F385786

General Info

Members Datasets Scaffolds Average Seq Length
283 199 566 299

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0041319|Ga0495631_0041319_256_1125
Length 289
Sequence MRIAVTGSSGLIGSALVRSLRTDGHEAVRLVRSEPSAPDEVRWDPDRQYVDTAGLIGCDAVVHLAGAGVGDHRWTAAYKKQIRESRVLGTAAIAEAVASMATPPRVLISGSGVNFYGDTGDRAVDEKDPPGEAWEEATGAAEEAGVRTAHVRTGLVVARHGGAWGRLFPLYKAGLGGRLGNGRQYWSFIALHDHIAALRHIIDTPALSGPVNLTGPGPITNREVNAAMARVLRRPGLFAVPAPVLKAVLGEFADDVLGSFRVRPAKLLDSGFAFAFPEIDGAIRAALGR

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
13 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
14 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
22 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
23 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
24 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
25 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
26 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
31 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
32 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
33 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
39 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
40 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
41 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
42 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
43 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
44 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
45 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
46 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
47 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
48 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
49 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
50 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
51 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
52 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
53 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
56 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
57 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
58 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
59 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
60 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
63 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
64 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
65 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
66 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
69 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
79 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
80 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
86 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
87 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
95 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
96 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
130 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
131 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
132 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
133 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
134 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
135 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
136 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
139 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
140 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
145 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
146 2643221548 Streptomyces sp. Root55 Isolate Unclassified
147 2643221578 Streptomyces sp. Root63 Isolate Unclassified
148 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
149 2643221647 Streptomyces sp. Root369 Isolate Unclassified
150 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
151 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
152 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
153 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
154 2643221714 Streptomyces sp. Root264 Isolate Unclassified
155 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
156 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
157 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
158 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
159 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
160 2808606448 Streptomyces sp. 193411 Isolate Unclassified
161 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
162 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
163 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
164 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
165 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
166 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
167 2862574272 Streptomyces sp. AcE210 Isolate Nodule
168 2867369537 Streptomyces sp. Z26 Isolate Unclassified
169 2867428634 Streptomyces sp. RP5T Isolate Unclassified
170 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
171 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
172 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
173 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
174 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
175 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
176 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
177 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
178 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
179 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
180 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
181 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
182 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
183 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
184 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
185 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
186 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
187 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
188 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
189 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
190 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
191 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
192 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
193 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
194 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
195 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
196 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
197 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
198 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
199 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.15
Metatranscriptomes 1.06
Isolates 19.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0.35
Rhizoplane 0.71
Rhizosphere 74.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0041319 3300046518 Bacteria 2041
2 JGI24739J22299_10027646 3300001989 Bacteria 1981
3 rootH1_10102839 3300003316 Bacteria 2306
4 rootH2_10276058 3300003320 Bacteria 1563
5 rootL2_10043052 3300003322 Bacteria 3391
6 rootL2_10052221 3300003322 Bacteria 3354
7 rootL2_10052225 3300003322 Bacteria 4490
8 rootH1_10008481 3300003323 Bacteria 10577
9 rootH1_10035552 3300003323 Bacteria 2704
10 Ga0006562J51391_1063125 3300003578 Bacteria 2890
11 Ga0006562J51391_1145300 3300003578 Bacteria 3060
12 Ga0006562J51391_1145301 3300003578 Bacteria 3080
13 Ga0075365_10051494 3300006038 Bacteria 2720
14 Ga0075367_10105386 3300006178 Bacteria 1727
15 Ga0105243_10480854 3300009148 Bacteria 1172
16 Ga0105246_10216855 3300011119 Bacteria 1497
17 Ga0182008_10000719 3300014497 Bacteria 23643
18 Ga0182006_1025666 3300015261 Bacteria 2418
19 Ga0182007_10003209 3300015262 Bacteria 7795
20 Ga0182007_10005305 3300015262 Bacteria 5684
21 Ga0183367_1009 3300015688 Bacteria 484598
22 Ga0207426_1009379 3300025302 Bacteria 3875
23 Ga0307517_10007628 3300028786 Bacteria 15732
24 Ga0307515_10053417 3300028794 Bacteria 5962
25 Ga0307512_10001818 3300030522 Bacteria 28729
26 Ga0307513_10010927 3300031456 Bacteria 11332
27 Ga0307513_10195948 3300031456 Bacteria 1866
28 Ga0307508_10003792 3300031616 Bacteria 15089
29 Ga0307508_10005802 3300031616 Bacteria 11666
30 Ga0307508_10019770 3300031616 Bacteria 6119
31 Ga0307508_10115954 3300031616 Bacteria 2280
32 Ga0307514_10001909 3300031649 Bacteria 22901
33 Ga0307514_10101635 3300031649 Bacteria 2063
34 Ga0307516_10010484 3300031730 Bacteria 10178
35 Ga0307516_10044961 3300031730 Bacteria 4365
36 Ga0307516_10246702 3300031730 Bacteria 1482
37 Ga0307507_10130940 3300033179 Bacteria 1963
38 Ga0307510_10069355 3300033180 Bacteria 3531
39 Ga0395900_0422289 3300037418 Bacteria 1294
40 Ga0395898_0088538 3300037466 Bacteria 2980
41 Ga0451807_2030142 3300041486 Bacteria 1244
42 Ga0451853_1201933 3300041512 Bacteria 1362
43 Ga0439449_0000259 3300042007 Bacteria 19011
44 Ga0450906_000960 3300042145 Bacteria 6321
45 Ga0466969_0004581 3300044656 Bacteria 7364
46 Ga0466972_0024667 3300044658 Bacteria 2984
47 Ga0466965_0026908 3300044683 Bacteria 2789
48 Ga0466966_0004318 3300044684 Bacteria 9370
49 Ga0466961_0004538 3300044693 Bacteria 8708
50 Ga0466963_0001054 3300044694 Bacteria 14344
51 Ga0466970_0026780 3300044765 Bacteria 3022
52 Ga0495617_070611 3300046452 Bacteria 1148
53 Ga0495627_055119 3300046453 Bacteria 1187
54 Ga0495592_0054183 3300046454 Bacteria 2972
55 Ga0495603_0001559 3300046455 Bacteria 13411
56 Ga0495603_0002320 3300046455 Bacteria 11164
57 Ga0495603_0009172 3300046455 Bacteria 5978
58 Ga0495603_0028142 3300046455 Bacteria 3390
59 Ga0495590_0058688 3300046457 Bacteria 1346
60 Ga0495629_0008050 3300046459 Bacteria 7759
61 Ga0495629_0029938 3300046459 Bacteria 3859
62 Ga0495638_0009772 3300046460 Bacteria 6700
63 Ga0495638_0027542 3300046460 Bacteria 3678
64 Ga0495638_0139113 3300046460 Bacteria 1419
65 Ga0495638_0196935 3300046460 Bacteria 1140
66 Ga0495651_0011036 3300046462 Bacteria 6952
67 Ga0495651_0012134 3300046462 Bacteria 6632
68 Ga0495580_0041733 3300046472 Bacteria 3271
69 Ga0495639_0015911 3300046475 Bacteria 3262
70 Ga0495662_0005461 3300046476 Bacteria 6363
71 Ga0495664_0115609 3300046477 Bacteria 1621
72 Ga0495585_0025121 3300046492 Bacteria 3415
73 Ga0495585_0102752 3300046492 Bacteria 1527
74 Ga0495594_0005844 3300046499 Bacteria 6320
75 Ga0495594_0009804 3300046499 Bacteria 4960
76 Ga0495594_0094880 3300046499 Bacteria 1674
77 Ga0495607_0031929 3300046501 Bacteria 3220
78 Ga0495583_0028341 3300046506 Bacteria 2754
79 Ga0495608_0004251 3300046511 Bacteria 10260
80 Ga0495610_0100480 3300046512 Bacteria 1297
81 Ga0495616_0071085 3300046513 Bacteria 1683
82 Ga0495620_0016160 3300046515 Bacteria 3754
83 Ga0495628_0008357 3300046516 Bacteria 8886
84 Ga0495628_0043572 3300046516 Bacteria 3573
85 Ga0495631_0016122 3300046518 Bacteria 3570
86 Ga0495632_0009736 3300046519 Bacteria 5761
87 Ga0495632_0119459 3300046519 Bacteria 1233
88 Ga0495643_0004674 3300046522 Bacteria 9509
89 Ga0495643_0013191 3300046522 Bacteria 4957
90 Ga0495648_0102072 3300046524 Bacteria 1581
91 Ga0495666_0001342 3300046526 Bacteria 11923
92 Ga0495666_0069241 3300046526 Bacteria 1679
93 Ga0495652_0009568 3300046529 Bacteria 8800
94 Ga0495652_0066410 3300046529 Bacteria 3027
95 Ga0495654_0065707 3300046530 Bacteria 1731
96 Ga0495665_0007805 3300046531 Bacteria 5791
97 Ga0495586_0069725 3300046535 Bacteria 1919
98 Ga0495609_0110198 3300046538 Bacteria 1188
99 Ga0495597_0068267 3300046542 Bacteria 1536
100 Ga0495622_0015560 3300046557 Bacteria 3536
101 Ga0495622_0038110 3300046557 Bacteria 2238
102 Ga0495667_0007895 3300046559 Bacteria 7212
103 Ga0495668_0014026 3300046616 Bacteria 4710
104 Ga0495634_0017777 3300046642 Bacteria 5070
105 Ga0495634_0044620 3300046642 Bacteria 2999
106 Ga0495611_0014531 3300046648 Bacteria 3364
107 Ga0495625_0074336 3300046660 Bacteria 2381
108 Ga0495625_0110839 3300046660 Bacteria 1876
109 Ga0495588_0005811 3300046674 Bacteria 5520
110 Ga0495588_0028406 3300046674 Bacteria 2799
111 Ga0495657_0008686 3300046675 Bacteria 7755
112 Ga0495657_0013970 3300046675 Bacteria 5898
113 Ga0495599_0063043 3300046678 Bacteria 2315
114 Ga0495623_0010335 3300046679 Bacteria 6040
115 Ga0495646_0003752 3300046680 Bacteria 9496
116 Ga0495613_0078170 3300046689 Bacteria 2407
117 Ga0495613_0222736 3300046689 Bacteria 1324
118 Ga0495670_0082965 3300046691 Bacteria 1634
119 Ga0495649_0086849 3300046694 Bacteria 1669
120 Ga0495589_0010209 3300046794 Bacteria 4879
121 Ga0495589_0068180 3300046794 Bacteria 1740
122 Ga0495589_0112057 3300046794 Bacteria 1316
123 Ga0495600_0042906 3300046809 Bacteria 2949
124 Ga0495660_0121023 3300046810 Bacteria 1324
125 Ga0495660_0174196 3300046810 Bacteria 1046
126 Ga0495581_0065906 3300047315 Bacteria 2094
127 Ga0495581_0069208 3300047315 Bacteria 2041
128 Ga0495581_0116402 3300047315 Bacteria 1554
129 Ga0495604_0000970 3300047317 Bacteria 23925
130 Ga0495604_0019233 3300047317 Bacteria 5468
131 Ga0495604_0033413 3300047317 Bacteria 4072
132 Ga0495636_0009309 3300047318 Bacteria 3866
133 Ga0495636_0083256 3300047318 Bacteria 1380
134 Ga0495636_0086359 3300047318 Bacteria 1357
135 Ga0495674_0119960 3300047319 Bacteria 2222
136 Ga0495676_0019853 3300047321 Bacteria 5905
137 Ga0495676_0025167 3300047321 Bacteria 5142
138 Ga0495687_029368 3300047443 Bacteria 2546
139 Ga0495687_063279 3300047443 Bacteria 1515
140 Ga0495687_072881 3300047443 Bacteria 1370
141 Ga0495675_0021575 3300047444 Bacteria 4102
142 Ga0495679_046146 3300047446 Bacteria 1328
143 Ga0495685_000391 3300047447 Bacteria 13923
144 Ga0495685_007705 3300047447 Bacteria 3560
145 Ga0495685_017392 3300047447 Bacteria 2462
146 Ga0495685_024583 3300047447 Bacteria 2073
147 Ga0495685_037391 3300047447 Bacteria 1664
148 Ga0495681_0000674 3300047470 Bacteria 25911
149 Ga0495684_0018996 3300047471 Bacteria 5291
150 Ga0495593_0091992 3300047673 Bacteria 1561
151 Ga0495626_0138989 3300048091 Bacteria 1031
152 Ga0501031_0183101 3300049568 Bacteria 1368
153 Ga0501032_0007678 3300049569 Bacteria 7862
154 Ga0501032_0010088 3300049569 Bacteria 6818
155 Ga0501033_0000846 3300049570 Bacteria 27929
156 Ga0501033_0010782 3300049570 Bacteria 7008
157 Ga0501033_0102674 3300049570 Bacteria 2085
158 Ga0501034_0017073 3300049571 Bacteria 7444
159 Ga0501034_0040935 3300049571 Bacteria 4688
160 Ga0501034_0113720 3300049571 Bacteria 2696
161 Ga0501036_0002328 3300049572 Bacteria 14856
162 Ga0501036_0134640 3300049572 Bacteria 2085
163 Ga0501037_0005298 3300049573 Bacteria 9382
164 Ga0501037_0029805 3300049573 Bacteria 4031
165 Ga0501038_0002610 3300049574 Bacteria 16857
166 Ga0501038_0110676 3300049574 Bacteria 2275
167 Ga0501038_0413738 3300049574 Bacteria 1041
168 Ga0501039_0001121 3300049575 Bacteria 19691
169 Ga0501039_0039292 3300049575 Bacteria 3654
170 Ga0501039_0049207 3300049575 Bacteria 3259
171 Ga0501039_0183202 3300049575 Bacteria 1647
172 Ga0501041_0001245 3300049577 Bacteria 13953
173 Ga0501042_0036880 3300049578 Bacteria 3468
174 Ga0501042_0262723 3300049578 Bacteria 1246
175 Ga0501043_0010868 3300049579 Bacteria 7129
176 Ga0501043_0018053 3300049579 Bacteria 5533
177 Ga0501043_0060069 3300049579 Bacteria 2983
178 Ga0501046_0008449 3300049580 Bacteria 8981
179 Ga0501046_0014002 3300049580 Bacteria 6774
180 Ga0501046_0204821 3300049580 Bacteria 1467
181 Ga0501047_0020903 3300049581 Bacteria 6287
182 Ga0501047_0021377 3300049581 Bacteria 6210
183 Ga0501047_0050431 3300049581 Bacteria 4019
184 Ga0501047_0251580 3300049581 Bacteria 1615
185 Ga0501048_0003336 3300049582 Bacteria 12216
186 Ga0501048_0096036 3300049582 Bacteria 2090
187 Ga0501067_0036173 3300049583 Bacteria 2742
188 Ga0501068_0068908 3300049584 Bacteria 2156
189 Ga0501068_0092899 3300049584 Bacteria 1863
190 Ga0501069_0104122 3300049585 Bacteria 1612
191 Ga0501070_0002036 3300049586 Bacteria 17774
192 Ga0501070_0036027 3300049586 Bacteria 4131
193 Ga0501071_0001291 3300049587 Bacteria 14255
194 Ga0501072_0003727 3300049588 Bacteria 11499
195 Ga0501073_0076831 3300049589 Bacteria 2324
196 Ga0501074_0004225 3300049590 Bacteria 10257
197 Ga0501076_0037785 3300049592 Bacteria 3789
198 Ga0501080_0094083 3300049742 Bacteria 2783
199 Ga0501083_0003180 3300049744 Bacteria 11433
200 Ga0501035_0000524 3300049822 Bacteria 43227
201 Ga0501035_0023677 3300049822 Bacteria 5635
202 Ga0501035_0033885 3300049822 Bacteria 4642
203 Ga0501035_0045908 3300049822 Bacteria 3930
204 Ga0501044_0003267 3300049823 Bacteria 18242
205 Ga0501044_0019692 3300049823 Bacteria 7211
206 Ga0501044_0039685 3300049823 Bacteria 4909
207 Ga0501044_0087796 3300049823 Bacteria 3140
208 Ga0501044_0127736 3300049823 Bacteria 2539
209 Ga0501044_0196318 3300049823 Bacteria 1978
210 Ga0501044_0214818 3300049823 Bacteria 1876
211 Ga0501045_0145555 3300049824 Bacteria 1762
212 Ga0495619_0066046 3300053085 Bacteria 2414
213 Ga0500578_0028525 3300053086 Bacteria 3584
214 Ga0500566_0021672 3300053094 Bacteria 3777
215 Ga0500556_0033096 3300053104 Bacteria 1771
216 Ga0500560_006218 3300053107 Bacteria 2714
217 Ga0500652_004268 3300053131 Bacteria 4412
218 Ga0500658_0000859 3300053134 Bacteria 12465
219 Ga0500561_0001353 3300053137 Bacteria 3981
220 Ga0500600_0003305 3300053149 Bacteria 9284
221 Ga0500616_0007293 3300053153 Bacteria 7052
222 Ga0500633_0001614 3300053160 Bacteria 4343
223 Ga0500634_0039914 3300053161 Bacteria 2551
224 Ga0500656_002383 3300053732 Bacteria 1697
225 Ga0501084_0138404 3300054114 Bacteria 2049
226 Ga0501082_0008292 3300060353 Bacteria 8960
227 Ga0530510_0064670 3300061734 Bacteria 2649
228 2616694360 2616644814 Bacteria 11555299
229 2616899505 2616644941 Bacteria 8510691
230 2643759376 2643221548 Bacteria 8053412
231 2643897445 2643221578 Bacteria 9213798
232 2643945077 2643221587 Bacteria 7586415
233 2644265462 2643221647 Bacteria 10741251
234 2644408589 2643221673 Bacteria 9196637
235 2644431976 2643221677 Bacteria 7584031
236 2644435855 2643221678 Bacteria 9540101
237 2644463208 2643221682 Bacteria 6743283
238 2644632257 2643221714 Bacteria 9015452
239 2785344869 2784746763 Bacteria 9783172
240 2785368011 2784746768 Bacteria 10036182
241 2793981846 2791355406 Bacteria 11364898
242 2808840667 2808606359 Bacteria 9866990
243 2808919258 2808606375 Bacteria 9466072
244 2809231030 2808606448 Bacteria 8656184
245 2811847673 2808606982 Bacteria 7791042
246 2812481643 2811994917 Bacteria 7761064
247 2819694048 2818991463 Bacteria 7948711
248 2862288598 2862281513 Bacteria 9621493
249 2862290692 2862290372 Bacteria 7471434
250 2862511448 2862507626 Bacteria 9425308
251 2862582867 2862574272 Bacteria 10567477
252 2867370701 2867369537 Bacteria 6501581
253 2867432330 2867428634 Bacteria 9590268
254 2873156946 2873151551 Bacteria 8625867
255 2875393390 2875391855 Bacteria 7600475
256 2877682532 2877676314 Bacteria 9512378
257 2912721562 2912715099 Bacteria 9460473
258 2918503269 2918501144 Bacteria 8668083
259 2919468217 2919468124 Bacteria 9133025
260 2935395730 2935390628 Bacteria 7043367
261 2946051303 2946045630 Bacteria 8527308
262 2946074660 2946072368 Bacteria 8999607
263 2954387730 2954380949 Bacteria 10050426
264 2954698541 2954691527 Bacteria 10720516
265 2954703683 2954701450 Bacteria 10834262
266 2966603672 2966598605 Bacteria 7676064
267 2990062604 2990059506 Bacteria 9321252
268 2990092117 2990088156 Bacteria 6657676
269 3006397436 3006393351 Bacteria 6615579
270 3006427667 3006425503 Bacteria 6491253
271 3006487305 3006486233 Bacteria 8157040
272 3006495620 3006493962 Bacteria 8825450
273 8008580008 8008574985 Bacteria 7815457
274 8025481790 8025478263 Bacteria 8209203
275 8025537024 8025530807 Bacteria 8495698
276 8047899549 8047893842 Bacteria 11723082
277 8048136175 8048127548 Bacteria 11053136
278 8048359381 8048356638 Bacteria 11044339
279 8048376499 8048369669 Bacteria 11666822
280 8048385552 8048379754 Bacteria 11877923
281 8048408973 8048406513 Bacteria 8936924
282 8056450594 8056447290 Bacteria 7680491
283 8056836510 8056829672 Bacteria 9045328
284 Ga0495631_0041319
285 JGI24739J22299_10027646
286 rootH1_10102839
287 rootH2_10276058
288 rootL2_10043052
289 rootL2_10052221
290 rootL2_10052225
291 rootH1_10008481
292 rootH1_10035552
293 Ga0006562J51391_1063125
294 Ga0006562J51391_1145300
295 Ga0006562J51391_1145301
296 Ga0075365_10051494
297 Ga0075367_10105386
298 Ga0105243_10480854
299 Ga0105246_10216855
300 Ga0182008_10000719
301 Ga0182006_1025666
302 Ga0182007_10003209
303 Ga0182007_10005305
304 Ga0183367_1009
305 Ga0207426_1009379
306 Ga0307517_10007628
307 Ga0307515_10053417
308 Ga0307512_10001818
309 Ga0307513_10010927
310 Ga0307513_10195948
311 Ga0307508_10003792
312 Ga0307508_10005802
313 Ga0307508_10019770
314 Ga0307508_10115954
315 Ga0307514_10001909
316 Ga0307514_10101635
317 Ga0307516_10010484
318 Ga0307516_10044961
319 Ga0307516_10246702
320 Ga0307507_10130940
321 Ga0307510_10069355
322 Ga0395900_0422289
323 Ga0395898_0088538
324 Ga0451807_2030142
325 Ga0451853_1201933
326 Ga0439449_0000259
327 Ga0450906_000960
328 Ga0466969_0004581
329 Ga0466972_0024667
330 Ga0466965_0026908
331 Ga0466966_0004318
332 Ga0466961_0004538
333 Ga0466963_0001054
334 Ga0466970_0026780
335 Ga0495617_070611
336 Ga0495627_055119
337 Ga0495592_0054183
338 Ga0495603_0001559
339 Ga0495603_0002320
340 Ga0495603_0009172
341 Ga0495603_0028142
342 Ga0495590_0058688
343 Ga0495629_0008050
344 Ga0495629_0029938
345 Ga0495638_0009772
346 Ga0495638_0027542
347 Ga0495638_0139113
348 Ga0495638_0196935
349 Ga0495651_0011036
350 Ga0495651_0012134
351 Ga0495580_0041733
352 Ga0495639_0015911
353 Ga0495662_0005461
354 Ga0495664_0115609
355 Ga0495585_0025121
356 Ga0495585_0102752
357 Ga0495594_0005844
358 Ga0495594_0009804
359 Ga0495594_0094880
360 Ga0495607_0031929
361 Ga0495583_0028341
362 Ga0495608_0004251
363 Ga0495610_0100480
364 Ga0495616_0071085
365 Ga0495620_0016160
366 Ga0495628_0008357
367 Ga0495628_0043572
368 Ga0495631_0016122
369 Ga0495632_0009736
370 Ga0495632_0119459
371 Ga0495643_0004674
372 Ga0495643_0013191
373 Ga0495648_0102072
374 Ga0495666_0001342
375 Ga0495666_0069241
376 Ga0495652_0009568
377 Ga0495652_0066410
378 Ga0495654_0065707
379 Ga0495665_0007805
380 Ga0495586_0069725
381 Ga0495609_0110198
382 Ga0495597_0068267
383 Ga0495622_0015560
384 Ga0495622_0038110
385 Ga0495667_0007895
386 Ga0495668_0014026
387 Ga0495634_0017777
388 Ga0495634_0044620
389 Ga0495611_0014531
390 Ga0495625_0074336
391 Ga0495625_0110839
392 Ga0495588_0005811
393 Ga0495588_0028406
394 Ga0495657_0008686
395 Ga0495657_0013970
396 Ga0495599_0063043
397 Ga0495623_0010335
398 Ga0495646_0003752
399 Ga0495613_0078170
400 Ga0495613_0222736
401 Ga0495670_0082965
402 Ga0495649_0086849
403 Ga0495589_0010209
404 Ga0495589_0068180
405 Ga0495589_0112057
406 Ga0495600_0042906
407 Ga0495660_0121023
408 Ga0495660_0174196
409 Ga0495581_0065906
410 Ga0495581_0069208
411 Ga0495581_0116402
412 Ga0495604_0000970
413 Ga0495604_0019233
414 Ga0495604_0033413
415 Ga0495636_0009309
416 Ga0495636_0083256
417 Ga0495636_0086359
418 Ga0495674_0119960
419 Ga0495676_0019853
420 Ga0495676_0025167
421 Ga0495687_029368
422 Ga0495687_063279
423 Ga0495687_072881
424 Ga0495675_0021575
425 Ga0495679_046146
426 Ga0495685_000391
427 Ga0495685_007705
428 Ga0495685_017392
429 Ga0495685_024583
430 Ga0495685_037391
431 Ga0495681_0000674
432 Ga0495684_0018996
433 Ga0495593_0091992
434 Ga0495626_0138989
435 Ga0501031_0183101
436 Ga0501032_0007678
437 Ga0501032_0010088
438 Ga0501033_0000846
439 Ga0501033_0010782
440 Ga0501033_0102674
441 Ga0501034_0017073
442 Ga0501034_0040935
443 Ga0501034_0113720
444 Ga0501036_0002328
445 Ga0501036_0134640
446 Ga0501037_0005298
447 Ga0501037_0029805
448 Ga0501038_0002610
449 Ga0501038_0110676
450 Ga0501038_0413738
451 Ga0501039_0001121
452 Ga0501039_0039292
453 Ga0501039_0049207
454 Ga0501039_0183202
455 Ga0501041_0001245
456 Ga0501042_0036880
457 Ga0501042_0262723
458 Ga0501043_0010868
459 Ga0501043_0018053
460 Ga0501043_0060069
461 Ga0501046_0008449
462 Ga0501046_0014002
463 Ga0501046_0204821
464 Ga0501047_0020903
465 Ga0501047_0021377
466 Ga0501047_0050431
467 Ga0501047_0251580
468 Ga0501048_0003336
469 Ga0501048_0096036
470 Ga0501067_0036173
471 Ga0501068_0068908
472 Ga0501068_0092899
473 Ga0501069_0104122
474 Ga0501070_0002036
475 Ga0501070_0036027
476 Ga0501071_0001291
477 Ga0501072_0003727
478 Ga0501073_0076831
479 Ga0501074_0004225
480 Ga0501076_0037785
481 Ga0501080_0094083
482 Ga0501083_0003180
483 Ga0501035_0000524
484 Ga0501035_0023677
485 Ga0501035_0033885
486 Ga0501035_0045908
487 Ga0501044_0003267
488 Ga0501044_0019692
489 Ga0501044_0039685
490 Ga0501044_0087796
491 Ga0501044_0127736
492 Ga0501044_0196318
493 Ga0501044_0214818
494 Ga0501045_0145555
495 Ga0495619_0066046
496 Ga0500578_0028525
497 Ga0500566_0021672
498 Ga0500556_0033096
499 Ga0500560_006218
500 Ga0500652_004268
501 Ga0500658_0000859
502 Ga0500561_0001353
503 Ga0500600_0003305
504 Ga0500616_0007293
505 Ga0500633_0001614
506 Ga0500634_0039914
507 Ga0500656_002383
508 Ga0501084_0138404
509 Ga0501082_0008292
510 Ga0530510_0064670
511 2616694360
512 2616899505
513 2643759376
514 2643897445
515 2643945077
516 2644265462
517 2644408589
518 2644431976
519 2644435855
520 2644463208
521 2644632257
522 2785344869
523 2785368011
524 2793981846
525 2808840667
526 2808919258
527 2809231030
528 2811847673
529 2812481643
530 2819694048
531 2862288598
532 2862290692
533 2862511448
534 2862582867
535 2867370701
536 2867432330
537 2873156946
538 2875393390
539 2877682532
540 2912721562
541 2918503269
542 2919468217
543 2935395730
544 2946051303
545 2946074660
546 2954387730
547 2954698541
548 2954703683
549 2966603672
550 2990062604
551 2990092117
552 3006397436
553 3006427667
554 3006487305
555 3006495620
556 8008580008
557 8025481790
558 8025537024
559 8047899549
560 8048136175
561 8048359381
562 8048376499
563 8048385552
564 8048408973
565 8056450594
566 8056836510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08338

DUF1731

Domain of unknown function (DUF1731)

240

286

0.98

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

214

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z2g-assembly1.cif.gz_A crystal structure of l-amino acid oxidase from venom of naja atra 0.936 3 33
4b4o-assembly6.cif.gz_F crystal structure of human epimerase family protein sdr39u1 (isoform2) with nadph 0.9294 5 299
4b4o-assembly6.cif.gz_F crystal structure of human epimerase family protein sdr39u1 (isoform2) with nadph 0.9173 5 299
3oh8-assembly1.cif.gz_A crystal structure of the nucleoside-diphosphate sugar epimerase from corynebacterium glutamicum. northeast structural genomics consortium target cgr91 0.8718 2 302
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8335 4 303
ID Description Score Start End Superfamily
af_K7K156_39_177_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9731 4 34 3.40.50.720
af_P9WGP7_2_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 3 286 3.40.50.720
af_Q54W18_55_395_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9455 6 296 3.40.50.720
af_P9WGP7_2_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 3 286 3.40.50.720
af_P77775_2_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9264 6 297 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1E5PQD1-F1-model_v4 TIGR01777 family protein 0.9791 5 297
AF-A0A3R9STC3-F1-model_v4 TIGR01777 family protein 0.9774 1 297
AF-A0A6N9W1G8-F1-model_v4 deleted 0.9774 151 297
AF-A0A5D0V532-F1-model_v4 TIGR01777 family protein 0.9752 5 297
AF-A0A455V3Y5-F1-model_v4 deleted 0.9751 180 296

Map