F386013

General Info

Members Datasets Scaffolds Average Seq Length
284 143 568 201

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100007015|Ga0070660_1000070155
Length 230
Sequence VPDQSELLCLSHPQGHAVPHQASKLAAVRDWWLRTLLVLQRPRPVFVALRDDTREAAGDRSEQVLLIVLLAGIATLLFTGTAAHLNDDGSYSPILIAIWAFFAGSIYGLFAYFALGAVLHAGVKALGSQGSYRRSRHVLAFAAVPIALSLVTWPVKLALYGGDWFRAGGRDTGAGGVVFDLIELAFFVWAAVLLVIGVRAVHGWTWARAAAACALSLVAPVVLALLVSSL

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 3.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.73
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100007015 3300005339 Bacteria 7821
2 rootH1_10100740 3300003323 Bacteria 1123
3 Ga0070658_10181050 3300005327 Bacteria 1773
4 Ga0070658_10474065 3300005327 Bacteria 1080
5 Ga0070658_10594816 3300005327 Bacteria 959
6 Ga0070683_100124381 3300005329 Bacteria 2437
7 Ga0070683_100521345 3300005329 Bacteria 1136
8 Ga0070680_100059524 3300005336 Bacteria 3125
9 Ga0070680_100515724 3300005336 Bacteria 1023
10 Ga0070682_100082620 3300005337 Bacteria 2083
11 Ga0070660_100025832 3300005339 Bacteria 4368
12 Ga0070660_100094547 3300005339 Bacteria 2361
13 Ga0070661_100013881 3300005344 Bacteria 5660
14 Ga0070661_100113619 3300005344 Bacteria 2024
15 Ga0070671_100126473 3300005355 Bacteria 2152
16 Ga0070659_100019548 3300005366 Bacteria 5135
17 Ga0070710_10187541 3300005437 Bacteria 1299
18 Ga0070711_100029013 3300005439 Bacteria 3646
19 Ga0070708_100002927 3300005445 Bacteria 13283
20 Ga0070663_100095014 3300005455 Bacteria 2215
21 Ga0070678_100036808 3300005456 Bacteria 3429
22 Ga0070681_10003095 3300005458 Bacteria 15444
23 Ga0070681_10018719 3300005458 Bacteria 6930
24 Ga0070681_10173864 3300005458 Bacteria 2075
25 Ga0070699_100606621 3300005518 Bacteria 998
26 Ga0070679_100023972 3300005530 Bacteria 5978
27 Ga0070679_100052322 3300005530 Bacteria 4068
28 Ga0070679_100260774 3300005530 Bacteria 1688
29 Ga0070684_100093104 3300005535 Bacteria 2682
30 Ga0070684_100366316 3300005535 Bacteria 1327
31 Ga0070684_100436973 3300005535 Bacteria 1209
32 Ga0068853_100149200 3300005539 Bacteria 2104
33 Ga0068853_100672975 3300005539 Unclassified 986
34 Ga0070696_100051055 3300005546 Bacteria 2876
35 Ga0070665_100397189 3300005548 Bacteria 1386
36 Ga0068855_100009709 3300005563 Bacteria 11616
37 Ga0068855_100055750 3300005563 Bacteria 4640
38 Ga0068855_100098814 3300005563 Bacteria 3362
39 Ga0068855_100205571 3300005563 Bacteria 2215
40 Ga0068857_100092322 3300005577 Bacteria 2710
41 Ga0068856_100123073 3300005614 Bacteria 2596
42 Ga0068852_100119269 3300005616 Bacteria 2412
43 Ga0068852_100261268 3300005616 Bacteria 1662
44 Ga0070717_10413314 3300006028 Bacteria 1213
45 Ga0070716_100314855 3300006173 Bacteria 1094
46 Ga0070712_100112283 3300006175 Bacteria 2036
47 Ga0070712_100468941 3300006175 Bacteria 1051
48 Ga0105240_10060262 3300009093 Bacteria 4732
49 Ga0105240_10335861 3300009093 Bacteria 1718
50 Ga0105240_10526051 3300009093 Bacteria 1312
51 Ga0105242_10939270 3300009176 Unclassified 868
52 Ga0105248_10481942 3300009177 Bacteria 1398
53 Ga0105237_10090825 3300009545 Bacteria 3043
54 Ga0105237_10175438 3300009545 Bacteria 2144
55 Ga0105238_10146322 3300009551 Bacteria 2339
56 Ga0105239_10168414 3300010375 Bacteria 2450
57 Ga0157373_10073612 3300013100 Bacteria 2411
58 Ga0157370_10080670 3300013104 Bacteria 3063
59 Ga0157370_10213370 3300013104 Bacteria 1789
60 Ga0157370_10464393 3300013104 Bacteria 1163
61 Ga0157369_10073466 3300013105 Bacteria 3670
62 Ga0157369_10084540 3300013105 Bacteria 3392
63 Ga0157369_10094811 3300013105 Bacteria 3185
64 Ga0157369_10113634 3300013105 Bacteria 2876
65 Ga0157369_10462435 3300013105 Bacteria 1314
66 Ga0157369_10525989 3300013105 Bacteria 1223
67 Ga0157369_11240519 3300013105 Unclassified 760
68 Ga0157374_10094200 3300013296 Bacteria 2861
69 Ga0157374_10649559 3300013296 Bacteria 1067
70 Ga0157378_10087310 3300013297 Bacteria 2829
71 Ga0157378_10901764 3300013297 Unclassified 915
72 Ga0157372_10188309 3300013307 Bacteria 2390
73 Ga0157372_10278100 3300013307 Bacteria 1946
74 Ga0157372_10408057 3300013307 Bacteria 1583
75 Ga0157375_10224935 3300013308 Bacteria 2035
76 Ga0157376_10134193 3300014969 Bacteria 2213
77 Ga0206356_10841106 3300020070 Bacteria 1232
78 Ga0206356_11109838 3300020070 Bacteria 2454
79 Ga0206356_11637317 3300020070 Bacteria 1413
80 Ga0206354_10036559 3300020081 Bacteria 2916
81 Ga0206354_10050486 3300020081 Bacteria 3393
82 Ga0206353_10619696 3300020082 Bacteria 1078
83 Ga0206353_11655066 3300020082 Bacteria 2780
84 Ga0206353_11930976 3300020082 Bacteria 2705
85 Ga0224712_10009302 3300022467 Bacteria 2954
86 Ga0207692_10031614 3300025898 Bacteria 2537
87 Ga0207705_10030525 3300025909 Bacteria 3846
88 Ga0207705_10031203 3300025909 Bacteria 3802
89 Ga0207705_10357324 3300025909 Archaea 1126
90 Ga0207707_10165862 3300025912 Bacteria 1930
91 Ga0207707_10431808 3300025912 Bacteria 1128
92 Ga0207695_10291800 3300025913 Bacteria 1523
93 Ga0207695_10928303 3300025913 Bacteria 750
94 Ga0207671_10180675 3300025914 Bacteria 1642
95 Ga0207693_10101884 3300025915 Bacteria 2251
96 Ga0207693_10243183 3300025915 Bacteria 1413
97 Ga0207663_10111236 3300025916 Bacteria 1859
98 Ga0207660_10087656 3300025917 Bacteria 2300
99 Ga0207657_10001148 3300025919 Bacteria 28154
100 Ga0207657_10001734 3300025919 Bacteria 23503
101 Ga0207657_10001874 3300025919 Bacteria 22755
102 Ga0207657_10022080 3300025919 Bacteria 5973
103 Ga0207657_10374211 3300025919 Bacteria 1122
104 Ga0207649_10052963 3300025920 Bacteria 2520
105 Ga0207652_10021631 3300025921 Bacteria 5309
106 Ga0207652_10066960 3300025921 Bacteria 3113
107 Ga0207664_10244894 3300025929 Bacteria 1562
108 Ga0207644_10202797 3300025931 Bacteria 1565
109 Ga0207661_10052624 3300025944 Bacteria 3254
110 Ga0207661_10298706 3300025944 Bacteria 1443
111 Ga0207667_10094735 3300025949 Bacteria 3082
112 Ga0207667_10252964 3300025949 Bacteria 1802
113 Ga0207667_10480566 3300025949 Bacteria 1261
114 Ga0207667_10685181 3300025949 Unclassified 1028
115 Ga0207677_10763471 3300026023 Bacteria 863
116 Ga0207677_11078826 3300026023 Unclassified 731
117 Ga0207639_10230295 3300026041 Bacteria 1606
118 Ga0207639_10580261 3300026041 Bacteria 1032
119 Ga0207678_10193392 3300026067 Bacteria 1739
120 Ga0207702_10162861 3300026078 Bacteria 2038
121 Ga0207702_10171151 3300026078 Bacteria 1991
122 Ga0207674_10074951 3300026116 Bacteria 3394
123 Ga0207674_10157229 3300026116 Bacteria 2228
124 Ga0207683_10104661 3300026121 Bacteria 2529
125 Ga0265338_10067141 3300028800 Bacteria 3099
126 Ga0265338_10084482 3300028800 Bacteria 2650
127 Ga0265320_10220110 3300031240 Bacteria 846
128 Ga0265327_10078786 3300031251 Bacteria 1631
129 Ga0265316_10269453 3300031344 Bacteria 1246
130 Ga0395899_0049165 3300037312 Bacteria 3135
131 Ga0395899_0134392 3300037312 Bacteria 1764
132 Ga0395900_0049146 3300037418 Bacteria 4344
133 Ga0395900_0049711 3300037418 Bacteria 4320
134 Ga0395900_0116228 3300037418 Bacteria 2745
135 Ga0395900_0414756 3300037418 Bacteria 1308
136 Ga0395900_0455821 3300037418 Bacteria 1234
137 Ga0395898_0008643 3300037466 Bacteria 10742
138 Ga0395898_0112346 3300037466 Bacteria 2611
139 Ga0395898_0141934 3300037466 Bacteria 2299
140 Ga0395898_0174143 3300037466 Bacteria 2057
141 Ga0395898_0451720 3300037466 Bacteria 1224
142 Ga0395898_0636679 3300037466 Unclassified 1009
143 Ga0395905_0022871 3300037471 Bacteria 5909
144 Ga0395905_0288046 3300037471 Bacteria 1529
145 Ga0395905_0363820 3300037471 Bacteria 1339
146 Ga0395905_0387195 3300037471 Bacteria 1292
147 Ga0395905_0842524 3300037471 Unclassified 820
148 Ga0395901_0001784 3300038443 Bacteria 22196
149 Ga0395901_0021881 3300038443 Bacteria 6553
150 Ga0395901_0085277 3300038443 Bacteria 3302
151 Ga0395901_0125208 3300038443 Bacteria 2700
152 Ga0395901_0143418 3300038443 Bacteria 2510
153 Ga0436365_0910319 3300039437 Bacteria 899
154 Ga0436365_1191011 3300039437 Bacteria 833
155 Ga0466965_0089193 3300044683 Bacteria 1567
156 Ga0466965_0116693 3300044683 Bacteria 1376
157 Ga0466966_0040594 3300044684 Bacteria 2995
158 Ga0466966_0064155 3300044684 Bacteria 2313
159 Ga0466966_0233854 3300044684 Bacteria 1108
160 Ga0466961_0004101 3300044693 Bacteria 9093
161 Ga0466961_0143947 3300044693 Bacteria 1491
162 Ga0466963_0003437 3300044694 Bacteria 9065
163 Ga0466963_0018462 3300044694 Bacteria 4362
164 Ga0466963_0053871 3300044694 Bacteria 2672
165 Ga0466963_0169280 3300044694 Bacteria 1522
166 Ga0466963_0232099 3300044694 Bacteria 1293
167 Ga0466963_0276524 3300044694 Bacteria 1180
168 Ga0466963_0408997 3300044694 Bacteria 957
169 Ga0466971_0009054 3300044719 Bacteria 4350
170 Ga0466971_0204367 3300044719 Bacteria 933
171 Ga0466968_0025604 3300044735 Bacteria 2417
172 Ga0466968_0135315 3300044735 Bacteria 1124
173 Ga0466970_0135456 3300044765 Bacteria 1355
174 Ga0466957_0000044 3300044842 Bacteria 46388
175 Ga0466957_0152003 3300044842 Bacteria 1497
176 Ga0466959_0068085 3300045049 Bacteria 2580
177 Ga0466958_0034482 3300045836 Bacteria 3019
178 Ga0466967_0007564 3300045976 Bacteria 7851
179 Ga0466967_0023466 3300045976 Bacteria 5055
180 Ga0466967_0054664 3300045976 Bacteria 3516
181 Ga0466967_0082831 3300045976 Bacteria 2900
182 Ga0466967_0196469 3300045976 Bacteria 1909
183 Ga0466967_0277123 3300045976 Bacteria 1608
184 Ga0466967_0505757 3300045976 Bacteria 1186
185 Ga0495592_0364541 3300046454 Bacteria 923
186 Ga0495629_0069307 3300046459 Bacteria 2461
187 Ga0495651_0002853 3300046462 Bacteria 13391
188 Ga0495651_0164486 3300046462 Bacteria 1586
189 Ga0495653_0136037 3300046463 Bacteria 1733
190 Ga0495664_0060772 3300046477 Bacteria 2250
191 Ga0495608_0035004 3300046511 Bacteria 3389
192 Ga0495608_0055732 3300046511 Bacteria 2612
193 Ga0495618_0196724 3300046514 Bacteria 1277
194 Ga0495628_0064844 3300046516 Bacteria 2859
195 Ga0495628_0125502 3300046516 Bacteria 1967
196 Ga0495628_0209175 3300046516 Bacteria 1468
197 Ga0495630_0004288 3300046517 Bacteria 10003
198 Ga0495652_0081539 3300046529 Bacteria 2668
199 Ga0495652_0200780 3300046529 Bacteria 1513
200 Ga0495640_0018032 3300046533 Bacteria 5247
201 Ga0495640_0034792 3300046533 Bacteria 3567
202 Ga0495587_0172792 3300046536 Unclassified 1227
203 Ga0495645_0023337 3300046543 Bacteria 4479
204 Ga0495667_0017994 3300046559 Bacteria 4773
205 Ga0495634_0076851 3300046642 Bacteria 2191
206 Ga0495634_0125785 3300046642 Bacteria 1638
207 Ga0495635_0034235 3300046663 Bacteria 3523
208 Ga0495635_0130308 3300046663 Bacteria 1714
209 Ga0495588_0141971 3300046674 Bacteria 1269
210 Ga0495657_0080035 3300046675 Bacteria 2115
211 Ga0495657_0172702 3300046675 Bacteria 1330
212 Ga0495623_0380818 3300046679 Bacteria 763
213 Ga0495646_0081589 3300046680 Bacteria 1884
214 Ga0495613_0026943 3300046689 Bacteria 4279
215 Ga0495613_0344373 3300046689 Unclassified 1025
216 Ga0495604_0105946 3300047317 Bacteria 2057
217 Ga0495604_0204991 3300047317 Bacteria 1365
218 Ga0495674_0001283 3300047319 Bacteria 24435
219 Ga0495674_0041634 3300047319 Bacteria 4102
220 Ga0495674_0148786 3300047319 Bacteria 1964
221 Ga0495676_0418300 3300047321 Unclassified 887
222 Ga0495680_0003455 3300047322 Bacteria 15561
223 Ga0495680_0094272 3300047322 Bacteria 2240
224 Ga0495675_0119710 3300047444 Bacteria 1640
225 Ga0495684_0002523 3300047471 Bacteria 14593
226 Ga0495684_0012062 3300047471 Bacteria 6666
227 Ga0495602_0086536 3300048088 Bacteria 2616
228 Ga0495602_0222387 3300048088 Bacteria 1424
229 Ga0495602_0407834 3300048088 Bacteria 968
230 Ga0496100_0007619 3300048903 Bacteria 5987
231 Ga0496100_0058371 3300048903 Bacteria 2532
232 Ga0496101_0001173 3300048904 Bacteria 15695
233 Ga0496101_0008298 3300048904 Bacteria 6787
234 Ga0496101_0010839 3300048904 Bacteria 6030
235 Ga0496101_0014166 3300048904 Bacteria 5356
236 Ga0496101_0033995 3300048904 Bacteria 3599
237 Ga0496102_0009287 3300048905 Bacteria 8440
238 Ga0496102_0009380 3300048905 Bacteria 8406
239 Ga0496102_0449701 3300048905 Bacteria 1209
240 Ga0496103_0028171 3300048906 Bacteria 3408
241 Ga0496103_0116751 3300048906 Bacteria 1698
242 Ga0496104_0051634 3300048907 Bacteria 3881
243 Ga0496104_0081720 3300048907 Bacteria 3081
244 Ga0496105_0000930 3300048908 Bacteria 19941
245 Ga0496105_0005199 3300048908 Bacteria 9859
246 Ga0496106_0007232 3300048909 Bacteria 8200
247 Ga0496106_0032509 3300048909 Bacteria 3890
248 Ga0496107_0008786 3300048910 Bacteria 7000
249 Ga0496107_0030139 3300048910 Bacteria 3865
250 Ga0496107_0246105 3300048910 Bacteria 1331
251 Ga0496109_0002119 3300048912 Bacteria 16507
252 Ga0496109_0095455 3300048912 Bacteria 2753
253 Ga0496109_0899700 3300048912 Unclassified 823
254 Ga0496110_0032397 3300048913 Bacteria 4513
255 Ga0496110_0073604 3300048913 Bacteria 3032
256 Ga0496110_0109317 3300048913 Bacteria 2483
257 Ga0496111_0215817 3300048914 Bacteria 1425
258 Ga0496112_0015504 3300048915 Bacteria 7116
259 Ga0496112_0093500 3300048915 Bacteria 2977
260 Ga0496112_0259761 3300048915 Unclassified 1686
261 Ga0496112_0264157 3300048915 Bacteria 1670
262 Ga0496113_0098932 3300048916 Bacteria 2258
263 Ga0496114_0018228 3300048917 Bacteria 5673
264 Ga0496114_0018276 3300048917 Bacteria 5667
265 Ga0496114_0023811 3300048917 Bacteria 4997
266 Ga0496115_0001171 3300048918 Bacteria 18799
267 Ga0496115_0147975 3300048918 Bacteria 1939
268 Ga0496115_0281567 3300048918 Bacteria 1365
269 Ga0501032_0105595 3300049569 Bacteria 1866
270 Ga0501067_0208732 3300049583 Bacteria 1088
271 Ga0501069_0059516 3300049585 Bacteria 2131
272 Ga0501069_0065882 3300049585 Bacteria 2026
273 Ga0501070_0002159 3300049586 Bacteria 17293
274 Ga0501073_0230611 3300049589 Bacteria 1279
275 Ga0501074_0346186 3300049590 Bacteria 1055
276 Ga0501080_0178208 3300049742 Bacteria 1957
277 Ga0501080_0364960 3300049742 Bacteria 1302
278 Ga0501044_0471190 3300049823 Bacteria 1160
279 Ga0495601_0022960 3300053077 Bacteria 3833
280 Ga0495601_0202053 3300053077 Bacteria 1298
281 Ga0495612_0174565 3300053078 Unclassified 942
282 Ga0495595_0027189 3300053084 Bacteria 2547
283 Ga0495619_0020202 3300053085 Bacteria 4239
284 Ga0495619_0129252 3300053085 Bacteria 1735
285 Ga0070660_100007015
286 rootH1_10100740
287 Ga0070658_10181050
288 Ga0070658_10474065
289 Ga0070658_10594816
290 Ga0070683_100124381
291 Ga0070683_100521345
292 Ga0070680_100059524
293 Ga0070680_100515724
294 Ga0070682_100082620
295 Ga0070660_100025832
296 Ga0070660_100094547
297 Ga0070661_100013881
298 Ga0070661_100113619
299 Ga0070671_100126473
300 Ga0070659_100019548
301 Ga0070710_10187541
302 Ga0070711_100029013
303 Ga0070708_100002927
304 Ga0070663_100095014
305 Ga0070678_100036808
306 Ga0070681_10003095
307 Ga0070681_10018719
308 Ga0070681_10173864
309 Ga0070699_100606621
310 Ga0070679_100023972
311 Ga0070679_100052322
312 Ga0070679_100260774
313 Ga0070684_100093104
314 Ga0070684_100366316
315 Ga0070684_100436973
316 Ga0068853_100149200
317 Ga0068853_100672975
318 Ga0070696_100051055
319 Ga0070665_100397189
320 Ga0068855_100009709
321 Ga0068855_100055750
322 Ga0068855_100098814
323 Ga0068855_100205571
324 Ga0068857_100092322
325 Ga0068856_100123073
326 Ga0068852_100119269
327 Ga0068852_100261268
328 Ga0070717_10413314
329 Ga0070716_100314855
330 Ga0070712_100112283
331 Ga0070712_100468941
332 Ga0105240_10060262
333 Ga0105240_10335861
334 Ga0105240_10526051
335 Ga0105242_10939270
336 Ga0105248_10481942
337 Ga0105237_10090825
338 Ga0105237_10175438
339 Ga0105238_10146322
340 Ga0105239_10168414
341 Ga0157373_10073612
342 Ga0157370_10080670
343 Ga0157370_10213370
344 Ga0157370_10464393
345 Ga0157369_10073466
346 Ga0157369_10084540
347 Ga0157369_10094811
348 Ga0157369_10113634
349 Ga0157369_10462435
350 Ga0157369_10525989
351 Ga0157369_11240519
352 Ga0157374_10094200
353 Ga0157374_10649559
354 Ga0157378_10087310
355 Ga0157378_10901764
356 Ga0157372_10188309
357 Ga0157372_10278100
358 Ga0157372_10408057
359 Ga0157375_10224935
360 Ga0157376_10134193
361 Ga0206356_10841106
362 Ga0206356_11109838
363 Ga0206356_11637317
364 Ga0206354_10036559
365 Ga0206354_10050486
366 Ga0206353_10619696
367 Ga0206353_11655066
368 Ga0206353_11930976
369 Ga0224712_10009302
370 Ga0207692_10031614
371 Ga0207705_10030525
372 Ga0207705_10031203
373 Ga0207705_10357324
374 Ga0207707_10165862
375 Ga0207707_10431808
376 Ga0207695_10291800
377 Ga0207695_10928303
378 Ga0207671_10180675
379 Ga0207693_10101884
380 Ga0207693_10243183
381 Ga0207663_10111236
382 Ga0207660_10087656
383 Ga0207657_10001148
384 Ga0207657_10001734
385 Ga0207657_10001874
386 Ga0207657_10022080
387 Ga0207657_10374211
388 Ga0207649_10052963
389 Ga0207652_10021631
390 Ga0207652_10066960
391 Ga0207664_10244894
392 Ga0207644_10202797
393 Ga0207661_10052624
394 Ga0207661_10298706
395 Ga0207667_10094735
396 Ga0207667_10252964
397 Ga0207667_10480566
398 Ga0207667_10685181
399 Ga0207677_10763471
400 Ga0207677_11078826
401 Ga0207639_10230295
402 Ga0207639_10580261
403 Ga0207678_10193392
404 Ga0207702_10162861
405 Ga0207702_10171151
406 Ga0207674_10074951
407 Ga0207674_10157229
408 Ga0207683_10104661
409 Ga0265338_10067141
410 Ga0265338_10084482
411 Ga0265320_10220110
412 Ga0265327_10078786
413 Ga0265316_10269453
414 Ga0395899_0049165
415 Ga0395899_0134392
416 Ga0395900_0049146
417 Ga0395900_0049711
418 Ga0395900_0116228
419 Ga0395900_0414756
420 Ga0395900_0455821
421 Ga0395898_0008643
422 Ga0395898_0112346
423 Ga0395898_0141934
424 Ga0395898_0174143
425 Ga0395898_0451720
426 Ga0395898_0636679
427 Ga0395905_0022871
428 Ga0395905_0288046
429 Ga0395905_0363820
430 Ga0395905_0387195
431 Ga0395905_0842524
432 Ga0395901_0001784
433 Ga0395901_0021881
434 Ga0395901_0085277
435 Ga0395901_0125208
436 Ga0395901_0143418
437 Ga0436365_0910319
438 Ga0436365_1191011
439 Ga0466965_0089193
440 Ga0466965_0116693
441 Ga0466966_0040594
442 Ga0466966_0064155
443 Ga0466966_0233854
444 Ga0466961_0004101
445 Ga0466961_0143947
446 Ga0466963_0003437
447 Ga0466963_0018462
448 Ga0466963_0053871
449 Ga0466963_0169280
450 Ga0466963_0232099
451 Ga0466963_0276524
452 Ga0466963_0408997
453 Ga0466971_0009054
454 Ga0466971_0204367
455 Ga0466968_0025604
456 Ga0466968_0135315
457 Ga0466970_0135456
458 Ga0466957_0000044
459 Ga0466957_0152003
460 Ga0466959_0068085
461 Ga0466958_0034482
462 Ga0466967_0007564
463 Ga0466967_0023466
464 Ga0466967_0054664
465 Ga0466967_0082831
466 Ga0466967_0196469
467 Ga0466967_0277123
468 Ga0466967_0505757
469 Ga0495592_0364541
470 Ga0495629_0069307
471 Ga0495651_0002853
472 Ga0495651_0164486
473 Ga0495653_0136037
474 Ga0495664_0060772
475 Ga0495608_0035004
476 Ga0495608_0055732
477 Ga0495618_0196724
478 Ga0495628_0064844
479 Ga0495628_0125502
480 Ga0495628_0209175
481 Ga0495630_0004288
482 Ga0495652_0081539
483 Ga0495652_0200780
484 Ga0495640_0018032
485 Ga0495640_0034792
486 Ga0495587_0172792
487 Ga0495645_0023337
488 Ga0495667_0017994
489 Ga0495634_0076851
490 Ga0495634_0125785
491 Ga0495635_0034235
492 Ga0495635_0130308
493 Ga0495588_0141971
494 Ga0495657_0080035
495 Ga0495657_0172702
496 Ga0495623_0380818
497 Ga0495646_0081589
498 Ga0495613_0026943
499 Ga0495613_0344373
500 Ga0495604_0105946
501 Ga0495604_0204991
502 Ga0495674_0001283
503 Ga0495674_0041634
504 Ga0495674_0148786
505 Ga0495676_0418300
506 Ga0495680_0003455
507 Ga0495680_0094272
508 Ga0495675_0119710
509 Ga0495684_0002523
510 Ga0495684_0012062
511 Ga0495602_0086536
512 Ga0495602_0222387
513 Ga0495602_0407834
514 Ga0496100_0007619
515 Ga0496100_0058371
516 Ga0496101_0001173
517 Ga0496101_0008298
518 Ga0496101_0010839
519 Ga0496101_0014166
520 Ga0496101_0033995
521 Ga0496102_0009287
522 Ga0496102_0009380
523 Ga0496102_0449701
524 Ga0496103_0028171
525 Ga0496103_0116751
526 Ga0496104_0051634
527 Ga0496104_0081720
528 Ga0496105_0000930
529 Ga0496105_0005199
530 Ga0496106_0007232
531 Ga0496106_0032509
532 Ga0496107_0008786
533 Ga0496107_0030139
534 Ga0496107_0246105
535 Ga0496109_0002119
536 Ga0496109_0095455
537 Ga0496109_0899700
538 Ga0496110_0032397
539 Ga0496110_0073604
540 Ga0496110_0109317
541 Ga0496111_0215817
542 Ga0496112_0015504
543 Ga0496112_0093500
544 Ga0496112_0259761
545 Ga0496112_0264157
546 Ga0496113_0098932
547 Ga0496114_0018228
548 Ga0496114_0018276
549 Ga0496114_0023811
550 Ga0496115_0001171
551 Ga0496115_0147975
552 Ga0496115_0281567
553 Ga0501032_0105595
554 Ga0501067_0208732
555 Ga0501069_0059516
556 Ga0501069_0065882
557 Ga0501070_0002159
558 Ga0501073_0230611
559 Ga0501074_0346186
560 Ga0501080_0178208
561 Ga0501080_0364960
562 Ga0501044_0471190
563 Ga0495601_0022960
564 Ga0495601_0202053
565 Ga0495612_0174565
566 Ga0495595_0027189
567 Ga0495619_0020202
568 Ga0495619_0129252

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04893

Yip1

Yip1 domain

36

229

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xgg-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.4431 52 187
7xgf-assembly2.cif.gz_D crystal structure of bcl-xl in complex with computationally designed inhibitor protein 0.428 52 187
5vox-assembly1.cif.gz_W yeast v-atpase in complex with legionella pneumophila effector sidk (rotational state 1) 0.4027 52 187
8eat-assembly1.cif.gz_o yeast vo missing subunits a, e, and f in complex with vma12-22p 0.399 48 183
7tmt-assembly1.cif.gz_k v-atpase from saccharomyces cerevisiae, state 3 0.3923 31 187
ID Description Score Start End Superfamily
4i0xE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.572 122 185 1.10.287.1060
4i0xE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.5185 122 185 1.10.287.1060
af_Q61301_150_261_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4301 51 187 1.20.120.230
af_Q61301_150_261_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4176 51 187 1.20.120.230
af_Q9BY19_71_172_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4134 95 185 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7Y5WWF0-F1-model_v4 YIP1 family protein 0.9483 17 191 GO:0016020
AF-A0A6J6Q4K2-F1-model_v4 Unannotated protein 0.9468 18 191 GO:0016020
AF-A0A7W0SK89-F1-model_v4 YIP1 family protein 0.9405 13 191 GO:0016020
AF-A0A7Y5XWU8-F1-model_v4 YIP1 family protein 0.9375 15 191 GO:0016020
AF-A0A7W0TRC9-F1-model_v4 YIP1 family protein 0.9285 11 191 GO:0016020

Map