F385793

General Info

Members Datasets Scaffolds Average Seq Length
283 171 566 200

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0157214|Ga0495621_0157214_60_722
Length 220
Sequence MSREIAVWYTLFLLGAYHGINPGMGWLFAVALGMQAGRASAMWRALPPLALGHALSVGVVVALFAGAGVVLPLHLVKVVIAATLVTLGIYRLWRHRHPRFGGMQVGFRDLTIWSFLMASAHGAGLMVVPFVIDTDNSVSALSMHVQHAHRSMASTAMIGTAWTDAMAVGLHSLSYVLVSTLIAWVVYRKLGVAFLRVAWFNLDWLWAGALVITGVLVVLS

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 10.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0157214 3300046539 Bacteria 897
2 JGI24751J29686_10049998 3300002459 Bacteria 862
3 rootL2_10011877 3300003322 Bacteria 1285
4 Ga0065704_10041215 3300005289 Unclassified 902
5 Ga0065712_10068052 3300005290 Bacteria 15852
6 Ga0065715_10375158 3300005293 Unclassified 915
7 Ga0070676_10003447 3300005328 Bacteria 8245
8 Ga0070670_100000980 3300005331 Bacteria 22371
9 Ga0070677_10061546 3300005333 Unclassified 1550
10 Ga0068869_100005489 3300005334 Bacteria 7980
11 Ga0068869_100345972 3300005334 Bacteria 1211
12 Ga0070680_100490413 3300005336 Bacteria 1051
13 Ga0070680_100714973 3300005336 Bacteria 862
14 Ga0070687_100077707 3300005343 Bacteria 1802
15 Ga0070661_100106167 3300005344 Bacteria 2094
16 Ga0070669_100056443 3300005353 Bacteria 2879
17 Ga0070669_100213696 3300005353 Bacteria 1523
18 Ga0070675_100055052 3300005354 Bacteria 3274
19 Ga0070675_100060100 3300005354 Bacteria 3137
20 Ga0070674_100001830 3300005356 Bacteria 11544
21 Ga0070674_100015933 3300005356 Bacteria 4704
22 Ga0070674_100177158 3300005356 Bacteria 1630
23 Ga0070673_100002953 3300005364 Bacteria 10482
24 Ga0070673_100126519 3300005364 Bacteria 2139
25 Ga0070659_100038786 3300005366 Bacteria 3717
26 Ga0070659_100652055 3300005366 Unclassified 908
27 Ga0070667_100090595 3300005367 Bacteria 2629
28 Ga0070701_10107847 3300005438 Bacteria 1552
29 Ga0070701_10133994 3300005438 Bacteria 1410
30 Ga0070705_100001552 3300005440 Bacteria 12035
31 Ga0070700_100060172 3300005441 Bacteria 2393
32 Ga0070694_100076083 3300005444 Bacteria 2323
33 Ga0070678_100000300 3300005456 Bacteria 22954
34 Ga0070662_100001037 3300005457 Bacteria 16977
35 Ga0070681_10047597 3300005458 Bacteria 4287
36 Ga0070707_100007274 3300005468 Bacteria 10279
37 Ga0070697_100668171 3300005536 Bacteria 915
38 Ga0068853_100253460 3300005539 Bacteria 1616
39 Ga0070672_100146980 3300005543 Bacteria 1948
40 Ga0070695_100002130 3300005545 Bacteria 11343
41 Ga0070696_100002590 3300005546 Bacteria 11986
42 Ga0070696_100125451 3300005546 Bacteria 1862
43 Ga0070693_100065969 3300005547 Bacteria 2117
44 Ga0070693_100102063 3300005547 Bacteria 1749
45 Ga0070704_100376517 3300005549 Bacteria 1205
46 Ga0070704_100500802 3300005549 Bacteria 1054
47 Ga0068857_100004943 3300005577 Bacteria 11321
48 Ga0068857_100006042 3300005577 Bacteria 10341
49 Ga0068857_100214713 3300005577 Bacteria 1756
50 Ga0068854_100000918 3300005578 Bacteria 17683
51 Ga0070702_100002263 3300005615 Bacteria 8232
52 Ga0068859_100940034 3300005617 Bacteria 948
53 Ga0068864_100021733 3300005618 Bacteria 5374
54 Ga0068864_100669609 3300005618 Unclassified 1012
55 Ga0068866_10000566 3300005718 Bacteria 16802
56 Ga0068866_10063578 3300005718 Bacteria 1924
57 Ga0068861_100005726 3300005719 Bacteria 8423
58 Ga0068858_100059393 3300005842 Bacteria 3534
59 Ga0068860_100075789 3300005843 Bacteria 3199
60 Ga0068862_100084844 3300005844 Bacteria 2751
61 Ga0068862_100125909 3300005844 Unclassified 2262
62 Ga0075428_100016760 3300006844 Bacteria 8090
63 Ga0075428_100119371 3300006844 Bacteria 2871
64 Ga0075430_100007113 3300006846 Bacteria 9438
65 Ga0075430_100022231 3300006846 Bacteria 5393
66 Ga0075430_100032600 3300006846 Bacteria 4422
67 Ga0075430_100049120 3300006846 Bacteria 3561
68 Ga0075430_100141220 3300006846 Bacteria 2006
69 Ga0075430_100872950 3300006846 Bacteria 741
70 Ga0075431_100006365 3300006847 Bacteria 11721
71 Ga0075431_100062568 3300006847 Bacteria 3839
72 Ga0075431_100104445 3300006847 Bacteria 2924
73 Ga0075431_100160332 3300006847 Bacteria 2313
74 Ga0075431_100255779 3300006847 Bacteria 1778
75 Ga0075431_100320835 3300006847 Bacteria 1562
76 Ga0075433_10060062 3300006852 Bacteria 3328
77 Ga0075433_10487314 3300006852 Bacteria 1086
78 Ga0075434_100024342 3300006871 Bacteria 5918
79 Ga0075429_100001248 3300006880 Bacteria 20643
80 Ga0075429_100097631 3300006880 Bacteria 2563
81 Ga0068865_100006287 3300006881 Bacteria 7232
82 Ga0097620_100940039 3300006931 Bacteria 948
83 Ga0105240_10020723 3300009093 Bacteria 8760
84 Ga0111539_10000040 3300009094 Bacteria 136085
85 Ga0111539_10005554 3300009094 Bacteria 16306
86 Ga0111539_10017076 3300009094 Bacteria 8984
87 Ga0111539_10065807 3300009094 Bacteria 4282
88 Ga0111539_10237254 3300009094 Bacteria 2123
89 Ga0111539_10903390 3300009094 Bacteria 1027
90 Ga0105245_10061713 3300009098 Bacteria 3380
91 Ga0114129_10042456 3300009147 Bacteria 6404
92 Ga0114129_10099492 3300009147 Bacteria 4025
93 Ga0105243_10002652 3300009148 Bacteria 14861
94 Ga0105243_10021941 3300009148 Bacteria 4849
95 Ga0105241_10021686 3300009174 Bacteria 4752
96 Ga0105242_10003873 3300009176 Bacteria 11627
97 Ga0105242_10016435 3300009176 Bacteria 5753
98 Ga0105248_10014431 3300009177 Bacteria 8695
99 Ga0105249_10018058 3300009553 Bacteria 6269
100 Ga0105239_10047579 3300010375 Bacteria 4701
101 Ga0157371_10114783 3300013102 Bacteria 1913
102 Ga0157378_10000730 3300013297 Bacteria 30701
103 Ga0163162_10353236 3300013306 Bacteria 1603
104 Ga0163162_10398967 3300013306 Bacteria 1508
105 Ga0157375_10016583 3300013308 Bacteria 6623
106 Ga0157375_10344423 3300013308 Bacteria 1656
107 Ga0157375_10635925 3300013308 Bacteria 1224
108 Ga0157380_10070422 3300014326 Bacteria 2826
109 Ga0157380_10129782 3300014326 Bacteria 2148
110 Ga0157380_10224361 3300014326 Bacteria 1683
111 Ga0157380_10266857 3300014326 Bacteria 1558
112 Ga0157380_11314318 3300014326 Bacteria 771
113 Ga0157377_10008295 3300014745 Bacteria 5062
114 Ga0157379_10246984 3300014968 Bacteria 1619
115 Ga0157379_10481116 3300014968 Bacteria 1149
116 Ga0157376_10074892 3300014969 Bacteria 2887
117 Ga0224712_10004411 3300022467 Bacteria 3793
118 Ga0207642_10000565 3300025899 Bacteria 11352
119 Ga0207645_10001506 3300025907 Bacteria 19062
120 Ga0207645_10198271 3300025907 Bacteria 1320
121 Ga0207643_10002054 3300025908 Bacteria 11097
122 Ga0207654_10017628 3300025911 Bacteria 3738
123 Ga0207707_10132979 3300025912 Bacteria 2176
124 Ga0207695_10067570 3300025913 Bacteria 3666
125 Ga0207660_10376525 3300025917 Bacteria 1141
126 Ga0207662_10070644 3300025918 Bacteria 2112
127 Ga0207657_10164359 3300025919 Bacteria 1801
128 Ga0207649_10340603 3300025920 Bacteria 1107
129 Ga0207652_10026693 3300025921 Bacteria 4813
130 Ga0207646_10005044 3300025922 Bacteria 14048
131 Ga0207681_10138844 3300025923 Bacteria 1807
132 Ga0207650_10026321 3300025925 Bacteria 4148
133 Ga0207659_10048940 3300025926 Bacteria 2996
134 Ga0207659_10124345 3300025926 Bacteria 1981
135 Ga0207687_10028287 3300025927 Bacteria 3766
136 Ga0207690_10014368 3300025932 Bacteria 4784
137 Ga0207690_10097734 3300025932 Bacteria 2090
138 Ga0207706_10000153 3300025933 Bacteria 75743
139 Ga0207706_10211096 3300025933 Bacteria 1702
140 Ga0207706_10348920 3300025933 Unclassified 1287
141 Ga0207686_10000572 3300025934 Bacteria 23306
142 Ga0207709_10004909 3300025935 Bacteria 7655
143 Ga0207709_10668224 3300025935 Unclassified 829
144 Ga0207670_10360880 3300025936 Bacteria 1153
145 Ga0207704_10743515 3300025938 Unclassified 815
146 Ga0207691_10043515 3300025940 Bacteria 4138
147 Ga0207711_10004388 3300025941 Bacteria 12029
148 Ga0207689_10005128 3300025942 Bacteria 11778
149 Ga0207689_10136034 3300025942 Bacteria 2023
150 Ga0207651_10143692 3300025960 Bacteria 1847
151 Ga0207712_10191680 3300025961 Bacteria 1614
152 Ga0207712_10207915 3300025961 Bacteria 1557
153 Ga0207668_10316102 3300025972 Bacteria 1294
154 Ga0207640_10683125 3300025981 Bacteria 878
155 Ga0207658_10029612 3300025986 Bacteria 3869
156 Ga0207677_10823158 3300026023 Bacteria 832
157 Ga0207703_10018249 3300026035 Bacteria 5479
158 Ga0207648_10000028 3300026089 Bacteria 130116
159 Ga0207648_10027629 3300026089 Bacteria 5036
160 Ga0207676_10085921 3300026095 Unclassified 2568
161 Ga0207674_10008188 3300026116 Bacteria 12115
162 Ga0207674_10149155 3300026116 Bacteria 2296
163 Ga0207674_10306471 3300026116 Bacteria 1537
164 Ga0207674_10574154 3300026116 Bacteria 1089
165 Ga0207675_100002196 3300026118 Bacteria 19385
166 Ga0207675_100054046 3300026118 Bacteria 3747
167 Ga0207675_100309942 3300026118 Bacteria 1539
168 Ga0207683_10003284 3300026121 Bacteria 14100
169 Ga0207698_10237815 3300026142 Bacteria 1658
170 Ga0209971_1019779 3300027682 Unclassified 1599
171 Ga0207428_10001275 3300027907 Bacteria 26957
172 Ga0207428_10001798 3300027907 Bacteria 21966
173 Ga0268265_10182003 3300028380 Bacteria 1806
174 Ga0268265_10275454 3300028380 Bacteria 1503
175 Ga0268265_10280911 3300028380 Bacteria 1490
176 Ga0268265_10598416 3300028380 Bacteria 1053
177 Ga0268264_10011450 3300028381 Bacteria 7324
178 Ga0307408_100099598 3300031548 Bacteria 2212
179 Ga0307405_10277722 3300031731 Bacteria 1259
180 Ga0307407_10345487 3300031903 Bacteria 1052
181 Ga0307409_100038486 3300031995 Bacteria 3538
182 Ga0307416_100079949 3300032002 Bacteria 2757
183 Ga0307411_10065132 3300032005 Bacteria 2443
184 Ga0439450_147350 3300042008 Unclassified 616
185 Ga0439444_0016170 3300042437 Bacteria 1267
186 Ga0439464_0095631 3300042439 Bacteria 899
187 Ga0439460_0075350 3300042461 Bacteria 1051
188 Ga0451577_0029420 3300042876 Bacteria 4965
189 Ga0453684_0773351 3300044712 Bacteria 1038
190 Ga0451576_0032796 3300045051 Bacteria 5523
191 Ga0451576_0948361 3300045051 Unclassified 902
192 Ga0495603_0075195 3300046455 Bacteria 1983
193 Ga0495594_0046110 3300046499 Bacteria 2393
194 Ga0495598_0017349 3300046537 Unclassified 1854
195 Ga0495622_0028917 3300046557 Bacteria 2590
196 Ga0495656_0029162 3300046615 Bacteria 2219
197 Ga0495659_0047156 3300046664 Bacteria 1558
198 Ga0495669_0018208 3300046684 Bacteria 3018
199 Ga0495636_0048367 3300047318 Bacteria 1777
200 Ga0495677_0170279 3300047445 Unclassified 842
201 Ga0495615_0049493 3300048090 Unclassified 1077
202 Ga0496101_0028818 3300048904 Bacteria 3880
203 Ga0496102_0067452 3300048905 Bacteria 3282
204 Ga0496106_0009187 3300048909 Bacteria 7301
205 Ga0496107_0955336 3300048910 Bacteria 623
206 Ga0496109_0297255 3300048912 Bacteria 1522
207 Ga0496114_0028960 3300048917 Bacteria 4549
208 Ga0501036_0050842 3300049572 Bacteria 3510
209 Ga0501036_0197207 3300049572 Bacteria 1694
210 Ga0501038_0292818 3300049574 Bacteria 1279
211 Ga0501039_0161545 3300049575 Bacteria 1761
212 Ga0501039_0238974 3300049575 Bacteria 1428
213 Ga0501040_0115277 3300049576 Bacteria 1881
214 Ga0501040_0148282 3300049576 Bacteria 1654
215 Ga0501040_0547691 3300049576 Bacteria 835
216 Ga0501041_0061512 3300049577 Bacteria 2299
217 Ga0501041_0326190 3300049577 Bacteria 969
218 Ga0501043_0456541 3300049579 Unclassified 959
219 Ga0501046_0141144 3300049580 Bacteria 1823
220 Ga0501046_0658373 3300049580 Unclassified 740
221 Ga0501048_0291938 3300049582 Bacteria 1160
222 Ga0501048_0420073 3300049582 Bacteria 957
223 Ga0501071_0019187 3300049587 Bacteria 4745
224 Ga0501071_0037906 3300049587 Bacteria 3444
225 Ga0501071_0278370 3300049587 Bacteria 1266
226 Ga0501071_0331142 3300049587 Bacteria 1157
227 Ga0501071_0391515 3300049587 Bacteria 1060
228 Ga0501072_0043561 3300049588 Bacteria 3527
229 Ga0501072_0103132 3300049588 Bacteria 2267
230 Ga0501073_0051031 3300049589 Bacteria 2898
231 Ga0501075_0084509 3300049591 Bacteria 2404
232 Ga0501075_0102213 3300049591 Bacteria 2177
233 Ga0501075_0105330 3300049591 Unclassified 2143
234 Ga0501075_0477992 3300049591 Bacteria 950
235 Ga0501076_0050456 3300049592 Bacteria 3292
236 Ga0501076_0073339 3300049592 Bacteria 2741
237 Ga0501076_0118240 3300049592 Bacteria 2145
238 Ga0501076_0134682 3300049592 Unclassified 2005
239 Ga0501076_0326453 3300049592 Bacteria 1259
240 Ga0501077_0277641 3300049593 Bacteria 1066
241 Ga0501079_0054761 3300049741 Bacteria 3077
242 Ga0501079_0184735 3300049741 Unclassified 1627
243 Ga0501079_0301661 3300049741 Bacteria 1253
244 Ga0501080_0522984 3300049742 Bacteria 1058
245 Ga0501080_1084201 3300049742 Unclassified 692
246 Ga0501081_0242048 3300049743 Bacteria 1316
247 Ga0501081_0352944 3300049743 Bacteria 1084
248 Ga0501081_0411373 3300049743 Bacteria 1002
249 Ga0501081_0604708 3300049743 Unclassified 821
250 Ga0501035_0394010 3300049822 Bacteria 1153
251 Ga0501045_0110263 3300049824 Unclassified 2040
252 Ga0501045_0275958 3300049824 Bacteria 1251
253 nmdc:mga05p37_1255354_c1 3300050507 Bacteria 760
254 nmdc:mga05p37_176430_c1 3300050507 Bacteria 2603
255 nmdc:mga05p37_28390_c1 3300050507 Bacteria 6823
256 nmdc:mga09592_141632_c1 3300050508 Bacteria 2073
257 nmdc:mga09592_6391_c1 3300050508 Bacteria 9602
258 nmdc:mga09592_769670_c1 3300050508 Unclassified 816
259 nmdc:mga0qj67_21927_c1 3300050509 Bacteria 4901
260 nmdc:mga0qj67_298590_c1 3300050509 Unclassified 1305
261 nmdc:mga0qj67_3886_c1 3300050509 Bacteria 10795
262 nmdc:mga0qj67_86121_c1 3300050509 Bacteria 2521
263 nmdc:mga0qj67_920817_c1 3300050509 Bacteria 688
264 nmdc:mga06r32_158875_c1 3300050510 Bacteria 2242
265 nmdc:mga06r32_255140_c1 3300050510 Bacteria 1741
266 nmdc:mga06r32_450636_c1 3300050510 Bacteria 1266
267 nmdc:mga06r32_71131_c1 3300050510 Bacteria 3366
268 nmdc:mga06r32_74160_c1 3300050510 Bacteria 3298
269 nmdc:mga06r32_962210_c1 3300050510 Unclassified 808
270 nmdc:mga06r32_96770_c1 3300050510 Bacteria 2891
271 nmdc:mga08y16_159_c2 3300050511 Bacteria 44026
272 nmdc:mga08y16_177496_c1 3300050511 Bacteria 2212
273 nmdc:mga08y16_186719_c1 3300050511 Bacteria 2151
274 nmdc:mga08y16_83_c1 3300050511 Bacteria 80182
275 nmdc:mga0n895_2012577_c1 3300050512 Bacteria 535
276 nmdc:mga0a205_363864_c1 3300050515 Bacteria 1313
277 Ga0501084_0330705 3300054114 Unclassified 1287
278 Ga0501084_0385250 3300054114 Bacteria 1185
279 Ga0501082_0059616 3300060353 Bacteria 3289
280 Ga0501082_0997559 3300060353 Unclassified 732
281 Ga0530510_0013310 3300061734 Bacteria 5783
282 Ga0530510_0037653 3300061734 Bacteria 3490
283 Ga0530510_0126093 3300061734 Bacteria 1882
284 Ga0495621_0157214
285 JGI24751J29686_10049998
286 rootL2_10011877
287 Ga0065704_10041215
288 Ga0065712_10068052
289 Ga0065715_10375158
290 Ga0070676_10003447
291 Ga0070670_100000980
292 Ga0070677_10061546
293 Ga0068869_100005489
294 Ga0068869_100345972
295 Ga0070680_100490413
296 Ga0070680_100714973
297 Ga0070687_100077707
298 Ga0070661_100106167
299 Ga0070669_100056443
300 Ga0070669_100213696
301 Ga0070675_100055052
302 Ga0070675_100060100
303 Ga0070674_100001830
304 Ga0070674_100015933
305 Ga0070674_100177158
306 Ga0070673_100002953
307 Ga0070673_100126519
308 Ga0070659_100038786
309 Ga0070659_100652055
310 Ga0070667_100090595
311 Ga0070701_10107847
312 Ga0070701_10133994
313 Ga0070705_100001552
314 Ga0070700_100060172
315 Ga0070694_100076083
316 Ga0070678_100000300
317 Ga0070662_100001037
318 Ga0070681_10047597
319 Ga0070707_100007274
320 Ga0070697_100668171
321 Ga0068853_100253460
322 Ga0070672_100146980
323 Ga0070695_100002130
324 Ga0070696_100002590
325 Ga0070696_100125451
326 Ga0070693_100065969
327 Ga0070693_100102063
328 Ga0070704_100376517
329 Ga0070704_100500802
330 Ga0068857_100004943
331 Ga0068857_100006042
332 Ga0068857_100214713
333 Ga0068854_100000918
334 Ga0070702_100002263
335 Ga0068859_100940034
336 Ga0068864_100021733
337 Ga0068864_100669609
338 Ga0068866_10000566
339 Ga0068866_10063578
340 Ga0068861_100005726
341 Ga0068858_100059393
342 Ga0068860_100075789
343 Ga0068862_100084844
344 Ga0068862_100125909
345 Ga0075428_100016760
346 Ga0075428_100119371
347 Ga0075430_100007113
348 Ga0075430_100022231
349 Ga0075430_100032600
350 Ga0075430_100049120
351 Ga0075430_100141220
352 Ga0075430_100872950
353 Ga0075431_100006365
354 Ga0075431_100062568
355 Ga0075431_100104445
356 Ga0075431_100160332
357 Ga0075431_100255779
358 Ga0075431_100320835
359 Ga0075433_10060062
360 Ga0075433_10487314
361 Ga0075434_100024342
362 Ga0075429_100001248
363 Ga0075429_100097631
364 Ga0068865_100006287
365 Ga0097620_100940039
366 Ga0105240_10020723
367 Ga0111539_10000040
368 Ga0111539_10005554
369 Ga0111539_10017076
370 Ga0111539_10065807
371 Ga0111539_10237254
372 Ga0111539_10903390
373 Ga0105245_10061713
374 Ga0114129_10042456
375 Ga0114129_10099492
376 Ga0105243_10002652
377 Ga0105243_10021941
378 Ga0105241_10021686
379 Ga0105242_10003873
380 Ga0105242_10016435
381 Ga0105248_10014431
382 Ga0105249_10018058
383 Ga0105239_10047579
384 Ga0157371_10114783
385 Ga0157378_10000730
386 Ga0163162_10353236
387 Ga0163162_10398967
388 Ga0157375_10016583
389 Ga0157375_10344423
390 Ga0157375_10635925
391 Ga0157380_10070422
392 Ga0157380_10129782
393 Ga0157380_10224361
394 Ga0157380_10266857
395 Ga0157380_11314318
396 Ga0157377_10008295
397 Ga0157379_10246984
398 Ga0157379_10481116
399 Ga0157376_10074892
400 Ga0224712_10004411
401 Ga0207642_10000565
402 Ga0207645_10001506
403 Ga0207645_10198271
404 Ga0207643_10002054
405 Ga0207654_10017628
406 Ga0207707_10132979
407 Ga0207695_10067570
408 Ga0207660_10376525
409 Ga0207662_10070644
410 Ga0207657_10164359
411 Ga0207649_10340603
412 Ga0207652_10026693
413 Ga0207646_10005044
414 Ga0207681_10138844
415 Ga0207650_10026321
416 Ga0207659_10048940
417 Ga0207659_10124345
418 Ga0207687_10028287
419 Ga0207690_10014368
420 Ga0207690_10097734
421 Ga0207706_10000153
422 Ga0207706_10211096
423 Ga0207706_10348920
424 Ga0207686_10000572
425 Ga0207709_10004909
426 Ga0207709_10668224
427 Ga0207670_10360880
428 Ga0207704_10743515
429 Ga0207691_10043515
430 Ga0207711_10004388
431 Ga0207689_10005128
432 Ga0207689_10136034
433 Ga0207651_10143692
434 Ga0207712_10191680
435 Ga0207712_10207915
436 Ga0207668_10316102
437 Ga0207640_10683125
438 Ga0207658_10029612
439 Ga0207677_10823158
440 Ga0207703_10018249
441 Ga0207648_10000028
442 Ga0207648_10027629
443 Ga0207676_10085921
444 Ga0207674_10008188
445 Ga0207674_10149155
446 Ga0207674_10306471
447 Ga0207674_10574154
448 Ga0207675_100002196
449 Ga0207675_100054046
450 Ga0207675_100309942
451 Ga0207683_10003284
452 Ga0207698_10237815
453 Ga0209971_1019779
454 Ga0207428_10001275
455 Ga0207428_10001798
456 Ga0268265_10182003
457 Ga0268265_10275454
458 Ga0268265_10280911
459 Ga0268265_10598416
460 Ga0268264_10011450
461 Ga0307408_100099598
462 Ga0307405_10277722
463 Ga0307407_10345487
464 Ga0307409_100038486
465 Ga0307416_100079949
466 Ga0307411_10065132
467 Ga0439450_147350
468 Ga0439444_0016170
469 Ga0439464_0095631
470 Ga0439460_0075350
471 Ga0451577_0029420
472 Ga0453684_0773351
473 Ga0451576_0032796
474 Ga0451576_0948361
475 Ga0495603_0075195
476 Ga0495594_0046110
477 Ga0495598_0017349
478 Ga0495622_0028917
479 Ga0495656_0029162
480 Ga0495659_0047156
481 Ga0495669_0018208
482 Ga0495636_0048367
483 Ga0495677_0170279
484 Ga0495615_0049493
485 Ga0496101_0028818
486 Ga0496102_0067452
487 Ga0496106_0009187
488 Ga0496107_0955336
489 Ga0496109_0297255
490 Ga0496114_0028960
491 Ga0501036_0050842
492 Ga0501036_0197207
493 Ga0501038_0292818
494 Ga0501039_0161545
495 Ga0501039_0238974
496 Ga0501040_0115277
497 Ga0501040_0148282
498 Ga0501040_0547691
499 Ga0501041_0061512
500 Ga0501041_0326190
501 Ga0501043_0456541
502 Ga0501046_0141144
503 Ga0501046_0658373
504 Ga0501048_0291938
505 Ga0501048_0420073
506 Ga0501071_0019187
507 Ga0501071_0037906
508 Ga0501071_0278370
509 Ga0501071_0331142
510 Ga0501071_0391515
511 Ga0501072_0043561
512 Ga0501072_0103132
513 Ga0501073_0051031
514 Ga0501075_0084509
515 Ga0501075_0102213
516 Ga0501075_0105330
517 Ga0501075_0477992
518 Ga0501076_0050456
519 Ga0501076_0073339
520 Ga0501076_0118240
521 Ga0501076_0134682
522 Ga0501076_0326453
523 Ga0501077_0277641
524 Ga0501079_0054761
525 Ga0501079_0184735
526 Ga0501079_0301661
527 Ga0501080_0522984
528 Ga0501080_1084201
529 Ga0501081_0242048
530 Ga0501081_0352944
531 Ga0501081_0411373
532 Ga0501081_0604708
533 Ga0501035_0394010
534 Ga0501045_0110263
535 Ga0501045_0275958
536 nmdc:mga05p37_1255354_c1
537 nmdc:mga05p37_176430_c1
538 nmdc:mga05p37_28390_c1
539 nmdc:mga09592_141632_c1
540 nmdc:mga09592_6391_c1
541 nmdc:mga09592_769670_c1
542 nmdc:mga0qj67_21927_c1
543 nmdc:mga0qj67_298590_c1
544 nmdc:mga0qj67_3886_c1
545 nmdc:mga0qj67_86121_c1
546 nmdc:mga0qj67_920817_c1
547 nmdc:mga06r32_158875_c1
548 nmdc:mga06r32_255140_c1
549 nmdc:mga06r32_450636_c1
550 nmdc:mga06r32_71131_c1
551 nmdc:mga06r32_74160_c1
552 nmdc:mga06r32_962210_c1
553 nmdc:mga06r32_96770_c1
554 nmdc:mga08y16_159_c2
555 nmdc:mga08y16_177496_c1
556 nmdc:mga08y16_186719_c1
557 nmdc:mga08y16_83_c1
558 nmdc:mga0n895_2012577_c1
559 nmdc:mga0a205_363864_c1
560 Ga0501084_0330705
561 Ga0501084_0385250
562 Ga0501082_0059616
563 Ga0501082_0997559
564 Ga0530510_0013310
565 Ga0530510_0037653
566 Ga0530510_0126093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aps-assembly1.cif.gz_B crystal structure of a pot family peptide transporter in an inward open conformation. 0.4465 4 201
6g9x-assembly1.cif.gz_A crystal structure of a mfs transporter at 2.54 angstroem resolution 0.425 6 198
4aps-assembly1.cif.gz_B crystal structure of a pot family peptide transporter in an inward open conformation. 0.4197 4 201
4jre-assembly1.cif.gz_A crystal structure of nitrate/nitrite exchanger nark with nitrite bound 0.3955 3 198
4jre-assembly1.cif.gz_A crystal structure of nitrate/nitrite exchanger nark with nitrite bound 0.3882 3 198
ID Description Score Start End Superfamily
af_Q8N468_19_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4819 6 200 1.20.1250.20
af_C0RSI9_6_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4696 4 197 1.20.1250.20
af_Q0D566_20_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4618 1 201 1.20.1250.20
af_Q0D566_20_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4601 1 201 1.20.1250.20
af_A3QMB7_11_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4537 6 199 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2E0D446-F1-model_v4 deleted 0.7539 19 199
AF-A0A2E0D446-F1-model_v4 deleted 0.7428 19 199
AF-A0A1C9W3J1-F1-model_v4 HupE / UreJ protein 0.7192 3 198 GO:0016020
AF-A0A560ATA1-F1-model_v4 deleted 0.705 3 199
AF-A0A6N8YV81-F1-model_v4 Uncharacterized protein 0.7032 5 200 GO:0016020

Map