Ga0070704_101107027
363 Ga0070664_101411401
364 Ga0068854_100813344
365 Ga0068856_100209799
366 Ga0068856_101243724
367 Ga0070702_100112459
368 Ga0068859_101319538
369 Ga0068864_100313216
370 Ga0068866_10029057
371 Ga0068861_101521320
372 Ga0068870_10172926
373 Ga0068863_100201004
374 Ga0081539_10079107
375 Ga0070717_10009650
376 Ga0070717_10149318
377 Ga0070717_10623066
378 Ga0075432_10135442
379 Ga0075428_100012706
380 Ga0075430_100846505
381 Ga0075431_100033032
382 Ga0075433_10003025
383 Ga0075433_10148466
384 Ga0075433_11814423
385 Ga0075434_100008128
386 Ga0075434_100152328
387 Ga0075434_100305991
388 Ga0075434_100337861
389 Ga0075436_100048338
390 Ga0075436_100079860
391 Ga0097620_101319281
392 Ga0075435_100138643
393 Ga0075435_100161437
394 Ga0075435_100238884
395 Ga0075435_100312611
396 Ga0075435_101526414
397 Ga0105245_10408502
398 Ga0105245_10834171
399 Ga0105245_10889250
400 Ga0114129_10001747
401 Ga0114129_10006241
402 Ga0105243_10002884
403 Ga0105243_10501814
404 Ga0105243_11744654
405 Ga0105242_10007022
406 Ga0105242_11427287
407 Ga0105242_11718687
408 Ga0105242_13078284
409 Ga0105248_10187159
410 Ga0105239_10181776
411 Ga0105246_10023248
412 Ga0157374_11106623
413 Ga0157378_10003827
414 Ga0163162_11669152
415 Ga0157375_10487244
416 Ga0163163_10075986
417 Ga0157380_10094917
418 Ga0157376_10907651
419 Ga0163161_10790886
420 Ga0207653_10000002
421 Ga0207653_10026814
422 Ga0207642_10082813
423 Ga0207705_10104645
424 Ga0207705_10556585
425 Ga0207684_10000693
426 Ga0207684_10003998
427 Ga0207684_10063412
428 Ga0207684_10064560
429 Ga0207684_10073533
430 Ga0207684_10075400
431 Ga0207684_10227245
432 Ga0207684_10411571
433 Ga0207684_10510380
434 Ga0207662_10010661
435 Ga0207657_10018623
436 Ga0207657_10044184
437 Ga0207657_10556948
438 Ga0207646_10001696
439 Ga0207646_10003981
440 Ga0207646_10005947
441 Ga0207646_10034178
442 Ga0207646_10057968
443 Ga0207646_10165725
444 Ga0207646_10570940
445 Ga0207646_10588129
446 Ga0207687_10622571
447 Ga0207644_10090328
448 Ga0207686_10012173
449 Ga0207709_10049703
450 Ga0207669_10636850
451 Ga0207689_10052807
452 Ga0207661_10518833
453 Ga0207661_11064180
454 Ga0207677_10173255
455 Ga0207708_10221559
456 Ga0207702_12231280
457 Ga0207641_10111909
458 Ga0207648_10003170
459 Ga0207683_10135541
460 Ga0207683_10342793
461 Ga0207428_10046217
462 Ga0268266_10268955
463 Ga0307407_10832867
464 Ga0307409_100192023
465 Ga0307409_100411563
466 Ga0307409_100475077
467 Ga0307409_100719130
468 Ga0307409_100936658
469 Ga0307416_101400385
470 Ga0307416_101630915
471 Ga0307415_100765985
472 Ga0307415_101226742
473 Ga0373962_0080135
474 Ga0395899_0360691
475 Ga0395900_0029480
476 Ga0395898_0114179
477 Ga0395898_0189950
478 Ga0395905_0039911
479 Ga0395901_0043418
480 Ga0439466_0059267
481 Ga0451807_1435592
482 Ga0451853_1751067
483 Ga0439442_029372
484 Ga0439445_0008050
485 Ga0450920_062714
486 Ga0439446_0010532
487 Ga0439458_0042409
488 Ga0439434_0017793
489 Ga0453683_0111195
490 Ga0466967_0087919
491 Ga0495605_0215163
492 Ga0495596_0038071
493 Ga0495596_0074829
494 Ga0495642_0136940
495 Ga0495609_0047179
496 Ga0495647_0106483
497 Ga0495589_0018096
498 Ga0495581_0569680
499 Ga0495636_0112223
500 Ga0495677_0122977
501 Ga0496100_0969669
502 Ga0496102_0018015
503 Ga0496102_0040011
504 Ga0496102_0065414
505 Ga0496103_0013710
506 Ga0496103_0116635
507 Ga0496104_0001222
508 Ga0496104_0414173
509 Ga0496105_0021428
510 Ga0496105_1087206
511 Ga0496106_0008835
512 Ga0496107_0148870
513 Ga0496108_0002511
514 Ga0496108_0169166
515 Ga0496109_0065449
516 Ga0496109_0361695
517 Ga0496110_0000238
518 Ga0496110_0036456
519 Ga0496110_0670648
520 Ga0496111_0002246
521 Ga0496112_0000359
522 Ga0496112_0048331
523 Ga0496113_0000940
524 Ga0496114_0190429
525 Ga0496115_0032782
526 Ga0501036_0009686
527 Ga0501046_0069072
528 Ga0501048_0005423
529 Ga0501067_0015349
530 Ga0501067_0286578
531 Ga0501068_0037877
532 Ga0501068_0275990
533 Ga0501068_0508509
534 Ga0501071_0134138
535 Ga0501071_0375804
536 Ga0501072_0003723
537 Ga0501074_0036484
538 Ga0501079_0017181
539 Ga0501081_0014004
540 Ga0501081_0037273
541 Ga0501045_0073518
542 Ga0501045_0572213
543 nmdc:mga05p37_1201998_c1
544 nmdc:mga05p37_1389870_c1
545 nmdc:mga05p37_142_c1
546 nmdc:mga05p37_40073_c1
547 nmdc:mga09592_325644_c1
548 nmdc:mga09592_61023_c1
549 nmdc:mga06r32_20272_c1
550 nmdc:mga0n895_357765_c1
551 nmdc:mga0n895_58993_c1
552 nmdc:mga0n895_598096_c1
553 nmdc:mga0n895_908365_c1
554 nmdc:mga0rr50_1228972_c1
555 nmdc:mga0rr50_165750_c1
556 nmdc:mga0rr50_32466_c1
557 nmdc:mga0rr50_501957_c1
558 nmdc:mga08x19_366498_c1
559 nmdc:mga08x19_402072_c1
560 nmdc:mga0a205_1373879_c1
561 nmdc:mga0a205_155328_c1
562 nmdc:mga0a205_37124_c1
563 nmdc:mga0a205_755913_c1
564 Ga0495655_0142344
565 Ga0590075_179931
566 Ga0501082_0038055
567 Ga0530510_0004466
568 Ga0530510_0269898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

68

137

0.91

PF02311

AraC_binding

AraC-like ligand binding domain

64

169

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.9261 68 157
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9206 50 166
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9183 79 157
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9145 66 156
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.91 62 159
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9417 70 157 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9281 68 158 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9261 68 157 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9209 67 157 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9154 83 157 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7K1SUH7-F1-model_v4 Cupin domain-containing protein 0.9512 68 160
AF-A0A2V6D631-F1-model_v4 Cupin domain-containing protein 0.9484 84 158
AF-A0A533RQD7-F1-model_v4 Cupin domain-containing protein 0.9431 69 157 GO:0004475
GO:0005976
GO:0009298
AF-A0A2G4FZ11-F1-model_v4 Mannose-6-phosphate isomerase 0.9429 69 157 GO:0004475
GO:0005976
GO:0009298
GO:0016853
AF-A0A1F9S1I3-F1-model_v4 Mannose-6-phosphate isomerase 0.9419 69 158 GO:0004475
GO:0005976
GO:0009298
GO:0016853

Map