F385767

General Info

Members Datasets Scaffolds Average Seq Length
283 200 566 200

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0095262|Ga0466967_0095262_473_1198
Length 241
Sequence VTGFVLGSASPARLQVLRAAGLDPVVRISEVDEDAVAAALPPDTPPAGVVTALATAKAHTVAAALIADAAASGHGPAAPDSYGIVTARAPRLVDDCVVVGCDSMLLVGGVLQGKPHTPDVARARWADMAGRSADLLTGHCVLRLRDGAIVAGAQDCSTTTVHFAEPGPVELDAYIATGEPLRVAGAFTLDGMGGWFVDRIDGDPSSVIGIGLPLLRRLLGDVGVGIAQLWIGAQLRADAIG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
169 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
175 2547132424 Nocardia nova SH22a Isolate Unclassified
176 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
177 2643221692 Nocardia sp. Root136 Isolate Unclassified
178 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
179 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
180 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
181 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
182 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
183 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
184 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
185 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
186 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
187 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
188 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
189 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
190 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
191 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
192 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
193 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
194 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
195 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
196 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
197 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
198 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
199 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
200 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.46
Metatranscriptomes 0
Isolates 9.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.66
Nodule 0
Rhizoplane 10.95
Rhizosphere 65.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0095262 3300045976 Bacteria 2713
2 JGI24735J21928_10022718 3300002067 Bacteria 1907
3 Ga0070658_10588440 3300005327 Bacteria 964
4 Ga0070670_100150281 3300005331 Bacteria 2016
5 Ga0068868_100005128 3300005338 Bacteria 9200
6 Ga0070668_100000209 3300005347 Bacteria 38393
7 Ga0070668_100002883 3300005347 Bacteria 12687
8 Ga0070669_100000551 3300005353 Bacteria 27840
9 Ga0070671_100006613 3300005355 Bacteria 9266
10 Ga0070671_100009609 3300005355 Bacteria 7770
11 Ga0070671_100077618 3300005355 Bacteria 2776
12 Ga0070667_100000027 3300005367 Bacteria 181315
13 Ga0070667_100012979 3300005367 Bacteria 6889
14 Ga0070714_100043129 3300005435 Bacteria 3813
15 Ga0070710_10023129 3300005437 Bacteria 3262
16 Ga0068853_100072062 3300005539 Bacteria 3010
17 Ga0068853_100192444 3300005539 Bacteria 1854
18 Ga0070665_100002857 3300005548 Bacteria 18676
19 Ga0070665_100003743 3300005548 Bacteria 16108
20 Ga0070665_100216020 3300005548 Bacteria 1918
21 Ga0068855_100212047 3300005563 Bacteria 2176
22 Ga0068859_100000806 3300005617 Bacteria 31838
23 Ga0068864_100530002 3300005618 Bacteria 1136
24 Ga0068864_100761542 3300005618 Bacteria 949
25 Ga0068863_100000309 3300005841 Bacteria 50254
26 Ga0068863_100014646 3300005841 Bacteria 7549
27 Ga0068858_100043923 3300005842 Bacteria 4144
28 Ga0068860_100000144 3300005843 Bacteria 116029
29 Ga0068862_100000177 3300005844 Bacteria 70443
30 Ga0068862_100002319 3300005844 Bacteria 16991
31 Ga0068862_100724648 3300005844 Bacteria 965
32 Ga0081455_10016155 3300005937 Bacteria 7217
33 Ga0075365_10016801 3300006038 Bacteria 4462
34 Ga0075365_10148207 3300006038 Bacteria 1632
35 Ga0075363_100008096 3300006048 Bacteria 4877
36 Ga0075364_10036985 3300006051 Bacteria 3158
37 Ga0075364_10214570 3300006051 Bacteria 1305
38 Ga0070715_10253995 3300006163 Bacteria 920
39 Ga0070716_100000791 3300006173 Bacteria 13599
40 Ga0075369_10015047 3300006186 Bacteria 3099
41 Ga0075369_10019275 3300006186 Bacteria 2784
42 Ga0075369_10050015 3300006186 Bacteria 1806
43 Ga0075370_10034271 3300006353 Bacteria 2847
44 Ga0068865_100001804 3300006881 Bacteria 12577
45 Ga0097620_100000806 3300006931 Bacteria 31838
46 Ga0099795_10035223 3300007788 Bacteria 1749
47 Ga0105250_10029217 3300009092 Bacteria 2219
48 Ga0105240_10304769 3300009093 Bacteria 1821
49 Ga0105247_10000113 3300009101 Bacteria 81617
50 Ga0105243_10000741 3300009148 Bacteria 31251
51 Ga0105248_10000054 3300009177 Bacteria 143260
52 Ga0105237_10000454 3300009545 Bacteria 58115
53 Ga0105238_10165236 3300009551 Bacteria 2189
54 Ga0105249_10000013 3300009553 Bacteria 283609
55 Ga0105249_10000919 3300009553 Bacteria 26058
56 Ga0105249_10476531 3300009553 Bacteria 1290
57 Ga0105239_10024230 3300010375 Bacteria 6683
58 Ga0157369_10705646 3300013105 Bacteria 1039
59 Ga0163162_10293683 3300013306 Bacteria 1757
60 Ga0163162_10324282 3300013306 Bacteria 1672
61 Ga0163163_10003647 3300014325 Bacteria 13090
62 Ga0163163_10160358 3300014325 Bacteria 2295
63 Ga0157379_10092280 3300014968 Bacteria 2716
64 Ga0157376_10017587 3300014969 Bacteria 5460
65 Ga0163161_10003273 3300017792 Bacteria 11385
66 Ga0163161_10242708 3300017792 Bacteria 1401
67 Ga0207653_10025247 3300025885 Bacteria 1900
68 Ga0207642_10000213 3300025899 Bacteria 17157
69 Ga0207710_10000141 3300025900 Bacteria 82771
70 Ga0207710_10002872 3300025900 Bacteria 7833
71 Ga0207688_10008318 3300025901 Bacteria 5642
72 Ga0207699_10218391 3300025906 Bacteria 1300
73 Ga0207645_10019554 3300025907 Bacteria 4439
74 Ga0207705_10668361 3300025909 Bacteria 808
75 Ga0207671_10057866 3300025914 Bacteria 2874
76 Ga0207671_10207196 3300025914 Bacteria 1533
77 Ga0207693_10001755 3300025915 Bacteria 19046
78 Ga0207663_10000247 3300025916 Bacteria 23908
79 Ga0207660_10091791 3300025917 Bacteria 2253
80 Ga0207681_10011620 3300025923 Bacteria 5412
81 Ga0207681_10013260 3300025923 Bacteria 5097
82 Ga0207650_10340034 3300025925 Bacteria 1232
83 Ga0207687_10003511 3300025927 Bacteria 10550
84 Ga0207644_10028262 3300025931 Bacteria 3880
85 Ga0207706_10002731 3300025933 Bacteria 17196
86 Ga0207686_10002291 3300025934 Bacteria 10490
87 Ga0207709_10000891 3300025935 Bacteria 22584
88 Ga0207709_10002303 3300025935 Bacteria 12096
89 Ga0207670_10534326 3300025936 Bacteria 956
90 Ga0207669_10000631 3300025937 Bacteria 15211
91 Ga0207704_10000979 3300025938 Bacteria 12677
92 Ga0207665_10002579 3300025939 Bacteria 12173
93 Ga0207711_10000396 3300025941 Bacteria 46050
94 Ga0207711_10004199 3300025941 Bacteria 12332
95 Ga0207667_10538364 3300025949 Bacteria 1182
96 Ga0207712_10000018 3300025961 Bacteria 317921
97 Ga0207712_10001400 3300025961 Bacteria 16463
98 Ga0207668_10001895 3300025972 Bacteria 12250
99 Ga0207668_10002855 3300025972 Bacteria 10123
100 Ga0207668_10026760 3300025972 Bacteria 3750
101 Ga0207640_10000692 3300025981 Bacteria 19625
102 Ga0207658_10000235 3300025986 Bacteria 58555
103 Ga0207658_10013148 3300025986 Bacteria 5652
104 Ga0207658_10052478 3300025986 Bacteria 3009
105 Ga0207703_10006481 3300026035 Bacteria 9344
106 Ga0207703_10723225 3300026035 Bacteria 947
107 Ga0207639_10063556 3300026041 Bacteria 2859
108 Ga0207639_10259234 3300026041 Bacteria 1520
109 Ga0207678_10024967 3300026067 Bacteria 5219
110 Ga0207708_10000975 3300026075 Bacteria 21463
111 Ga0207641_10002337 3300026088 Bacteria 17568
112 Ga0207641_10006207 3300026088 Bacteria 10108
113 Ga0207648_10003108 3300026089 Bacteria 17535
114 Ga0207676_10385818 3300026095 Bacteria 1305
115 Ga0207674_10060866 3300026116 Bacteria 3817
116 Ga0207675_100007493 3300026118 Bacteria 10310
117 Ga0207683_10000437 3300026121 Bacteria 38578
118 Ga0207698_10431648 3300026142 Bacteria 1267
119 Ga0268266_10002295 3300028379 Bacteria 20744
120 Ga0268266_10005349 3300028379 Bacteria 12003
121 Ga0268266_10081600 3300028379 Bacteria 2820
122 Ga0268265_10000147 3300028380 Bacteria 88026
123 Ga0268264_10000005 3300028381 Bacteria 934972
124 Ga0268264_10005637 3300028381 Bacteria 10610
125 Ga0307413_10047569 3300031824 Bacteria 2559
126 Ga0307413_10060428 3300031824 Bacteria 2333
127 Ga0307410_10019228 3300031852 Bacteria 4150
128 Ga0307407_10044611 3300031903 Bacteria 2500
129 Ga0307412_10354054 3300031911 Bacteria 1180
130 Ga0307416_100081054 3300032002 Bacteria 2742
131 Ga0307411_10240808 3300032005 Bacteria 1416
132 Ga0307415_100000828 3300032126 Bacteria 14155
133 Ga0373961_0080778 3300035241 Bacteria 1023
134 Ga0373935_0562915 3300035692 Bacteria 832
135 Ga0436365_1367211 3300039437 Bacteria 1844
136 Ga0439461_0027062 3300041410 Bacteria 1173
137 Ga0439466_0012111 3300041411 Bacteria 3183
138 Ga0439466_0018622 3300041411 Bacteria 2490
139 Ga0439465_0023382 3300041413 Bacteria 1945
140 Ga0439442_018252 3300042002 Bacteria 1451
141 Ga0439445_0004129 3300042004 Bacteria 3281
142 Ga0439434_0041146 3300042435 Bacteria 1420
143 Ga0466972_0009319 3300044658 Bacteria 4936
144 Ga0466972_0009324 3300044658 Bacteria 4934
145 Ga0466972_0020135 3300044658 Bacteria 3334
146 Ga0466972_0049265 3300044658 Bacteria 2035
147 Ga0466965_0004116 3300044683 Bacteria 6462
148 Ga0466964_0010917 3300044706 Bacteria 3432
149 Ga0466971_0111119 3300044719 Bacteria 1265
150 Ga0466971_0204990 3300044719 Bacteria 931
151 Ga0466968_0007336 3300044735 Bacteria 4187
152 Ga0466970_0004739 3300044765 Bacteria 6717
153 Ga0466970_0021940 3300044765 Bacteria 3331
154 Ga0466960_0000865 3300044901 Bacteria 10697
155 Ga0466959_0030113 3300045049 Bacteria 4019
156 Ga0466958_0020302 3300045836 Bacteria 3873
157 Ga0466967_0172484 3300045976 Bacteria 2036
158 Ga0466967_0192649 3300045976 Bacteria 1927
159 Ga0466967_0234580 3300045976 Bacteria 1748
160 Ga0495629_0105148 3300046459 Bacteria 1969
161 Ga0495638_0003138 3300046460 Bacteria 13082
162 Ga0495607_0021548 3300046501 Bacteria 4054
163 Ga0495583_0030314 3300046506 Bacteria 2636
164 Ga0495606_0148266 3300046507 Bacteria 1379
165 Ga0495648_0005845 3300046524 Bacteria 10128
166 Ga0495672_0012803 3300047320 Bacteria 5827
167 Ga0495672_0088017 3300047320 Bacteria 1713
168 Ga0495672_0089732 3300047320 Bacteria 1691
169 Ga0495683_0000534 3300047323 Bacteria 28829
170 Ga0495686_0001467 3300047472 Bacteria 25670
171 Ga0496100_0006564 3300048903 Bacteria 6353
172 Ga0496100_0066136 3300048903 Bacteria 2397
173 Ga0496100_0090809 3300048903 Bacteria 2083
174 Ga0496101_0000008 3300048904 Bacteria 309720
175 Ga0496101_0057791 3300048904 Bacteria 2807
176 Ga0496101_0714861 3300048904 Bacteria 791
177 Ga0496101_0781978 3300048904 Bacteria 753
178 Ga0496102_0000063 3300048905 Bacteria 164782
179 Ga0496102_0000956 3300048905 Bacteria 27223
180 Ga0496102_0004473 3300048905 Bacteria 11797
181 Ga0496102_0151710 3300048905 Bacteria 2178
182 Ga0496103_0000407 3300048906 Bacteria 38157
183 Ga0496103_0001339 3300048906 Bacteria 16650
184 Ga0496103_0074126 3300048906 Bacteria 2133
185 Ga0496104_0022788 3300048907 Bacteria 5753
186 Ga0496105_0037757 3300048908 Bacteria 3978
187 Ga0496106_0000621 3300048909 Bacteria 25372
188 Ga0496106_0006140 3300048909 Bacteria 8886
189 Ga0496107_0002422 3300048910 Bacteria 12087
190 Ga0496107_0003489 3300048910 Bacteria 10518
191 Ga0496107_0254955 3300048910 Bacteria 1305
192 Ga0496108_0212355 3300048911 Bacteria 1680
193 Ga0496110_0038265 3300048913 Bacteria 4173
194 Ga0496111_0060438 3300048914 Bacteria 2747
195 Ga0496111_0113095 3300048914 Bacteria 2000
196 Ga0496113_0011146 3300048916 Bacteria 5981
197 Ga0496114_0003036 3300048917 Bacteria 12860
198 Ga0496114_0237200 3300048917 Bacteria 1603
199 Ga0496115_0686274 3300048918 Bacteria 806
200 Ga0496115_0760593 3300048918 Bacteria 757
201 Ga0496115_1117790 3300048918 Bacteria 596
202 Ga0496116_0006797 3300048919 Bacteria 10287
203 Ga0496117_0001333 3300048920 Bacteria 36307
204 Ga0496118_0001530 3300048921 Bacteria 34430
205 Ga0496119_0000127 3300048922 Bacteria 107730
206 Ga0496119_0007685 3300048922 Bacteria 9652
207 Ga0496120_0002389 3300048923 Bacteria 19126
208 Ga0496120_0003388 3300048923 Bacteria 14585
209 Ga0496121_0000120 3300048924 Bacteria 174571
210 Ga0496121_0001494 3300048924 Bacteria 39376
211 Ga0496122_0120178 3300048925 Bacteria 1696
212 Ga0496124_0214401 3300048927 Bacteria 1454
213 Ga0496124_0265106 3300048927 Bacteria 1261
214 Ga0496125_0024071 3300048928 Bacteria 5607
215 Ga0496126_0000417 3300048929 Bacteria 86182
216 Ga0496126_0010482 3300048929 Bacteria 9709
217 Ga0496126_0011585 3300048929 Bacteria 9102
218 Ga0496126_0151090 3300048929 Bacteria 1990
219 Ga0501032_0002010 3300049569 Bacteria 16021
220 Ga0501034_0006664 3300049571 Bacteria 12385
221 Ga0501034_0123068 3300049571 Bacteria 2580
222 Ga0501036_0007862 3300049572 Bacteria 8722
223 Ga0501037_0000248 3300049573 Bacteria 46058
224 Ga0501038_0003725 3300049574 Bacteria 14200
225 Ga0501039_0000242 3300049575 Bacteria 39738
226 Ga0501043_0000185 3300049579 Bacteria 56468
227 Ga0501070_0003818 3300049586 Bacteria 13002
228 Ga0501070_0130741 3300049586 Bacteria 2074
229 Ga0501073_0010940 3300049589 Bacteria 6638
230 Ga0501073_0445709 3300049589 Bacteria 895
231 Ga0501044_0020455 3300049823 Bacteria 7067
232 Ga0501044_0064420 3300049823 Bacteria 3742
233 nmdc:mga03683_132746_c1 3300050489 Bacteria 1115
234 nmdc:mga03n38_33942_c1 3300050490 Bacteria 2175
235 nmdc:mga03n38_59137_c1 3300050490 Bacteria 1739
236 nmdc:mga00v17_35911_c1 3300050491 Bacteria 2952
237 nmdc:mga00v17_74780_c1 3300050491 Bacteria 2106
238 nmdc:mga0yw44_233215_c1 3300050492 Bacteria 1222
239 nmdc:mga0yw44_376512_c1 3300050492 Bacteria 958
240 nmdc:mga07m45_33647_c1 3300050496 Bacteria 2847
241 nmdc:mga07m45_51525_c1 3300050496 Bacteria 2321
242 nmdc:mga0sz30_126427_c1 3300050516 Bacteria 1125
243 nmdc:mga0sz30_49914_c1 3300050516 Bacteria 1773
244 nmdc:mga0sz30_7703_c1 3300050516 Bacteria 4045
245 Ga0500610_0000272 3300053079 Bacteria 15730
246 Ga0500635_0003788 3300053080 Bacteria 3834
247 Ga0500643_004550 3300053087 Bacteria 6220
248 Ga0500643_006889 3300053087 Bacteria 4675
249 Ga0500644_0232002 3300053088 Bacteria 773
250 Ga0500556_0016100 3300053104 Bacteria 2320
251 Ga0500652_000809 3300053131 Bacteria 10494
252 Ga0500658_0035536 3300053134 Bacteria 1973
253 Ga0500559_0173875 3300053136 Bacteria 1013
254 Ga0500616_0070360 3300053153 Bacteria 1786
255 Ga0500627_0018033 3300053158 Bacteria 2786
256 Ga0500645_000269 3300053730 Bacteria 37477
257 2523385723 2523231044 Bacteria 6434991
258 2548693410 2547132424 Bacteria 8348532
259 2552106128 2551306166 Bacteria 9731570
260 2644515142 2643221692 Bacteria 7282860
261 2644635868 2643221715 Bacteria 6671032
262 2738708378 2738541274 Bacteria 6909446
263 2739236533 2738543011 Bacteria 5731169
264 2739334909 2738543028 Bacteria 6917070
265 2739366954 2738543034 Bacteria 6084756
266 2753039087 2751185725 Bacteria 5740550
267 2753327598 2751185792 Bacteria 5739090
268 2889306019 2889300758 Bacteria 5690814
269 2902799353 2902792274 Bacteria 7270173
270 2902800719 2902799365 Bacteria 5419524
271 2902813325 2902810491 Bacteria 6794147
272 2904765955 2904765812 Bacteria 5369154
273 2904773555 2904770941 Bacteria 5580202
274 2908812280 2908811453 Bacteria 5478616
275 2915362643 2915358134 Bacteria 6050864
276 2919424154 2919420072 Bacteria 5390363
277 2919437262 2919432681 Bacteria 5390474
278 2919718524 2919713450 Bacteria 7431245
279 2932398333 2932398195 Bacteria 3847976
280 2939744156 2939743619 Bacteria 5762299
281 2974317995 2974315732 Bacteria 4602776
282 8054475117 8054472261 Bacteria 7464355
283 8055177111 8055172936 Bacteria 9305943
284 Ga0466967_0095262
285 JGI24735J21928_10022718
286 Ga0070658_10588440
287 Ga0070670_100150281
288 Ga0068868_100005128
289 Ga0070668_100000209
290 Ga0070668_100002883
291 Ga0070669_100000551
292 Ga0070671_100006613
293 Ga0070671_100009609
294 Ga0070671_100077618
295 Ga0070667_100000027
296 Ga0070667_100012979
297 Ga0070714_100043129
298 Ga0070710_10023129
299 Ga0068853_100072062
300 Ga0068853_100192444
301 Ga0070665_100002857
302 Ga0070665_100003743
303 Ga0070665_100216020
304 Ga0068855_100212047
305 Ga0068859_100000806
306 Ga0068864_100530002
307 Ga0068864_100761542
308 Ga0068863_100000309
309 Ga0068863_100014646
310 Ga0068858_100043923
311 Ga0068860_100000144
312 Ga0068862_100000177
313 Ga0068862_100002319
314 Ga0068862_100724648
315 Ga0081455_10016155
316 Ga0075365_10016801
317 Ga0075365_10148207
318 Ga0075363_100008096
319 Ga0075364_10036985
320 Ga0075364_10214570
321 Ga0070715_10253995
322 Ga0070716_100000791
323 Ga0075369_10015047
324 Ga0075369_10019275
325 Ga0075369_10050015
326 Ga0075370_10034271
327 Ga0068865_100001804
328 Ga0097620_100000806
329 Ga0099795_10035223
330 Ga0105250_10029217
331 Ga0105240_10304769
332 Ga0105247_10000113
333 Ga0105243_10000741
334 Ga0105248_10000054
335 Ga0105237_10000454
336 Ga0105238_10165236
337 Ga0105249_10000013
338 Ga0105249_10000919
339 Ga0105249_10476531
340 Ga0105239_10024230
341 Ga0157369_10705646
342 Ga0163162_10293683
343 Ga0163162_10324282
344 Ga0163163_10003647
345 Ga0163163_10160358
346 Ga0157379_10092280
347 Ga0157376_10017587
348 Ga0163161_10003273
349 Ga0163161_10242708
350 Ga0207653_10025247
351 Ga0207642_10000213
352 Ga0207710_10000141
353 Ga0207710_10002872
354 Ga0207688_10008318
355 Ga0207699_10218391
356 Ga0207645_10019554
357 Ga0207705_10668361
358 Ga0207671_10057866
359 Ga0207671_10207196
360 Ga0207693_10001755
361 Ga0207663_10000247
362 Ga0207660_10091791
363 Ga0207681_10011620
364 Ga0207681_10013260
365 Ga0207650_10340034
366 Ga0207687_10003511
367 Ga0207644_10028262
368 Ga0207706_10002731
369 Ga0207686_10002291
370 Ga0207709_10000891
371 Ga0207709_10002303
372 Ga0207670_10534326
373 Ga0207669_10000631
374 Ga0207704_10000979
375 Ga0207665_10002579
376 Ga0207711_10000396
377 Ga0207711_10004199
378 Ga0207667_10538364
379 Ga0207712_10000018
380 Ga0207712_10001400
381 Ga0207668_10001895
382 Ga0207668_10002855
383 Ga0207668_10026760
384 Ga0207640_10000692
385 Ga0207658_10000235
386 Ga0207658_10013148
387 Ga0207658_10052478
388 Ga0207703_10006481
389 Ga0207703_10723225
390 Ga0207639_10063556
391 Ga0207639_10259234
392 Ga0207678_10024967
393 Ga0207708_10000975
394 Ga0207641_10002337
395 Ga0207641_10006207
396 Ga0207648_10003108
397 Ga0207676_10385818
398 Ga0207674_10060866
399 Ga0207675_100007493
400 Ga0207683_10000437
401 Ga0207698_10431648
402 Ga0268266_10002295
403 Ga0268266_10005349
404 Ga0268266_10081600
405 Ga0268265_10000147
406 Ga0268264_10000005
407 Ga0268264_10005637
408 Ga0307413_10047569
409 Ga0307413_10060428
410 Ga0307410_10019228
411 Ga0307407_10044611
412 Ga0307412_10354054
413 Ga0307416_100081054
414 Ga0307411_10240808
415 Ga0307415_100000828
416 Ga0373961_0080778
417 Ga0373935_0562915
418 Ga0436365_1367211
419 Ga0439461_0027062
420 Ga0439466_0012111
421 Ga0439466_0018622
422 Ga0439465_0023382
423 Ga0439442_018252
424 Ga0439445_0004129
425 Ga0439434_0041146
426 Ga0466972_0009319
427 Ga0466972_0009324
428 Ga0466972_0020135
429 Ga0466972_0049265
430 Ga0466965_0004116
431 Ga0466964_0010917
432 Ga0466971_0111119
433 Ga0466971_0204990
434 Ga0466968_0007336
435 Ga0466970_0004739
436 Ga0466970_0021940
437 Ga0466960_0000865
438 Ga0466959_0030113
439 Ga0466958_0020302
440 Ga0466967_0172484
441 Ga0466967_0192649
442 Ga0466967_0234580
443 Ga0495629_0105148
444 Ga0495638_0003138
445 Ga0495607_0021548
446 Ga0495583_0030314
447 Ga0495606_0148266
448 Ga0495648_0005845
449 Ga0495672_0012803
450 Ga0495672_0088017
451 Ga0495672_0089732
452 Ga0495683_0000534
453 Ga0495686_0001467
454 Ga0496100_0006564
455 Ga0496100_0066136
456 Ga0496100_0090809
457 Ga0496101_0000008
458 Ga0496101_0057791
459 Ga0496101_0714861
460 Ga0496101_0781978
461 Ga0496102_0000063
462 Ga0496102_0000956
463 Ga0496102_0004473
464 Ga0496102_0151710
465 Ga0496103_0000407
466 Ga0496103_0001339
467 Ga0496103_0074126
468 Ga0496104_0022788
469 Ga0496105_0037757
470 Ga0496106_0000621
471 Ga0496106_0006140
472 Ga0496107_0002422
473 Ga0496107_0003489
474 Ga0496107_0254955
475 Ga0496108_0212355
476 Ga0496110_0038265
477 Ga0496111_0060438
478 Ga0496111_0113095
479 Ga0496113_0011146
480 Ga0496114_0003036
481 Ga0496114_0237200
482 Ga0496115_0686274
483 Ga0496115_0760593
484 Ga0496115_1117790
485 Ga0496116_0006797
486 Ga0496117_0001333
487 Ga0496118_0001530
488 Ga0496119_0000127
489 Ga0496119_0007685
490 Ga0496120_0002389
491 Ga0496120_0003388
492 Ga0496121_0000120
493 Ga0496121_0001494
494 Ga0496122_0120178
495 Ga0496124_0214401
496 Ga0496124_0265106
497 Ga0496125_0024071
498 Ga0496126_0000417
499 Ga0496126_0010482
500 Ga0496126_0011585
501 Ga0496126_0151090
502 Ga0501032_0002010
503 Ga0501034_0006664
504 Ga0501034_0123068
505 Ga0501036_0007862
506 Ga0501037_0000248
507 Ga0501038_0003725
508 Ga0501039_0000242
509 Ga0501043_0000185
510 Ga0501070_0003818
511 Ga0501070_0130741
512 Ga0501073_0010940
513 Ga0501073_0445709
514 Ga0501044_0020455
515 Ga0501044_0064420
516 nmdc:mga03683_132746_c1
517 nmdc:mga03n38_33942_c1
518 nmdc:mga03n38_59137_c1
519 nmdc:mga00v17_35911_c1
520 nmdc:mga00v17_74780_c1
521 nmdc:mga0yw44_233215_c1
522 nmdc:mga0yw44_376512_c1
523 nmdc:mga07m45_33647_c1
524 nmdc:mga07m45_51525_c1
525 nmdc:mga0sz30_126427_c1
526 nmdc:mga0sz30_49914_c1
527 nmdc:mga0sz30_7703_c1
528 Ga0500610_0000272
529 Ga0500635_0003788
530 Ga0500643_004550
531 Ga0500643_006889
532 Ga0500644_0232002
533 Ga0500556_0016100
534 Ga0500652_000809
535 Ga0500658_0035536
536 Ga0500559_0173875
537 Ga0500616_0070360
538 Ga0500627_0018033
539 Ga0500645_000269
540 2523385723
541 2548693410
542 2552106128
543 2644515142
544 2644635868
545 2738708378
546 2739236533
547 2739334909
548 2739366954
549 2753039087
550 2753327598
551 2889306019
552 2902799353
553 2902800719
554 2902813325
555 2904765955
556 2904773555
557 2908812280
558 2915362643
559 2919424154
560 2919437262
561 2919718524
562 2932398333
563 2939744156
564 2974317995
565 8054475117
566 8055177111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

3

222

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9103 2 198
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.8987 1 202
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.8955 2 200
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.8945 2 198
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.8941 1 202
ID Description Score Start End Superfamily
af_P9WK27_1_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9802 1 197 3.90.950.10
af_P9WK27_1_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9562 1 197 3.90.950.10
af_A0A0R4IRZ4_38_132_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.928 114 131 2.60.40.10
af_F4K330_90_229_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9162 72 198 3.90.950.10
af_Q54TC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9049 2 198 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A7I7RI64-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9928 17 210 GO:0005737
GO:0009117
GO:0106379
AF-A0A1S1NHS3-F1-model_v4 Septum formation inhibitor Maf 0.9864 33 207 GO:0047429
AF-A4TF31-F1-model_v4 Nucleoside triphosphate pyrophosphatase (EC 3.6.1.9) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9862 1 207 GO:0005737
GO:0009117
GO:0106379
AF-A0A2S9FDR3-F1-model_v4 Septum formation inhibitor Maf 0.9855 1 170 GO:0047429
AF-A0A2S9FDR3-F1-model_v4 Septum formation inhibitor Maf 0.9798 1 170 GO:0047429

Map