F385879

General Info

Members Datasets Scaffolds Average Seq Length
283 141 566 120

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_1285448_c1|nmdc:mga09592_1285448_c1_147_584
Length 145
Sequence MPELHLPPTGDDRRCVAAGVEGRVMTDRMTVDVWLRGTDFATTATIEGSPRPPRSWTDEDVRQVLEAMLRAMDRLKRPGEGDRDISLRGLSWIVNPYEEGGVVIAIEISMGAAVAGPFDIDKAALEAMIARVLTQPAPPSSSTVH

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
110 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
111 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 97.88
Stem 0
Stem Tuber 0
Unclassified 26.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_1285448_c1 3300050508 Unclassified 602
2 Ga0065712_10590399 3300005290 Bacteria 596
3 Ga0065715_10417701 3300005293 Bacteria 862
4 Ga0065715_10616626 3300005293 Unclassified 698
5 Ga0065715_10980029 3300005293 Unclassified 551
6 Ga0065707_10315955 3300005295 Bacteria 975
7 Ga0070676_10713661 3300005328 Bacteria 733
8 Ga0070690_101103608 3300005330 Unclassified 629
9 Ga0068869_101753388 3300005334 Unclassified 555
10 Ga0070666_11340469 3300005335 Bacteria 534
11 Ga0068868_100151961 3300005338 Bacteria 1907
12 Ga0068868_100307449 3300005338 Bacteria 1348
13 Ga0070689_100133245 3300005340 Bacteria 1994
14 Ga0070689_100502521 3300005340 Archaea 1039
15 Ga0070689_101774441 3300005340 Unclassified 562
16 Ga0070691_10517596 3300005341 Unclassified 692
17 Ga0070687_100090675 3300005343 Bacteria 1690
18 Ga0070692_10260763 3300005345 Unclassified 1042
19 Ga0070668_100346366 3300005347 Bacteria 1256
20 Ga0070668_100490447 3300005347 Unclassified 1062
21 Ga0070669_100296488 3300005353 Unclassified 1299
22 Ga0070669_100337439 3300005353 Bacteria 1220
23 Ga0070669_100664589 3300005353 Bacteria 877
24 Ga0070669_101305993 3300005353 Unclassified 628
25 Ga0070675_100000988 3300005354 Bacteria 20349
26 Ga0070674_100042023 3300005356 Bacteria 3103
27 Ga0070673_100030345 3300005364 Bacteria 4044
28 Ga0070673_100274293 3300005364 Bacteria 1477
29 Ga0070673_100538300 3300005364 Unclassified 1060
30 Ga0070688_100118631 3300005365 Bacteria 1769
31 Ga0070688_100484196 3300005365 Bacteria 931
32 Ga0070667_100230802 3300005367 Bacteria 1650
33 Ga0070710_11056353 3300005437 Unclassified 594
34 Ga0070701_11048779 3300005438 Unclassified 571
35 Ga0070705_100019586 3300005440 Bacteria 3563
36 Ga0070705_100238583 3300005440 Bacteria 1269
37 Ga0070705_101286041 3300005440 Archaea 606
38 Ga0070705_101342905 3300005440 Bacteria 594
39 Ga0070694_100031151 3300005444 Unclassified 3495
40 Ga0070694_100039522 3300005444 Bacteria 3141
41 Ga0070694_101188135 3300005444 Bacteria 639
42 Ga0070694_101819358 3300005444 Bacteria 519
43 Ga0070708_100353917 3300005445 Unclassified 1384
44 Ga0070708_100391270 3300005445 Bacteria 1311
45 Ga0070663_101449708 3300005455 Bacteria 609
46 Ga0070678_101819060 3300005456 Unclassified 574
47 Ga0070662_100481961 3300005457 Unclassified 1033
48 Ga0068867_100277443 3300005459 Bacteria 1373
49 Ga0068867_101776879 3300005459 Unclassified 579
50 Ga0070706_100201517 3300005467 Unclassified 1859
51 Ga0070706_101203045 3300005467 Unclassified 696
52 Ga0070706_101735874 3300005467 Bacteria 568
53 Ga0070707_100201482 3300005468 Bacteria 1940
54 Ga0070698_100079865 3300005471 Unclassified 3267
55 Ga0070699_100001294 3300005518 Bacteria 23090
56 Ga0070699_100100136 3300005518 Unclassified 2540
57 Ga0070699_100277054 3300005518 Unclassified 1502
58 Ga0070699_100819629 3300005518 Bacteria 852
59 Ga0070697_100248040 3300005536 Unclassified 1522
60 Ga0070697_100394445 3300005536 Bacteria 1200
61 Ga0070672_100163772 3300005543 Bacteria 1847
62 Ga0070695_100023455 3300005545 Bacteria 3792
63 Ga0070695_100358784 3300005545 Bacteria 1094
64 Ga0070695_100419104 3300005545 Unclassified 1019
65 Ga0070695_100650339 3300005545 Unclassified 832
66 Ga0070696_100514735 3300005546 Bacteria 954
67 Ga0070693_100349058 3300005547 Bacteria 1012
68 Ga0070704_100008291 3300005549 Bacteria 6222
69 Ga0070704_100013330 3300005549 Bacteria 5099
70 Ga0070704_100863791 3300005549 Unclassified 812
71 Ga0070664_100866680 3300005564 Unclassified 846
72 Ga0070664_101916947 3300005564 Unclassified 562
73 Ga0068854_100787363 3300005578 Unclassified 828
74 Ga0068859_100352421 3300005617 Unclassified 1567
75 Ga0068859_101949283 3300005617 Unclassified 649
76 Ga0068866_10306845 3300005718 Unclassified 993
77 Ga0068866_10904891 3300005718 Unclassified 621
78 Ga0068861_100033521 3300005719 Bacteria 3789
79 Ga0068861_100777256 3300005719 Bacteria 897
80 Ga0068861_102345010 3300005719 Unclassified 536
81 Ga0068861_102361245 3300005719 Bacteria 534
82 Ga0068863_100004638 3300005841 Bacteria 13547
83 Ga0068863_100763325 3300005841 Bacteria 963
84 Ga0068858_100989971 3300005842 Unclassified 824
85 Ga0068858_101414959 3300005842 Bacteria 685
86 Ga0068860_100022174 3300005843 Bacteria 6147
87 Ga0068860_100602712 3300005843 Bacteria 1104
88 Ga0068860_100934571 3300005843 Bacteria 884
89 Ga0068860_101138420 3300005843 Bacteria 800
90 Ga0068862_100053077 3300005844 Bacteria 3469
91 Ga0068862_100155987 3300005844 Unclassified 2035
92 Ga0068862_100632499 3300005844 Bacteria 1030
93 Ga0068862_101338819 3300005844 Viruses 718
94 Ga0068862_101598992 3300005844 Unclassified 659
95 Ga0081539_10014399 3300005985 Bacteria 5854
96 Ga0081539_10500062 3300005985 Unclassified 503
97 Ga0070715_10578016 3300006163 Unclassified 655
98 Ga0097621_100302611 3300006237 Bacteria 1413
99 Ga0068871_100278090 3300006358 Bacteria 1464
100 Ga0068871_100285415 3300006358 Bacteria 1445
101 Ga0068871_102033055 3300006358 Unclassified 547
102 Ga0075428_100664861 3300006844 Bacteria 1111
103 Ga0075433_10044078 3300006852 Bacteria 3875
104 Ga0075433_10054636 3300006852 Bacteria 3484
105 Ga0075433_10057195 3300006852 Bacteria 3409
106 Ga0075433_10178085 3300006852 Bacteria 1892
107 Ga0075433_10420441 3300006852 Bacteria 1179
108 Ga0075434_100001822 3300006871 Bacteria 18397
109 Ga0075434_100013791 3300006871 Bacteria 7705
110 Ga0075434_100086445 3300006871 Bacteria 3136
111 Ga0075434_100418434 3300006871 Bacteria 1361
112 Ga0075434_100469510 3300006871 Unclassified 1279
113 Ga0075434_101368392 3300006871 Unclassified 718
114 Ga0068865_100682643 3300006881 Bacteria 876
115 Ga0075436_100018710 3300006914 Bacteria 4742
116 Ga0075436_100032972 3300006914 Bacteria 3568
117 Ga0075436_100339102 3300006914 Bacteria 1082
118 Ga0075436_100849975 3300006914 Bacteria 681
119 Ga0097620_100352446 3300006931 Unclassified 1567
120 Ga0097620_100853090 3300006931 Unclassified 997
121 Ga0097620_101949299 3300006931 Unclassified 649
122 Ga0075435_100053614 3300007076 Bacteria 3252
123 Ga0075435_100074135 3300007076 Bacteria 2783
124 Ga0075435_100115341 3300007076 Bacteria 2237
125 Ga0075435_101033579 3300007076 Bacteria 718
126 Ga0111539_10151595 3300009094 Bacteria 2713
127 Ga0111539_11644698 3300009094 Bacteria 745
128 Ga0114129_10002259 3300009147 Bacteria 26632
129 Ga0114129_10003418 3300009147 Bacteria 22320
130 Ga0114129_10068574 3300009147 Bacteria 4945
131 Ga0114129_10392709 3300009147 Bacteria 1829
132 Ga0114129_12066961 3300009147 Bacteria 688
133 Ga0105243_10040970 3300009148 Bacteria 3620
134 Ga0105243_10192602 3300009148 Unclassified 1782
135 Ga0105248_10051824 3300009177 Bacteria 4605
136 Ga0105248_10056851 3300009177 Bacteria 4390
137 Ga0105248_10322023 3300009177 Bacteria 1741
138 Ga0105248_10710097 3300009177 Unclassified 1134
139 Ga0105248_10715676 3300009177 Unclassified 1130
140 Ga0105248_10730509 3300009177 Bacteria 1117
141 Ga0105248_11573384 3300009177 Bacteria 745
142 Ga0105249_10400483 3300009553 Bacteria 1403
143 Ga0105249_10490789 3300009553 Unclassified 1272
144 Ga0105249_10846802 3300009553 Unclassified 980
145 Ga0105249_11596987 3300009553 Unclassified 725
146 Ga0105249_11840805 3300009553 Unclassified 678
147 Ga0157324_1007044 3300012506 Bacteria 866
148 Ga0157374_12503918 3300013296 Unclassified 543
149 Ga0157375_10107254 3300013308 Bacteria 2886
150 Ga0157375_10172905 3300013308 Bacteria 2308
151 Ga0163163_10109410 3300014325 Bacteria 2791
152 Ga0157380_10062832 3300014326 Bacteria 2976
153 Ga0157380_10148328 3300014326 Bacteria 2024
154 Ga0157380_10365670 3300014326 Bacteria 1355
155 Ga0157377_10082808 3300014745 Bacteria 1879
156 Ga0157379_10015111 3300014968 Bacteria 6771
157 Ga0157379_10064543 3300014968 Bacteria 3272
158 Ga0157379_10545044 3300014968 Bacteria 1079
159 Ga0157379_10634492 3300014968 Bacteria 999
160 Ga0157376_10268854 3300014969 Bacteria 1600
161 Ga0157376_10638206 3300014969 Unclassified 1064
162 Ga0207653_10143627 3300025885 Unclassified 874
163 Ga0207692_10635271 3300025898 Unclassified 689
164 Ga0207688_10190292 3300025901 Bacteria 1227
165 Ga0207646_10075224 3300025922 Bacteria 3017
166 Ga0207646_10522551 3300025922 Bacteria 1068
167 Ga0207681_10130354 3300025923 Bacteria 1858
168 Ga0207681_10249761 3300025923 Bacteria 1384
169 Ga0207681_11181824 3300025923 Bacteria 643
170 Ga0207659_10002508 3300025926 Bacteria 10934
171 Ga0207644_10925452 3300025931 Bacteria 731
172 Ga0207706_10042477 3300025933 Bacteria 4029
173 Ga0207706_10829691 3300025933 Bacteria 784
174 Ga0207706_11322482 3300025933 Unclassified 595
175 Ga0207686_10253234 3300025934 Bacteria 1287
176 Ga0207686_10541074 3300025934 Bacteria 909
177 Ga0207686_11548640 3300025934 Unclassified 547
178 Ga0207709_10724064 3300025935 Unclassified 798
179 Ga0207670_10042520 3300025936 Bacteria 2995
180 Ga0207670_10084033 3300025936 Bacteria 2234
181 Ga0207669_10018577 3300025937 Bacteria 3598
182 Ga0207669_10449672 3300025937 Unclassified 1021
183 Ga0207704_10229673 3300025938 Bacteria 1379
184 Ga0207691_10019470 3300025940 Bacteria 6421
185 Ga0207711_10014297 3300025941 Bacteria 6591
186 Ga0207711_10047273 3300025941 Bacteria 3678
187 Ga0207711_10171553 3300025941 Bacteria 1968
188 Ga0207689_11096735 3300025942 Bacteria 671
189 Ga0207651_10032667 3300025960 Bacteria 3347
190 Ga0207651_10047209 3300025960 Bacteria 2902
191 Ga0207651_10148106 3300025960 Bacteria 1823
192 Ga0207651_11282655 3300025960 Bacteria 658
193 Ga0207712_10858286 3300025961 Unclassified 800
194 Ga0207712_10923570 3300025961 Unclassified 772
195 Ga0207668_10459646 3300025972 Unclassified 1088
196 Ga0207640_11032502 3300025981 Unclassified 724
197 Ga0207658_10188334 3300025986 Bacteria 1713
198 Ga0207658_10259428 3300025986 Bacteria 1481
199 Ga0207677_10144207 3300026023 Bacteria 1828
200 Ga0207677_10278903 3300026023 Bacteria 1371
201 Ga0207703_11160037 3300026035 Bacteria 742
202 Ga0207703_11735719 3300026035 Bacteria 600
203 Ga0207708_10074419 3300026075 Bacteria 2603
204 Ga0207708_12012498 3300026075 Bacteria 506
205 Ga0207641_10005956 3300026088 Bacteria 10332
206 Ga0207641_10068705 3300026088 Bacteria 3039
207 Ga0207641_11440807 3300026088 Unclassified 690
208 Ga0207648_10351835 3300026089 Bacteria 1328
209 Ga0207648_10600735 3300026089 Bacteria 1014
210 Ga0207648_11650550 3300026089 Unclassified 602
211 Ga0207676_11788230 3300026095 Bacteria 613
212 Ga0207675_100019748 3300026118 Bacteria 6289
213 Ga0207675_100553960 3300026118 Bacteria 1149
214 Ga0207675_100692208 3300026118 Bacteria 1028
215 Ga0207675_100862067 3300026118 Bacteria 921
216 Ga0207675_101735158 3300026118 Bacteria 644
217 Ga0207675_102431387 3300026118 Unclassified 536
218 Ga0207683_10751463 3300026121 Bacteria 905
219 Ga0207428_10044600 3300027907 Bacteria 3577
220 Ga0268265_10045279 3300028380 Bacteria 3282
221 Ga0268265_12326820 3300028380 Bacteria 542
222 Ga0268264_10050350 3300028381 Bacteria 3468
223 Ga0268264_10298756 3300028381 Bacteria 1515
224 Ga0268264_11588333 3300028381 Unclassified 665
225 Ga0265760_10250633 3300031090 Bacteria 613
226 Ga0265314_10284949 3300031711 Bacteria 933
227 Ga0373948_0043490 3300034817 Bacteria 946
228 Ga0373950_0001944 3300034818 Bacteria 2789
229 Ga0373958_0014922 3300034819 Bacteria 1365
230 Ga0373958_0041697 3300034819 Bacteria 940
231 Ga0373959_0016220 3300034820 Bacteria 1378
232 Ga0373928_0002332 3300035084 Bacteria 3688
233 Ga0373929_0001692 3300035085 Bacteria 4150
234 Ga0373940_0002983 3300035088 Bacteria 3385
235 Ga0373951_0003811 3300035091 Bacteria 3630
236 Ga0373951_0177733 3300035091 Bacteria 610
237 Ga0373952_0002929 3300035092 Bacteria 3086
238 Ga0373932_0000813 3300035112 Bacteria 9235
239 Ga0373939_0140909 3300035114 Bacteria 869
240 Ga0373960_0035692 3300035121 Bacteria 1412
241 Ga0373942_0003893 3300035207 Bacteria 3491
242 Ga0373942_0036657 3300035207 Bacteria 1322
243 Ga0373962_0005560 3300035242 Bacteria 3046
244 Ga0373931_0053083 3300035691 Bacteria 2162
245 Ga0373937_0370438 3300036401 Bacteria 1358
246 Ga0436364_1410231 3300037853 Bacteria 1126
247 Ga0495594_0369255 3300046499 Bacteria 817
248 Ga0495628_1040450 3300046516 Unclassified 562
249 Ga0495642_0526697 3300046528 Bacteria 524
250 Ga0495659_0452323 3300046664 Bacteria 559
251 Ga0495669_0529202 3300046684 Unclassified 573
252 Ga0495600_0758813 3300046809 Bacteria 580
253 Ga0495674_0358229 3300047319 Bacteria 1183
254 Ga0495684_0570211 3300047471 Unclassified 768
255 Ga0496102_1580137 3300048905 Unclassified 574
256 Ga0496103_0986990 3300048906 Bacteria 525
257 Ga0496109_0257955 3300048912 Bacteria 1642
258 Ga0496112_0037846 3300048915 Bacteria 4711
259 Ga0496112_0317587 3300048915 Bacteria 1502
260 nmdc:mga05p37_106226_c1 3300050507 Bacteria 3454
261 nmdc:mga05p37_2297_c1 3300050507 Bacteria 22293
262 nmdc:mga05p37_47768_c1 3300050507 Bacteria 5264
263 nmdc:mga05p37_5923_c1 3300050507 Bacteria 14384
264 nmdc:mga08y16_219275_c1 3300050511 Unclassified 1969
265 nmdc:mga0n895_12570_c1 3300050512 Bacteria 7598
266 nmdc:mga0n895_311758_c1 3300050512 Bacteria 1595
267 nmdc:mga0n895_469626_c1 3300050512 Bacteria 1269
268 nmdc:mga0n895_496851_c1 3300050512 Bacteria 1229
269 nmdc:mga0n895_531837_c1 3300050512 Unclassified 1182
270 nmdc:mga0n895_5374_c1 3300050512 Bacteria 10687
271 nmdc:mga0rr50_16977_c1 3300050513 Bacteria 4849
272 nmdc:mga0rr50_383029_c1 3300050513 Bacteria 1186
273 nmdc:mga0rr50_86559_c1 3300050513 Bacteria 2431
274 nmdc:mga08x19_144235_c1 3300050514 Bacteria 1610
275 nmdc:mga08x19_260501_c1 3300050514 Bacteria 1199
276 nmdc:mga08x19_416905_c1 3300050514 Bacteria 943
277 nmdc:mga08x19_8654_c1 3300050514 Bacteria 6068
278 nmdc:mga08x19_97792_c1 3300050514 Bacteria 1944
279 nmdc:mga0a205_1127930_c1 3300050515 Bacteria 632
280 nmdc:mga0a205_162154_c1 3300050515 Bacteria 2132
281 nmdc:mga0a205_479022_c1 3300050515 Bacteria 1103
282 nmdc:mga0a205_49538_c1 3300050515 Bacteria 4055
283 nmdc:mga0a205_73813_c1 3300050515 Bacteria 3296
284 nmdc:mga09592_1285448_c1
285 Ga0065712_10590399
286 Ga0065715_10417701
287 Ga0065715_10616626
288 Ga0065715_10980029
289 Ga0065707_10315955
290 Ga0070676_10713661
291 Ga0070690_101103608
292 Ga0068869_101753388
293 Ga0070666_11340469
294 Ga0068868_100151961
295 Ga0068868_100307449
296 Ga0070689_100133245
297 Ga0070689_100502521
298 Ga0070689_101774441
299 Ga0070691_10517596
300 Ga0070687_100090675
301 Ga0070692_10260763
302 Ga0070668_100346366
303 Ga0070668_100490447
304 Ga0070669_100296488
305 Ga0070669_100337439
306 Ga0070669_100664589
307 Ga0070669_101305993
308 Ga0070675_100000988
309 Ga0070674_100042023
310 Ga0070673_100030345
311 Ga0070673_100274293
312 Ga0070673_100538300
313 Ga0070688_100118631
314 Ga0070688_100484196
315 Ga0070667_100230802
316 Ga0070710_11056353
317 Ga0070701_11048779
318 Ga0070705_100019586
319 Ga0070705_100238583
320 Ga0070705_101286041
321 Ga0070705_101342905
322 Ga0070694_100031151
323 Ga0070694_100039522
324 Ga0070694_101188135
325 Ga0070694_101819358
326 Ga0070708_100353917
327 Ga0070708_100391270
328 Ga0070663_101449708
329 Ga0070678_101819060
330 Ga0070662_100481961
331 Ga0068867_100277443
332 Ga0068867_101776879
333 Ga0070706_100201517
334 Ga0070706_101203045
335 Ga0070706_101735874
336 Ga0070707_100201482
337 Ga0070698_100079865
338 Ga0070699_100001294
339 Ga0070699_100100136
340 Ga0070699_100277054
341 Ga0070699_100819629
342 Ga0070697_100248040
343 Ga0070697_100394445
344 Ga0070672_100163772
345 Ga0070695_100023455
346 Ga0070695_100358784
347 Ga0070695_100419104
348 Ga0070695_100650339
349 Ga0070696_100514735
350 Ga0070693_100349058
351 Ga0070704_100008291
352 Ga0070704_100013330
353 Ga0070704_100863791
354 Ga0070664_100866680
355 Ga0070664_101916947
356 Ga0068854_100787363
357 Ga0068859_100352421
358 Ga0068859_101949283
359 Ga0068866_10306845
360 Ga0068866_10904891
361 Ga0068861_100033521
362 Ga0068861_100777256
363 Ga0068861_102345010
364 Ga0068861_102361245
365 Ga0068863_100004638
366 Ga0068863_100763325
367 Ga0068858_100989971
368 Ga0068858_101414959
369 Ga0068860_100022174
370 Ga0068860_100602712
371 Ga0068860_100934571
372 Ga0068860_101138420
373 Ga0068862_100053077
374 Ga0068862_100155987
375 Ga0068862_100632499
376 Ga0068862_101338819
377 Ga0068862_101598992
378 Ga0081539_10014399
379 Ga0081539_10500062
380 Ga0070715_10578016
381 Ga0097621_100302611
382 Ga0068871_100278090
383 Ga0068871_100285415
384 Ga0068871_102033055
385 Ga0075428_100664861
386 Ga0075433_10044078
387 Ga0075433_10054636
388 Ga0075433_10057195
389 Ga0075433_10178085
390 Ga0075433_10420441
391 Ga0075434_100001822
392 Ga0075434_100013791
393 Ga0075434_100086445
394 Ga0075434_100418434
395 Ga0075434_100469510
396 Ga0075434_101368392
397 Ga0068865_100682643
398 Ga0075436_100018710
399 Ga0075436_100032972
400 Ga0075436_100339102
401 Ga0075436_100849975
402 Ga0097620_100352446
403 Ga0097620_100853090
404 Ga0097620_101949299
405 Ga0075435_100053614
406 Ga0075435_100074135
407 Ga0075435_100115341
408 Ga0075435_101033579
409 Ga0111539_10151595
410 Ga0111539_11644698
411 Ga0114129_10002259
412 Ga0114129_10003418
413 Ga0114129_10068574
414 Ga0114129_10392709
415 Ga0114129_12066961
416 Ga0105243_10040970
417 Ga0105243_10192602
418 Ga0105248_10051824
419 Ga0105248_10056851
420 Ga0105248_10322023
421 Ga0105248_10710097
422 Ga0105248_10715676
423 Ga0105248_10730509
424 Ga0105248_11573384
425 Ga0105249_10400483
426 Ga0105249_10490789
427 Ga0105249_10846802
428 Ga0105249_11596987
429 Ga0105249_11840805
430 Ga0157324_1007044
431 Ga0157374_12503918
432 Ga0157375_10107254
433 Ga0157375_10172905
434 Ga0163163_10109410
435 Ga0157380_10062832
436 Ga0157380_10148328
437 Ga0157380_10365670
438 Ga0157377_10082808
439 Ga0157379_10015111
440 Ga0157379_10064543
441 Ga0157379_10545044
442 Ga0157379_10634492
443 Ga0157376_10268854
444 Ga0157376_10638206
445 Ga0207653_10143627
446 Ga0207692_10635271
447 Ga0207688_10190292
448 Ga0207646_10075224
449 Ga0207646_10522551
450 Ga0207681_10130354
451 Ga0207681_10249761
452 Ga0207681_11181824
453 Ga0207659_10002508
454 Ga0207644_10925452
455 Ga0207706_10042477
456 Ga0207706_10829691
457 Ga0207706_11322482
458 Ga0207686_10253234
459 Ga0207686_10541074
460 Ga0207686_11548640
461 Ga0207709_10724064
462 Ga0207670_10042520
463 Ga0207670_10084033
464 Ga0207669_10018577
465 Ga0207669_10449672
466 Ga0207704_10229673
467 Ga0207691_10019470
468 Ga0207711_10014297
469 Ga0207711_10047273
470 Ga0207711_10171553
471 Ga0207689_11096735
472 Ga0207651_10032667
473 Ga0207651_10047209
474 Ga0207651_10148106
475 Ga0207651_11282655
476 Ga0207712_10858286
477 Ga0207712_10923570
478 Ga0207668_10459646
479 Ga0207640_11032502
480 Ga0207658_10188334
481 Ga0207658_10259428
482 Ga0207677_10144207
483 Ga0207677_10278903
484 Ga0207703_11160037
485 Ga0207703_11735719
486 Ga0207708_10074419
487 Ga0207708_12012498
488 Ga0207641_10005956
489 Ga0207641_10068705
490 Ga0207641_11440807
491 Ga0207648_10351835
492 Ga0207648_10600735
493 Ga0207648_11650550
494 Ga0207676_11788230
495 Ga0207675_100019748
496 Ga0207675_100553960
497 Ga0207675_100692208
498 Ga0207675_100862067
499 Ga0207675_101735158
500 Ga0207675_102431387
501 Ga0207683_10751463
502 Ga0207428_10044600
503 Ga0268265_10045279
504 Ga0268265_12326820
505 Ga0268264_10050350
506 Ga0268264_10298756
507 Ga0268264_11588333
508 Ga0265760_10250633
509 Ga0265314_10284949
510 Ga0373948_0043490
511 Ga0373950_0001944
512 Ga0373958_0014922
513 Ga0373958_0041697
514 Ga0373959_0016220
515 Ga0373928_0002332
516 Ga0373929_0001692
517 Ga0373940_0002983
518 Ga0373951_0003811
519 Ga0373951_0177733
520 Ga0373952_0002929
521 Ga0373932_0000813
522 Ga0373939_0140909
523 Ga0373960_0035692
524 Ga0373942_0003893
525 Ga0373942_0036657
526 Ga0373962_0005560
527 Ga0373931_0053083
528 Ga0373937_0370438
529 Ga0436364_1410231
530 Ga0495594_0369255
531 Ga0495628_1040450
532 Ga0495642_0526697
533 Ga0495659_0452323
534 Ga0495669_0529202
535 Ga0495600_0758813
536 Ga0495674_0358229
537 Ga0495684_0570211
538 Ga0496102_1580137
539 Ga0496103_0986990
540 Ga0496109_0257955
541 Ga0496112_0037846
542 Ga0496112_0317587
543 nmdc:mga05p37_106226_c1
544 nmdc:mga05p37_2297_c1
545 nmdc:mga05p37_47768_c1
546 nmdc:mga05p37_5923_c1
547 nmdc:mga08y16_219275_c1
548 nmdc:mga0n895_12570_c1
549 nmdc:mga0n895_311758_c1
550 nmdc:mga0n895_469626_c1
551 nmdc:mga0n895_496851_c1
552 nmdc:mga0n895_531837_c1
553 nmdc:mga0n895_5374_c1
554 nmdc:mga0rr50_16977_c1
555 nmdc:mga0rr50_383029_c1
556 nmdc:mga0rr50_86559_c1
557 nmdc:mga08x19_144235_c1
558 nmdc:mga08x19_260501_c1
559 nmdc:mga08x19_416905_c1
560 nmdc:mga08x19_8654_c1
561 nmdc:mga08x19_97792_c1
562 nmdc:mga0a205_1127930_c1
563 nmdc:mga0a205_162154_c1
564 nmdc:mga0a205_479022_c1
565 nmdc:mga0a205_49538_c1
566 nmdc:mga0a205_73813_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cir-assembly1.cif.gz_A the ferm domain of human moesin with a bound peptide identified by phage display 0.7401 64 88
6nsd-assembly1.cif.gz_A tar14, tryptophan c-6 flavin-dependent halogenase (chlorinase) from taromycin biosynthesis 0.7393 66 93
4qgx-assembly3.cif.gz_B-2 crystal structure of the r132k:r111l:l121e mutant of cellular retinoic acid binding proteinii complexed with a synthetic ligand (merocyanine) at 1.47 angstrom resolution 0.6881 53 89
6mop-assembly1.cif.gz_A crystal structure of the all-trans retinal-bound r111k:y134f:t54v:r132q:p39y:r59y:l121e mutant of human cellular retinoic acid binding protein ii in the dark at 1.9 angstrom resolution 0.6759 53 89
6mqi-assembly1.cif.gz_A crystal structure of the all-trans retinal bound r111k:y134f:t54v:r132q:p39y:r59y:l121q mutant of human cellular retinoic acid binding protein ii irradiated with 400 nm laser for 5 minutes at 1.87 angstrom resolution 0.6751 53 89
ID Description Score Start End Superfamily
af_P51673_2_139_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6673 53 89 2.40.128.20
2k7iB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.6404 63 106 3.30.160.160
1eurA00 Mainly Beta;6 Propeller;Neuraminidase; 0.6281 63 89 2.120.10.10
af_A4HUP1_1_315_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.614 63 93 2.115.10.20
2m2uA01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6104 63 93 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A2V8I7N1-F1-model_v4 Uncharacterized protein 0.9512 1 106
AF-A0A382MWZ6-F1-model_v4 Uncharacterized protein 0.9503 1 106
AF-A0A7W1DPB9-F1-model_v4 DUF3194 domain-containing protein 0.9268 1 116
AF-A0A1Q7NAD3-F1-model_v4 Uncharacterized protein 0.9191 1 120
AF-A0A1Q7NAD3-F1-model_v4 Uncharacterized protein 0.9116 1 120

Map